2PYOB

Drosophila nucleosome core
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (147-MER)
publication title Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2pyoB00
4H9RB 4HGAC 1H3OB 1P3OC 1P3PC 3RELB 4JJND 1AOIB 5B0YA 4XUJC 1P3LD 3AN2D 5BNVA 4X23C 4R8PC 4KHAA 2F8ND 1HTAA 3AZJB 5E5AD 3AZGD 2HIOD 4H9PB 3VH5T 3WTPA 3MGQC 3X1TC 3LZ1A 5BS7A 5CPJD 5B33D 5DNMA 3B0BA 5CP6A 3NQUA 1HQ3B 4ZUXC 1KX5A 2AROD 2BYKA 3LJAD 1P3FA 3B6GD 4KGCC 2JSSA 3REIB 3AV2C 3KUYA 4WU8A 4J8WA 2F8NK 5B2JD 1P3BA 3WA9C 5B1LC 1P3AB 5GT3D 4QLCD 1U35C 2NZDD 3AYWC 5AVCA 4H9NB 3A6NA 5B1MD 4H9SA 3MGSD 3B6FB 1M19A 4AWLC 1ID3C 1F66C 1TZYD 1P3MB 2F8NG 1EQZC 4CSRB 3MGPD 3VH6A 5AVBA 3KWQD 5BNXA 4J8XD 5B24D 5GT0B 4XZQA 5B1MB 5B0YC 3W96A 3AZHD 1P34A 3AZKD 3AZMC 1KX3D 5FUGB 1P3GB 3KWQB 1P3KB 3W99D 5AY8C 1ZLAD 3UTAA 5BS7C 2HUEB 3TU4A 1R4VA 1S32A 4HGAB 3B0CW 3AZLD 5DNMC 1P3OB 5B40D 5CP6C 1P3PB 4KUDD 1KX5C 1P3FC 4XUJB 3REKA 4CAYB 4WU8C 1M18D 4X23B 5AV6A 4R8PB 1P3ID 5F99A 4ZUXD 4DRBA 1P3BC 3AZFD 5BO0A 5GSUC 3MGQB 4J8VA 5DNNC 3NQJB 2PYOD 3X1TB 5AVCC 3A6NC 2YFVB 4H9SC 1BFMA 1N1JA 1M19C 4ZUXB 1M1AA 4CAYA 4KGCB 3AV2B 5CPKA 1BH8A 5AVBC 4YS3D 3AZID 3LZ0A 2YFWB 3WA9B 3W97A 3W96C 1P34C 5B1LB 3NQJA 1U35B 4WU9D 3LELD 3AYWB 3MGRD 5B32A 4AWLB 1ID3B 1F66B 2F8NH 3AZNA 3C1CD 3AV2A 3AV1A 3UTAC 3KXBD 1EQZB 4J8UA 1Q9CA 3UTBD 2CV5A 1S32C 4NE5A 3O62A 3WKJC 5CPIA 3WTPD 3LZ1D 4M6BA 5B0YB 3REKC 3B0DC 5BT1D 5BNVB 3X1UC 3RELD 5AV6C 3AZMB 1AOID 5F99C 4E45A 4KHAB 3X1SA 3X1VA 3KUYD 4J8WD 5GXQA 2NQBA 3WTPB 4J8VC 4LD9A 3LZ1B 3AZJD 3REHA 4G92C 5DNMB 5CP6B 3R45B 4G91C 3NQUB 5B31A 3AZEC 1KX5B 4WNNA 2BYKB 1P3FB 1M1AC 5CPKC 3KUYB 4WU8B 4J8WB 5C3IC 3AZMA 3LZ0C 2BYMA 1HQ3D 4YM6C 1P3BB 3REID 3W97C 5AY8A 5GSUB 1TAFA 5JRGA 3W98A 3MVDA 5AVCB 3A6NB 4XZQD 3R45A 1P3AD 1M19B 5B32C 1WWIA 3AZNC 3AV1C 4Z5TA 2RVQD 5AVBB 4J8UC 2CV5C 3UT9A 3B6FD 5B2IA 3O62C 5CPIC 5BNXB 1P3MD 4XZQB 3MNNA 3W96B 4NE3A 5AV9A 3TU4D 5GSUA 1P34B 5DNNA 2CWEA 3REJA 5B0ZA 5GT0D 3AFAA 2FJ7A 5JA4B 3X1VC 3C1BA 3X1SC 5AV5A 5KDMA 5GXQC 2NQBC 1BH9A 4LD9C 3UTAB 3TU4B 4Z66C 1S32B 1P3GD 3REHC 1P3KD 3WKJB 4Z2MG 5B31C 3REKB 3B0DB 1P3OD 4JJNA 1P3PD 5AV6B 5JA4A 1P3LA 5F99B 4XUJD 3AN2A 5BO0B 4X23D 4R8PD 3W98C 5JRGC 4J8VB 3MVDC 1ULYA 5AV8C 2HIOA 3WKJA 1N1JB 3MGQD 5CPJA 4G91B 3X1TD 5B33A 1M1AB 5CPKB 1BH8B 4Z5TC 3X1UA 5C3IB 3UT9C 3LZ0B 3WAAC 5B2IC 2AROA 3LJAA 3B6GA 4KGCD 3AV2D 3W97B 3MNNC 4E44A 5AV9C 5B2JA 3REJC 5B0ZC 3WA9D 3AFAC 2FJ7C 5GT3A 3C1BC 5B1LD 2NZDA 5B32B 5AV5C 4WZSB 3AZEA 1U35D 3AYWD 3AZNB 3AV1B 3KSYA 3MGSA 1KX4C 4J8UB 2CV5B 1ID3D 1F66D 4YM6A 3O62B 1TZYA 5CPIB 3MGPA 1EQZD 5B24A 4JJNC 3VH5A 1P3LC 3AZHA 4UUZA 5B0YD 3AN2C 4H9QA 3X1SB 3X1VB 3AZKA 3WTPE 1KX3A 5B32G 5G49A 5GXQB 3AZMD 2NQBB 3VH6T 4LD9B 4Z66B 5E5AC 3REHB 3AZGC 3W99A 2HIOC 5AY8D 4Z2MH 1ZLAA 5CPJC 5JRGD 5B31B 5B33C 1JFIA 4WNNB 5B40A 2LY8A 5DNMD 5CP6D 2BYMB 2AROC 3LJAC 1KX5D 3B6GC 1P3FD 4DRAA 1M18A 4WU8D 5AY8B 1P3IA 5B2JC 3W98B 1A7WA 1TAFB 5JRGB 3MVDB 3AZFA 1P3BD 4EO5C 4Z66A 5GT3C 4QLCC 2PYOA 5GSUD 2NZDC 5DNND 5B1MC 5B31G 5AVCD 3A6ND 3MGSC 4Z5TB 1M19D 3UT9B 3WAAB 5B2IB 1TZYC 5CHLB 3MGPC 4ZBJC 3AZIA 3MNNB 5AVBD 5AV9B 3KWQC 2IO5C 5DNNB 3REJB 4J8XC 5B24C 5AV8A 5B0ZB 3AFAB 3AZHC 2FJ7B 3W96D 1P34D 3C1BB 3AZKC 4WU9A 3LELA 5AV5B 5KDMB 1KX3C 3MGRA 1BH9B 1KX4B 3WAAA 4H9OA 3W99C 3C1CA 1ZLAC 3KXBA 3UTAD 3UTBA 3AZLC 1S32D 5B40C 4KUDC 3WKJD 4JJNB 1P3LB 4H9RA 1H3OA 3REKD 3AN2B 1M18C 3RELA 1AOIA 1P3IC 3X1UD 5AV6D 3AZFC 5F99D 1KX4A 2F8NB 5E5AB 2L5AA 3AZGB 2HIOB 2PYOC 4J8VD 1F1EA 5CPJB 5B33B 3AZJA 4WV4B 4H9PA 3X1UB 2AROB 3LJAB 3AZED 3B6GB 1M1AD 4YS3C 3AZIC 5CPKD 1HQ3A 3VH6W 3LZ0D 5B2JB 2F8NA 4YM6D 3REIA 1B6WA 4EO5B 5E5AA 3W97D 4G92B 3AZGA 5GT3B 4QLCB 4WU9C 3LELC 2NZDB 3AZEB 3MGRC 3MGSB 1P3AA 5B32D 4YM6B 1TZYB 3C1CC 4H9NA 3KXBC 3AZND 3AV1D 3MGPB 4ZBJB 3UTBC 3B6FA 4J8UD 2CV5D 2IO5B 3O62D 3WTPC 5B24B 4J8XB 1P3MA 5CPID 4CSRA 3LZ1C 3AZHB 4NFTA 5BT1C 4UUZB 4QLCA 4H9QB 3AZKB 3RELC 5GT0A 1AOIC 1KX3B 5B1MA 5G49B 3X1VD 3X1SD 3KUYC 4J8WC 3W99B 5GXQD 1ZLAB 2NQBD 4LD9D 5FUGA 1JFIB 3AZJC 1P3GA 3KWQA 3AZLB 4Z66D 1P3KA 3REHD 5B40B 4J8XA 4KUDB 1B67A 5B31D 1P3OA 3V9RB 1P3PA 1M18B 1HQ3C 1P3IB 4XUJA 3AZFB 3REIC 4X23A 4R8PA 2PYOB 3W98D 3MVDD 3AZLA 5AV8D 4XZQC 1P3AC 3VH5W 4KUDA 3MGQA 3X1TA 1KU5A 2YFVA 3V9RA 2RVQC 3AZIB 4YS3B 3B6FC 4Z5TD 4ZUXA 3UT9D 3WAAD 5B2ID 4KGCA 5AV8B 1P3MC 3TU4C 3MNND 5AV9D 3B0CT 3REJD 2YFWA 3LELB 4WU9B 3WA9A 5GT0C 5B0ZD 3MGRB 3AFAD 4NE6A 2FJ7D 5B1LA 3C1BD 1U35A 4H9OB 5AV5D 3AYWA 3C1CB 3KXBB 4YS3A 1WWSA 1P3GC 3UTBB 1KX4D 1ID3A 1F66A 1P3KC 1EQZA 2HUEC
chains in the Genus database with same CATH superfamily
4H9RB 4HGAC 1H3OB 1P3OC 1P3PC 2Y2OA 3RELB 4JJND 1AOIB 3F6TA 5B0YA 4XUJC 1P3LD 3AN2D 5BNVA 4X23C 4R8PC 4KHAA 2F8ND 1HTAA 3AZJB 5E5AD 3AZGD 2HIOD 4H9PB 3VH5T 3WTPA 3MGQC 3X1TC 3LZ1A 5BS7A 5CPJD 5B33D 5DNMA 3B0BA 5CP6A 3NQUA 1HQ3B 4ZUXC 1KX5A 2AROD 2BYKA 3LJAD 1P3FA 3B6GD 4KGCC 2JSSA 3REIB 3AV2C 3KUYA 4WU8A 4J8WA 2F8NK 2J8PA 3FDDA 5B2JD 1P3BA 3WA9C 5B1LC 1P3AB 5GT3D 4QLCD 1U35C 2NZDD 3AYWC 5AVCA 4H9NB 3A6NA 5B1MD 4H9SA 3MGSD 3B6FB 1M19A 4AWLC 1ID3C 1F66C 1TZYD 1P3MB 2F8NG 1EQZC 3H0MC 4CSRB 3VH6A 5AVBA 3MGPD 3KWQD 5BNXA 4J8XD 5B24D 5GT0B 4XZQA 5B1MB 5B0YC 3W96A 3AZHD 1P34A 3AZKD 1T3UA 3AZMC 1KX3D 5FUGB 1P3GB 3KWQB 1P3KB 3W99D 5AY8C 1ZLAD 3UTAA 5BS7C 3EPHA 2HUEB 3TU4A 1R4VA 1S32A 4HGAB 3B0CW 3AZLD 5DNMC 1P3OB 5B40D 5CP6C 1P3PB 4KUDD 1KX5C 1P3FC 4XUJB 3REKA 4CAYB 4WU8C 1M18D 4X23B 5AV6A 4R8PB 1P3ID 5F99A 4ZUXD 4DRBA 1P3BC 3AZFD 5BO0A 2UWXA 2Y2GA 3IP4C 5GSUC 3MGQB 5DNNC 3NQJB 4J8VA 3X1TB 2PYOD 5AVCC 3A6NC 2YFVB 4H9SC 1BFMA 1N1JA 1M19C 2ZM5A 4ZUXB 2Y2KA 1M1AA 4CAYA 4KGCB 3AV2B 5CPKA 1BH8A 5AVBC 4YS3D 3AZID 3LZ0A 2YFWB 3WA9B 3W97A 3W96C 1P34C 5B1LB 3NQJA 1U35B 4WU9D 3LELD 3AYWB 3MGRD 2Y2IA 2XD5A 5B32A 4AWLB 1ID3B 1F66B 2F8NH 3AZNA 3C1CD 3AV2A 3AV1A 3UTAC 3KXBD 1EQZB 4J8UA 1Q9CA 3UTBD 4UPKA 2CV5A 1S32C 4NE5A 3O62A 3WKJC 5CPIA 3WTPD 3LZ1D 4M6BA 5B0YB 3REKC 3B0DC 5BT1D 2ZY4A 5BNVB 3X1UC 3RELD 5AV6C 3AZMB 1AOID 5F99C 2DQNC 4E45A 4KHAB 3X1SA 3X1VA 3KUYD 4J8WD 5GXQA 2NQBA 3WTPB 4J8VC 4LD9A 2ZY2A 3LZ1B 3AZJD 3REHA 4G92C 5DNMB 5CP6B 3R45B 4G91C 3NQUB 5B31A 3AZEC 1KX5B 4WNNA 2BYKB 1P3FB 1M1AC 5CPKC 3KUYB 4WU8B 4J8WB 3P5JB 5C3IC 3AZMA 3LZ0C 2BYMA 1HQ3D 4YM6C 2G5HC 1P3BB 3REID 3W97C 5AY8A 5GSUB 1TAFA 5JRGA 3W98A 3MVDA 5AVCB 3A6NB 4XZQD 3R45A 1P3AD 1M19B 5B32C 2DF4C 1WWIA 3AZNC 3AV1C 4Z5TA 2RVQD 5AVBB 4J8UC 2CV5C 3UT9A 3B6FD 5B2IA 3O62C 5CPIC 5BNXB 1P3MD 4XZQB 3MNNA 3W96B 4NE3A 5AV9A 3TU4D 5GSUA 1P34B 5DNNA 2CWEA 3REJA 5B0ZA 5GT0D 3AFAA 2FJ7A 5JA4B 3X1VC 3C1BA 2ZY5A 3X1SC 5AV5A 5KDMA 5GXQC 2NQBC 1BH9A 4LD9C 3UTAB 3TU4B 4Z66C 1S32B 1P3GD 3REHC 1P3KD 3WKJB 4Z2MG 5B31C 3REKB 3B0DB 2XD1A 1P3OD 4JJNA 1P3PD 5AV6B 5JA4A 1P3LA 5F99B 4XUJD 3AN2A 5BO0B 4X23D 4R8PD 3W98C 5JRGC 4J8VB 3MVDC 1ULYA 5AV8C 2HIOA 3WKJA 1N1JB 3MGQD 5CPJA 4G91B 3X1TD 5B33A 1M1AB 1W2EA 5CPKB 1BH8B 4Z5TC 5C3IB 3X1UA 3UT9C 3LZ0B 3WAAC 5B2IC 2AROA 3LJAA 3EG5B 2JE5A 3B6GA 4KGCD 3AV2D 3W97B 3MNNC 4E44A 5AV9C 5B2JA 3REJC 5B0ZC 3WA9D 3AFAC 2FJ7C 5GT3A 3C1BC 5B1LD 2BG1A 2NZDA 5B32B 5AV5C 4WZSB 3AZEA 1U35D 3AYWD 3AZNB 3AV1B 3KSYA 2FFFB 3MGSA 1KX4C 4J8UB 2CV5B 1ID3D 1F66D 4YM6A 3O62B 1TZYA 5CPIB 3MGPA 1EQZD 5B24A 4JJNC 3VH5A 1P3LC 3AZHA 4UUZA 5B0YD 3AN2C 4H9QA 3X1SB 3X1VB 3AZKA 3WTPE 1KX3A 5B32G 5G49A 5GXQB 3AZMD 2NQBB 3VH6T 4LD9B 4Z66B 5E5AC 3REHB 3AZGC 3W99A 2HIOC 5AY8D 4Z2MH 1ZLAA 5CPJC 5JRGD 5B31B 5B33C 1JFIA 4WNNB 5B40A 2LY8A 5DNMD 1Z2CB 5CP6D 2BYMB 2AROC 3LJAC 1KX5D 3B6GC 1P3FD 4DRAA 1M18A 4WU8D 5AY8B 1P3IA 2Y2PA 5B2JC 3W98B 1A7WA 1TAFB 5JRGB 3MVDB 3AZFA 1P3BD 2Y2JA 3KFUG 4EO5C 4Z66A 5GT3C 4QLCC 2PYOA 5GSUD 2NZDC 5DNND 5B1MC 5B31G 5AVCD 3A6ND 3MGSC 4Z5TB 1M19D 3UT9B 3WAAB 5B2IB 1TZYC 5CHLB 2Y2NA 3MGPC 4ZBJC 3AZIA 3MNNB 5AVBD 5AV9B 3KWQC 2IO5C 5DNNB 3REJB 4J8XC 5B24C 5AV8A 5B0ZB 3AFAB 3AZHC 2FJ7B 3W96D 1P34D 3C1BB 3EPLA 3AZKC 4WU9A 3LELA 5AV5B 5KDMB 3H0LC 1KX3C 3MGRA 1BH9B 3H0RC 2Y2QA 1KX4B 3WAAA 4H9OA 3W99C 3C1CA 3EPJA 1ZLAC 3KXBA 3UTAD 3UTBA 3AZLC 1S32D 5B40C 4KUDC 3WKJD 4JJNB 2Y2LA 1P3LB 4H9RA 1H3OA 3REKD 3AN2B 1M18C 3RELA 1AOIA 1P3IC 2JCHA 3X1UD 2Y2MA 5AV6D 3AZFC 5F99D 1KX4A 2F8NB 2W8SA 5E5AB 2L5AA 3AZGB 2HIOB 2PYOC 4J8VD 1F1EA 5CPJB 5B33B 3AZJA 1PZRA 4WV4B 4H9PA 3X1UB 3AL0C 2AROB 3LJAB 3AZED 3B6GB 2RIQA 1M1AD 4YS3C 3AZIC 5CPKD 2F2AC 1HQ3A 3VH6W 3LZ0D 5B2JB 2F8NA 4YM6D 3A1IA 3REIA 1B6WA 4EO5B 5E5AA 3W97D 4G92B 3AZGA 5GT3B 4DQYB 4QLCB 4WU9C 3LELC 2NZDB 3AZEB 3EPKA 3MGRC 3MGSB 1P3AA 5B32D 4YM6B 1TZYB 3C1CC 4H9NA 3KXBC 3AZND 3AV1D 3MGPB 4ZBJB 3UTBC 3B6FA 4J8UD 2CV5D 2IO5B 3O62D 3WTPC 5B24B 4J8XB 1P3MA 5CPID 4CSRA 3LZ1C 3AZHB 4NFTA 5BT1C 4UUZB 4QLCA 4H9QB 3AZKB 3RELC 5GT0A 1AOIC 1KX3B 4WJ3C 5B1MA 5G49B 3X1VD 3X1SD 3KUYC 4J8WC 2Y2HA 3W99B 5GXQD 1ZLAB 2NQBD 4LD9D 5FUGA 1JFIB 3AZJC 3A1KA 1P3GA 3KWQA 3AZLB 4Z66D 1P3KA 3REHD 5B40B 4J8XA 4KUDB 1B67A 5B31D 1P3OA 3V9RB 1P3PA 1M18B 1HQ3C 1P3IB 4XUJA 3AZFB 3REIC 4X23A 4R8PA 2PYOB 3W98D 3MVDD 3AZLA 5AV8D 4XZQC 1P3AC 3VH5W 4KUDA 3MGQA 3X1TA 1KU5A 2YFVA 3V9RA 2RVQC 3AZIB 4YS3B 2ZY3A 4Z5TD 3B6FC 4ZUXA 3UT9D 3WAAD 5B2ID 4KGCA 2G5IC 5AV8B 1P3MC 3TU4C 3MNND 5AV9D 3B0CT 3REJD 2YFWA 3LELB 4WU9B 3WA9A 5GT0C 5B0ZD 3MGRB 3AFAD 4NE6A 2VQRA 2FJ7D 5B1LA 3C1BD 1U35A 4H9OB 5AV5D 3AYWA 3C1CB 3KXBB 4YS3A 1WWSA 1P3GC 3UTBB 1KX4D 1ID3A 1F66A 1P3KC 1EQZA 2HUEC
chains in the Genus database with same CATH topology
4H9RB 4HGAC 1H3OB 1P3OC 1P3PC 2Y2OA 3RELB 4JJND 1AOIB 3F6TA 5B0YA 4XUJC 1P3LD 3AN2D 5BNVA 4X23C 4R8PC 4KHAA 2F8ND 1HTAA 3AZJB 5E5AD 3AZGD 2HIOD 4H9PB 3VH5T 3WTPA 3MGQC 3X1TC 3LZ1A 5BS7A 5CPJD 5B33D 5DNMA 3B0BA 5CP6A 3NQUA 1HQ3B 4ZUXC 1KX5A 2AROD 2BYKA 3LJAD 1P3FA 3B6GD 4KGCC 2JSSA 3REIB 3AV2C 3KUYA 4WU8A 4J8WA 2F8NK 2J8PA 3FDDA 5B2JD 1P3BA 3WA9C 5B1LC 1P3AB 5GT3D 4QLCD 1U35C 2NZDD 3AYWC 5AVCA 4H9NB 3A6NA 5B1MD 4H9SA 3MGSD 3B6FB 1M19A 4AWLC 1ID3C 1F66C 1TZYD 1P3MB 2F8NG 1EQZC 3H0MC 4CSRB 3VH6A 5AVBA 3MGPD 3KWQD 5BNXA 4J8XD 5B24D 5GT0B 4XZQA 5B1MB 5B0YC 3W96A 3AZHD 1P34A 3AZKD 1T3UA 3AZMC 1KX3D 5FUGB 1P3GB 3KWQB 1P3KB 3W99D 5AY8C 1ZLAD 3UTAA 5BS7C 3EPHA 2HUEB 3TU4A 1R4VA 1S32A 4HGAB 3B0CW 3AZLD 5DNMC 1P3OB 5B40D 5CP6C 1P3PB 4KUDD 1KX5C 1P3FC 4XUJB 3REKA 4CAYB 4WU8C 1M18D 4X23B 5AV6A 4R8PB 1P3ID 5F99A 4ZUXD 4DRBA 1P3BC 3AZFD 5BO0A 2UWXA 2Y2GA 3IP4C 5GSUC 3MGQB 5DNNC 3NQJB 4J8VA 3X1TB 2PYOD 5AVCC 3A6NC 2YFVB 4H9SC 1BFMA 1N1JA 1M19C 2ZM5A 4ZUXB 2Y2KA 1M1AA 4CAYA 4KGCB 3AV2B 5CPKA 1BH8A 5AVBC 4YS3D 3AZID 3LZ0A 2YFWB 3WA9B 3W97A 3W96C 1P34C 5B1LB 3NQJA 1U35B 4WU9D 3LELD 3AYWB 3MGRD 2Y2IA 2XD5A 5B32A 4AWLB 1ID3B 1F66B 2F8NH 3AZNA 3C1CD 3AV2A 3AV1A 3UTAC 3KXBD 1EQZB 4J8UA 1Q9CA 3UTBD 4UPKA 2CV5A 1S32C 4NE5A 3O62A 3WKJC 5CPIA 3WTPD 3LZ1D 4M6BA 5B0YB 3REKC 3B0DC 5BT1D 2ZY4A 5BNVB 3X1UC 3RELD 5AV6C 3AZMB 1AOID 5F99C 2DQNC 4E45A 4KHAB 3X1SA 3X1VA 3KUYD 4J8WD 5GXQA 2NQBA 3WTPB 4J8VC 4LD9A 2ZY2A 3LZ1B 3AZJD 3REHA 4G92C 5DNMB 5CP6B 3R45B 4G91C 3NQUB 5B31A 3AZEC 1KX5B 4WNNA 2BYKB 1P3FB 1M1AC 5CPKC 3KUYB 4WU8B 4J8WB 3P5JB 5C3IC 3AZMA 3LZ0C 2BYMA 1HQ3D 4YM6C 2G5HC 1P3BB 3REID 3W97C 5AY8A 5GSUB 1TAFA 5JRGA 3W98A 3MVDA 5AVCB 3A6NB 4XZQD 3R45A 1P3AD 1M19B 5B32C 2DF4C 1WWIA 3AZNC 3AV1C 4Z5TA 2RVQD 5AVBB 4J8UC 2CV5C 3UT9A 3B6FD 5B2IA 3O62C 5CPIC 5BNXB 1P3MD 4XZQB 3MNNA 3W96B 4NE3A 5AV9A 3TU4D 5GSUA 1P34B 5DNNA 2CWEA 3REJA 5B0ZA 5GT0D 3AFAA 2FJ7A 5JA4B 3X1VC 3C1BA 2ZY5A 3X1SC 5AV5A 5KDMA 5GXQC 2NQBC 1BH9A 4LD9C 3UTAB 3TU4B 4Z66C 1S32B 1P3GD 3REHC 1P3KD 3WKJB 4Z2MG 5B31C 3REKB 3B0DB 2XD1A 1P3OD 4JJNA 1P3PD 5AV6B 5JA4A 1P3LA 5F99B 4XUJD 3AN2A 5BO0B 4X23D 4R8PD 3W98C 5JRGC 4J8VB 3MVDC 1ULYA 5AV8C 2HIOA 3WKJA 1N1JB 3MGQD 5CPJA 4G91B 3X1TD 5B33A 1M1AB 1W2EA 5CPKB 1BH8B 4Z5TC 5C3IB 3X1UA 3UT9C 3LZ0B 3WAAC 5B2IC 2AROA 3LJAA 3EG5B 2JE5A 3B6GA 4KGCD 3AV2D 3W97B 3MNNC 4E44A 5AV9C 5B2JA 3REJC 5B0ZC 3WA9D 3AFAC 2FJ7C 5GT3A 3C1BC 5B1LD 2BG1A 2NZDA 5B32B 5AV5C 4WZSB 3AZEA 1U35D 3AYWD 3AZNB 3AV1B 3KSYA 2FFFB 3MGSA 1KX4C 4J8UB 2CV5B 1ID3D 1F66D 4YM6A 3O62B 1TZYA 5CPIB 3MGPA 1EQZD 5B24A 4JJNC 3VH5A 1P3LC 3AZHA 4UUZA 5B0YD 3AN2C 4H9QA 3X1SB 3X1VB 3AZKA 3WTPE 1KX3A 5B32G 5G49A 5GXQB 3AZMD 2NQBB 3VH6T 4LD9B 4Z66B 5E5AC 3REHB 3AZGC 3W99A 2HIOC 5AY8D 4Z2MH 1ZLAA 5CPJC 5JRGD 5B31B 5B33C 1JFIA 4WNNB 5B40A 2LY8A 5DNMD 1Z2CB 5CP6D 2BYMB 2AROC 3LJAC 1KX5D 3B6GC 1P3FD 4DRAA 1M18A 4WU8D 5AY8B 1P3IA 2Y2PA 5B2JC 3W98B 1A7WA 1TAFB 5JRGB 3MVDB 3AZFA 1P3BD 2Y2JA 3KFUG 4EO5C 4Z66A 5GT3C 4QLCC 2PYOA 5GSUD 2NZDC 5DNND 5B1MC 5B31G 5AVCD 3A6ND 3MGSC 4Z5TB 1M19D 3UT9B 3WAAB 5B2IB 1TZYC 5CHLB 2Y2NA 3MGPC 4ZBJC 3AZIA 3MNNB 5AVBD 5AV9B 3KWQC 2IO5C 5DNNB 3REJB 4J8XC 5B24C 5AV8A 5B0ZB 3AFAB 3AZHC 2FJ7B 3W96D 1P34D 3C1BB 3EPLA 3AZKC 4WU9A 3LELA 5AV5B 5KDMB 3H0LC 1KX3C 3MGRA 1BH9B 3H0RC 2Y2QA 1KX4B 3WAAA 4H9OA 3W99C 3C1CA 3EPJA 1ZLAC 3KXBA 3UTAD 3UTBA 3AZLC 1S32D 5B40C 4KUDC 3WKJD 4JJNB 2Y2LA 1P3LB 4H9RA 1H3OA 3REKD 3AN2B 1M18C 3RELA 1AOIA 1P3IC 2JCHA 3X1UD 2Y2MA 5AV6D 3AZFC 5F99D 1KX4A 2F8NB 2W8SA 5E5AB 2L5AA 3AZGB 2HIOB 2PYOC 4J8VD 1F1EA 5CPJB 5B33B 3AZJA 1PZRA 4WV4B 4H9PA 3X1UB 3AL0C 2AROB 3LJAB 3AZED 3B6GB 2RIQA 1M1AD 4YS3C 3AZIC 5CPKD 2F2AC 1HQ3A 3VH6W 3LZ0D 5B2JB 2F8NA 4YM6D 3A1IA 3REIA 1B6WA 4EO5B 5E5AA 3W97D 4G92B 3AZGA 5GT3B 4DQYB 4QLCB 4WU9C 3LELC 2NZDB 3AZEB 3EPKA 3MGRC 3MGSB 1P3AA 5B32D 4YM6B 1TZYB 3C1CC 4H9NA 3KXBC 3AZND 3AV1D 3MGPB 4ZBJB 3UTBC 3B6FA 4J8UD 2CV5D 2IO5B 3O62D 3WTPC 5B24B 4J8XB 1P3MA 5CPID 4CSRA 3LZ1C 3AZHB 4NFTA 5BT1C 4UUZB 4QLCA 4H9QB 3AZKB 3RELC 5GT0A 1AOIC 1KX3B 4WJ3C 5B1MA 5G49B 3X1VD 3X1SD 3KUYC 4J8WC 2Y2HA 3W99B 5GXQD 1ZLAB 2NQBD 4LD9D 5FUGA 1JFIB 3AZJC 3A1KA 1P3GA 3KWQA 3AZLB 4Z66D 1P3KA 3REHD 5B40B 4J8XA 4KUDB 1B67A 5B31D 1P3OA 3V9RB 1P3PA 1M18B 1HQ3C 1P3IB 4XUJA 3AZFB 3REIC 4X23A 4R8PA 2PYOB 3W98D 3MVDD 3AZLA 5AV8D 4XZQC 1P3AC 3VH5W 4KUDA 3MGQA 3X1TA 1KU5A 2YFVA 3V9RA 2RVQC 3AZIB 4YS3B 2ZY3A 4Z5TD 3B6FC 4ZUXA 3UT9D 3WAAD 5B2ID 4KGCA 2G5IC 5AV8B 1P3MC 3TU4C 3MNND 5AV9D 3B0CT 3REJD 2YFWA 3LELB 4WU9B 3WA9A 5GT0C 5B0ZD 3MGRB 3AFAD 4NE6A 2VQRA 2FJ7D 5B1LA 3C1BD 1U35A 4H9OB 5AV5D 3AYWA 3C1CB 3KXBB 4YS3A 1WWSA 1P3GC 3UTBB 1KX4D 1ID3A 1F66A 1P3KC 1EQZA 2HUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R B;  4HGA C;  1H3O B;  1P3O C;  1P3P C;  3REL B;  4JJN D;  1AOI B;  5B0Y A;  4XUJ C;  1P3L D;  3AN2 D;  5BNV A;  4X23 C;  4R8P C;  4KHA A;  2F8N D;  1HTA A;  3AZJ B;  5E5A D;  3AZG D;  2HIO D;  4H9P B;  3VH5 T;  3WTP A;  3MGQ C;  3X1T C;  3LZ1 A;  5BS7 A;  5CPJ D;  5B33 D;  5DNM A;  3B0B A;  5CP6 A;  3NQU A;  1HQ3 B;  4ZUX C;  1KX5 A;  2ARO D;  2BYK A;  3LJA D;  1P3F A;  3B6G D;  4KGC C;  2JSS A;  3REI B;  3AV2 C;  3KUY A;  4WU8 A;  4J8W A;  2F8N K;  5B2J D;  1P3B A;  3WA9 C;  5B1L C;  1P3A B;  5GT3 D;  4QLC D;  1U35 C;  2NZD D;  3AYW C;  5AVC A;  4H9N B;  3A6N A;  5B1M D;  4H9S A;  3MGS D;  3B6F B;  1M19 A;  4AWL C;  1ID3 C;  1F66 C;  1TZY D;  1P3M B;  2F8N G;  1EQZ C;  4CSR B;  3MGP D;  3VH6 A;  5AVB A;  3KWQ D;  5BNX A;  4J8X D;  5B24 D;  5GT0 B;  4XZQ A;  5B1M B;  5B0Y C;  3W96 A;  3AZH D;  1P34 A;  3AZK D;  3AZM C;  1KX3 D;  5FUG B;  1P3G B;  3KWQ B;  1P3K B;  3W99 D;  5AY8 C;  1ZLA D;  3UTA A;  5BS7 C;  2HUE B;  3TU4 A;  1R4V A;  1S32 A;  4HGA B;  3B0C W;  3AZL D;  5DNM C;  1P3O B;  5B40 D;  5CP6 C;  1P3P B;  4KUD D;  1KX5 C;  1P3F C;  4XUJ B;  3REK A;  4CAY B;  4WU8 C;  1M18 D;  4X23 B;  5AV6 A;  4R8P B;  1P3I D;  5F99 A;  4ZUX D;  4DRB A;  1P3B C;  3AZF D;  5BO0 A;  5GSU C;  3MGQ B;  4J8V A;  5DNN C;  3NQJ B;  2PYO D;  3X1T B;  5AVC C;  3A6N C;  2YFV B;  4H9S C;  1BFM A;  1N1J A;  1M19 C;  4ZUX B;  1M1A A;  4CAY A;  4KGC B;  3AV2 B;  5CPK A;  1BH8 A;  5AVB C;  4YS3 D;  3AZI D;  3LZ0 A;  2YFW B;  3WA9 B;  3W97 A;  3W96 C;  1P34 C;  5B1L B;  3NQJ A;  1U35 B;  4WU9 D;  3LEL D;  3AYW B;  3MGR D;  5B32 A;  4AWL B;  1ID3 B;  1F66 B;  2F8N H;  3AZN A;  3C1C D;  3AV2 A;  3AV1 A;  3UTA C;  3KXB D;  1EQZ B;  4J8U A;  1Q9C A;  3UTB D;  2CV5 A;  1S32 C;  4NE5 A;  3O62 A;  3WKJ C;  5CPI A;  3WTP D;  3LZ1 D;  4M6B A;  5B0Y B;  3REK C;  3B0D C;  5BT1 D;  5BNV B;  3X1U C;  3REL D;  5AV6 C;  3AZM B;  1AOI D;  5F99 C;  4E45 A;  4KHA B;  3X1S A;  3X1V A;  3KUY D;  4J8W D;  5GXQ A;  2NQB A;  3WTP B;  4J8V C;  4LD9 A;  3LZ1 B;  3AZJ D;  3REH A;  4G92 C;  5DNM B;  5CP6 B;  3R45 B;  4G91 C;  3NQU B;  5B31 A;  3AZE C;  1KX5 B;  4WNN A;  2BYK B;  1P3F B;  1M1A C;  5CPK C;  3KUY B;  4WU8 B;  4J8W B;  5C3I C;  3AZM A;  3LZ0 C;  2BYM A;  1HQ3 D;  4YM6 C;  1P3B B;  3REI D;  3W97 C;  5AY8 A;  5GSU B;  1TAF A;  5JRG A;  3W98 A;  3MVD A;  5AVC B;  3A6N B;  4XZQ D;  3R45 A;  1P3A D;  1M19 B;  5B32 C;  1WWI A;  3AZN C;  3AV1 C;  4Z5T A;  2RVQ D;  5AVB B;  4J8U C;  2CV5 C;  3UT9 A;  3B6F D;  5B2I A;  3O62 C;  5CPI C;  5BNX B;  1P3M D;  4XZQ B;  3MNN A;  3W96 B;  4NE3 A;  5AV9 A;  3TU4 D;  5GSU A;  1P34 B;  5DNN A;  2CWE A;  3REJ A;  5B0Z A;  5GT0 D;  3AFA A;  2FJ7 A;  5JA4 B;  3X1V C;  3C1B A;  3X1S C;  5AV5 A;  5KDM A;  5GXQ C;  2NQB C;  1BH9 A;  4LD9 C;  3UTA B;  3TU4 B;  4Z66 C;  1S32 B;  1P3G D;  3REH C;  1P3K D;  3WKJ B;  4Z2M G;  5B31 C;  3REK B;  3B0D B;  1P3O D;  4JJN A;  1P3P D;  5AV6 B;  5JA4 A;  1P3L A;  5F99 B;  4XUJ D;  3AN2 A;  5BO0 B;  4X23 D;  4R8P D;  3W98 C;  5JRG C;  4J8V B;  3MVD C;  1ULY A;  5AV8 C;  2HIO A;  3WKJ A;  1N1J B;  3MGQ D;  5CPJ A;  4G91 B;  3X1T D;  5B33 A;  1M1A B;  5CPK B;  1BH8 B;  4Z5T C;  3X1U A;  5C3I B;  3UT9 C;  3LZ0 B;  3WAA C;  5B2I C;  2ARO A;  3LJA A;  3B6G A;  4KGC D;  3AV2 D;  3W97 B;  3MNN C;  4E44 A;  5AV9 C;  5B2J A;  3REJ C;  5B0Z C;  3WA9 D;  3AFA C;  2FJ7 C;  5GT3 A;  3C1B C;  5B1L D;  2NZD A;  5B32 B;  5AV5 C;  4WZS B;  3AZE A;  1U35 D;  3AYW D;  3AZN B;  3AV1 B;  3KSY A;  3MGS A;  1KX4 C;  4J8U B;  2CV5 B;  1ID3 D;  1F66 D;  4YM6 A;  3O62 B;  1TZY A;  5CPI B;  3MGP A;  1EQZ D;  5B24 A;  4JJN C;  3VH5 A;  1P3L C;  3AZH A;  4UUZ A;  5B0Y D;  3AN2 C;  4H9Q A;  3X1S B;  3X1V B;  3AZK A;  3WTP E;  1KX3 A;  5B32 G;  5G49 A;  5GXQ B;  3AZM D;  2NQB B;  3VH6 T;  4LD9 B;  4Z66 B;  5E5A C;  3REH B;  3AZG C;  3W99 A;  2HIO C;  5AY8 D;  4Z2M H;  1ZLA A;  5CPJ C;  5JRG D;  5B31 B;  5B33 C;  1JFI A;  4WNN B;  5B40 A;  2LY8 A;  5DNM D;  5CP6 D;  2BYM B;  2ARO C;  3LJA C;  1KX5 D;  3B6G C;  1P3F D;  4DRA A;  1M18 A;  4WU8 D;  5AY8 B;  1P3I A;  5B2J C;  3W98 B;  1A7W A;  1TAF B;  5JRG B;  3MVD B;  3AZF A;  1P3B D;  4EO5 C;  4Z66 A;  5GT3 C;  4QLC C;  2PYO A;  5GSU D;  2NZD C;  5DNN D;  5B1M C;  5B31 G;  5AVC D;  3A6N D;  3MGS C;  4Z5T B;  1M19 D;  3UT9 B;  3WAA B;  5B2I B;  1TZY C;  5CHL B;  3MGP C;  4ZBJ C;  3AZI A;  3MNN B;  5AVB D;  5AV9 B;  3KWQ C;  2IO5 C;  5DNN B;  3REJ B;  4J8X C;  5B24 C;  5AV8 A;  5B0Z B;  3AFA B;  3AZH C;  2FJ7 B;  3W96 D;  1P34 D;  3C1B B;  3AZK C;  4WU9 A;  3LEL A;  5AV5 B;  5KDM B;  1KX3 C;  3MGR A;  1BH9 B;  1KX4 B;  3WAA A;  4H9O A;  3W99 C;  3C1C A;  1ZLA C;  3KXB A;  3UTA D;  3UTB A;  3AZL C;  1S32 D;  5B40 C;  4KUD C;  3WKJ D;  4JJN B;  1P3L B;  4H9R A;  1H3O A;  3REK D;  3AN2 B;  1M18 C;  3REL A;  1AOI A;  1P3I C;  3X1U D;  5AV6 D;  3AZF C;  5F99 D;  1KX4 A;  2F8N B;  5E5A B;  2L5A A;  3AZG B;  2HIO B;  2PYO C;  4J8V D;  1F1E A;  5CPJ B;  5B33 B;  3AZJ A;  4WV4 B;  4H9P A;  3X1U B;  2ARO B;  3LJA B;  3AZE D;  3B6G B;  1M1A D;  4YS3 C;  3AZI C;  5CPK D;  1HQ3 A;  3VH6 W;  3LZ0 D;  5B2J B;  2F8N A;  4YM6 D;  3REI A;  1B6W A;  4EO5 B;  5E5A A;  3W97 D;  4G92 B;  3AZG A;  5GT3 B;  4QLC B;  4WU9 C;  3LEL C;  2NZD B;  3AZE B;  3MGR C;  3MGS B;  1P3A A;  5B32 D;  4YM6 B;  1TZY B;  3C1C C;  4H9N A;  3KXB C;  3AZN D;  3AV1 D;  3MGP B;  4ZBJ B;  3UTB C;  3B6F A;  4J8U D;  2CV5 D;  2IO5 B;  3O62 D;  3WTP C;  5B24 B;  4J8X B;  1P3M A;  5CPI D;  4CSR A;  3LZ1 C;  3AZH B;  4NFT A;  5BT1 C;  4UUZ B;  4QLC A;  4H9Q B;  3AZK B;  3REL C;  5GT0 A;  1AOI C;  1KX3 B;  5B1M A;  5G49 B;  3X1V D;  3X1S D;  3KUY C;  4J8W C;  3W99 B;  5GXQ D;  1ZLA B;  2NQB D;  4LD9 D;  5FUG A;  1JFI B;  3AZJ C;  1P3G A;  3KWQ A;  3AZL B;  4Z66 D;  1P3K A;  3REH D;  5B40 B;  4J8X A;  4KUD B;  1B67 A;  5B31 D;  1P3O A;  3V9R B;  1P3P A;  1M18 B;  1HQ3 C;  1P3I B;  4XUJ A;  3AZF B;  3REI C;  4X23 A;  4R8P A;  2PYO B;  3W98 D;  3MVD D;  3AZL A;  5AV8 D;  4XZQ C;  1P3A C;  3VH5 W;  4KUD A;  3MGQ A;  3X1T A;  1KU5 A;  2YFV A;  3V9R A;  2RVQ C;  3AZI B;  4YS3 B;  3B6F C;  4Z5T D;  4ZUX A;  3UT9 D;  3WAA D;  5B2I D;  4KGC A;  5AV8 B;  1P3M C;  3TU4 C;  3MNN D;  5AV9 D;  3B0C T;  3REJ D;  2YFW A;  3LEL B;  4WU9 B;  3WA9 A;  5GT0 C;  5B0Z D;  3MGR B;  3AFA D;  4NE6 A;  2FJ7 D;  5B1L A;  3C1B D;  1U35 A;  4H9O B;  5AV5 D;  3AYW A;  3C1C B;  3KXB B;  4YS3 A;  1WWS A;  1P3G C;  3UTB B;  1KX4 D;  1ID3 A;  1F66 A;  1P3K C;  1EQZ A;  2HUE C; 
#chains in the Genus database with same CATH topology
 4H9R B;  4HGA C;  1H3O B;  1P3O C;  1P3P C;  2Y2O A;  3REL B;  4JJN D;  1AOI B;  3F6T A;  5B0Y A;  4XUJ C;  1P3L D;  3AN2 D;  5BNV A;  4X23 C;  4R8P C;  4KHA A;  2F8N D;  1HTA A;  3AZJ B;  5E5A D;  3AZG D;  2HIO D;  4H9P B;  3VH5 T;  3WTP A;  3MGQ C;  3X1T C;  3LZ1 A;  5BS7 A;  5CPJ D;  5B33 D;  5DNM A;  3B0B A;  5CP6 A;  3NQU A;  1HQ3 B;  4ZUX C;  1KX5 A;  2ARO D;  2BYK A;  3LJA D;  1P3F A;  3B6G D;  4KGC C;  2JSS A;  3REI B;  3AV2 C;  3KUY A;  4WU8 A;  4J8W A;  2F8N K;  2J8P A;  3FDD A;  5B2J D;  1P3B A;  3WA9 C;  5B1L C;  1P3A B;  5GT3 D;  4QLC D;  1U35 C;  2NZD D;  3AYW C;  5AVC A;  4H9N B;  3A6N A;  5B1M D;  4H9S A;  3MGS D;  3B6F B;  1M19 A;  4AWL C;  1ID3 C;  1F66 C;  1TZY D;  1P3M B;  2F8N G;  1EQZ C;  3H0M C;  4CSR B;  3VH6 A;  5AVB A;  3MGP D;  3KWQ D;  5BNX A;  4J8X D;  5B24 D;  5GT0 B;  4XZQ A;  5B1M B;  5B0Y C;  3W96 A;  3AZH D;  1P34 A;  3AZK D;  1T3U A;  3AZM C;  1KX3 D;  5FUG B;  1P3G B;  3KWQ B;  1P3K B;  3W99 D;  5AY8 C;  1ZLA D;  3UTA A;  5BS7 C;  3EPH A;  2HUE B;  3TU4 A;  1R4V A;  1S32 A;  4HGA B;  3B0C W;  3AZL D;  5DNM C;  1P3O B;  5B40 D;  5CP6 C;  1P3P B;  4KUD D;  1KX5 C;  1P3F C;  4XUJ B;  3REK A;  4CAY B;  4WU8 C;  1M18 D;  4X23 B;  5AV6 A;  4R8P B;  1P3I D;  5F99 A;  4ZUX D;  4DRB A;  1P3B C;  3AZF D;  5BO0 A;  2UWX A;  2Y2G A;  3IP4 C;  5GSU C;  3MGQ B;  5DNN C;  3NQJ B;  4J8V A;  3X1T B;  2PYO D;  5AVC C;  3A6N C;  2YFV B;  4H9S C;  1BFM A;  1N1J A;  1M19 C;  2ZM5 A;  4ZUX B;  2Y2K A;  1M1A A;  4CAY A;  4KGC B;  3AV2 B;  5CPK A;  1BH8 A;  5AVB C;  4YS3 D;  3AZI D;  3LZ0 A;  2YFW B;  3WA9 B;  3W97 A;  3W96 C;  1P34 C;  5B1L B;  3NQJ A;  1U35 B;  4WU9 D;  3LEL D;  3AYW B;  3MGR D;  2Y2I A;  2XD5 A;  5B32 A;  4AWL B;  1ID3 B;  1F66 B;  2F8N H;  3AZN A;  3C1C D;  3AV2 A;  3AV1 A;  3UTA C;  3KXB D;  1EQZ B;  4J8U A;  1Q9C A;  3UTB D;  4UPK A;  2CV5 A;  1S32 C;  4NE5 A;  3O62 A;  3WKJ C;  5CPI A;  3WTP D;  3LZ1 D;  4M6B A;  5B0Y B;  3REK C;  3B0D C;  5BT1 D;  2ZY4 A;  5BNV B;  3X1U C;  3REL D;  5AV6 C;  3AZM B;  1AOI D;  5F99 C;  2DQN C;  4E45 A;  4KHA B;  3X1S A;  3X1V A;  3KUY D;  4J8W D;  5GXQ A;  2NQB A;  3WTP B;  4J8V C;  4LD9 A;  2ZY2 A;  3LZ1 B;  3AZJ D;  3REH A;  4G92 C;  5DNM B;  5CP6 B;  3R45 B;  4G91 C;  3NQU B;  5B31 A;  3AZE C;  1KX5 B;  4WNN A;  2BYK B;  1P3F B;  1M1A C;  5CPK C;  3KUY B;  4WU8 B;  4J8W B;  3P5J B;  5C3I C;  3AZM A;  3LZ0 C;  2BYM A;  1HQ3 D;  4YM6 C;  2G5H C;  1P3B B;  3REI D;  3W97 C;  5AY8 A;  5GSU B;  1TAF A;  5JRG A;  3W98 A;  3MVD A;  5AVC B;  3A6N B;  4XZQ D;  3R45 A;  1P3A D;  1M19 B;  5B32 C;  2DF4 C;  1WWI A;  3AZN C;  3AV1 C;  4Z5T A;  2RVQ D;  5AVB B;  4J8U C;  2CV5 C;  3UT9 A;  3B6F D;  5B2I A;  3O62 C;  5CPI C;  5BNX B;  1P3M D;  4XZQ B;  3MNN A;  3W96 B;  4NE3 A;  5AV9 A;  3TU4 D;  5GSU A;  1P34 B;  5DNN A;  2CWE A;  3REJ A;  5B0Z A;  5GT0 D;  3AFA A;  2FJ7 A;  5JA4 B;  3X1V C;  3C1B A;  2ZY5 A;  3X1S C;  5AV5 A;  5KDM A;  5GXQ C;  2NQB C;  1BH9 A;  4LD9 C;  3UTA B;  3TU4 B;  4Z66 C;  1S32 B;  1P3G D;  3REH C;  1P3K D;  3WKJ B;  4Z2M G;  5B31 C;  3REK B;  3B0D B;  2XD1 A;  1P3O D;  4JJN A;  1P3P D;  5AV6 B;  5JA4 A;  1P3L A;  5F99 B;  4XUJ D;  3AN2 A;  5BO0 B;  4X23 D;  4R8P D;  3W98 C;  5JRG C;  4J8V B;  3MVD C;  1ULY A;  5AV8 C;  2HIO A;  3WKJ A;  1N1J B;  3MGQ D;  5CPJ A;  4G91 B;  3X1T D;  5B33 A;  1M1A B;  1W2E A;  5CPK B;  1BH8 B;  4Z5T C;  5C3I B;  3X1U A;  3UT9 C;  3LZ0 B;  3WAA C;  5B2I C;  2ARO A;  3LJA A;  3EG5 B;  2JE5 A;  3B6G A;  4KGC D;  3AV2 D;  3W97 B;  3MNN C;  4E44 A;  5AV9 C;  5B2J A;  3REJ C;  5B0Z C;  3WA9 D;  3AFA C;  2FJ7 C;  5GT3 A;  3C1B C;  5B1L D;  2BG1 A;  2NZD A;  5B32 B;  5AV5 C;  4WZS B;  3AZE A;  1U35 D;  3AYW D;  3AZN B;  3AV1 B;  3KSY A;  2FFF B;  3MGS A;  1KX4 C;  4J8U B;  2CV5 B;  1ID3 D;  1F66 D;  4YM6 A;  3O62 B;  1TZY A;  5CPI B;  3MGP A;  1EQZ D;  5B24 A;  4JJN C;  3VH5 A;  1P3L C;  3AZH A;  4UUZ A;  5B0Y D;  3AN2 C;  4H9Q A;  3X1S B;  3X1V B;  3AZK A;  3WTP E;  1KX3 A;  5B32 G;  5G49 A;  5GXQ B;  3AZM D;  2NQB B;  3VH6 T;  4LD9 B;  4Z66 B;  5E5A C;  3REH B;  3AZG C;  3W99 A;  2HIO C;  5AY8 D;  4Z2M H;  1ZLA A;  5CPJ C;  5JRG D;  5B31 B;  5B33 C;  1JFI A;  4WNN B;  5B40 A;  2LY8 A;  5DNM D;  1Z2C B;  5CP6 D;  2BYM B;  2ARO C;  3LJA C;  1KX5 D;  3B6G C;  1P3F D;  4DRA A;  1M18 A;  4WU8 D;  5AY8 B;  1P3I A;  2Y2P A;  5B2J C;  3W98 B;  1A7W A;  1TAF B;  5JRG B;  3MVD B;  3AZF A;  1P3B D;  2Y2J A;  3KFU G;  4EO5 C;  4Z66 A;  5GT3 C;  4QLC C;  2PYO A;  5GSU D;  2NZD C;  5DNN D;  5B1M C;  5B31 G;  5AVC D;  3A6N D;  3MGS C;  4Z5T B;  1M19 D;  3UT9 B;  3WAA B;  5B2I B;  1TZY C;  5CHL B;  2Y2N A;  3MGP C;  4ZBJ C;  3AZI A;  3MNN B;  5AVB D;  5AV9 B;  3KWQ C;  2IO5 C;  5DNN B;  3REJ B;  4J8X C;  5B24 C;  5AV8 A;  5B0Z B;  3AFA B;  3AZH C;  2FJ7 B;  3W96 D;  1P34 D;  3C1B B;  3EPL A;  3AZK C;  4WU9 A;  3LEL A;  5AV5 B;  5KDM B;  3H0L C;  1KX3 C;  3MGR A;  1BH9 B;  3H0R C;  2Y2Q A;  1KX4 B;  3WAA A;  4H9O A;  3W99 C;  3C1C A;  3EPJ A;  1ZLA C;  3KXB A;  3UTA D;  3UTB A;  3AZL C;  1S32 D;  5B40 C;  4KUD C;  3WKJ D;  4JJN B;  2Y2L A;  1P3L B;  4H9R A;  1H3O A;  3REK D;  3AN2 B;  1M18 C;  3REL A;  1AOI A;  1P3I C;  2JCH A;  3X1U D;  2Y2M A;  5AV6 D;  3AZF C;  5F99 D;  1KX4 A;  2F8N B;  2W8S A;  5E5A B;  2L5A A;  3AZG B;  2HIO B;  2PYO C;  4J8V D;  1F1E A;  5CPJ B;  5B33 B;  3AZJ A;  1PZR A;  4WV4 B;  4H9P A;  3X1U B;  3AL0 C;  2ARO B;  3LJA B;  3AZE D;  3B6G B;  2RIQ A;  1M1A D;  4YS3 C;  3AZI C;  5CPK D;  2F2A C;  1HQ3 A;  3VH6 W;  3LZ0 D;  5B2J B;  2F8N A;  4YM6 D;  3A1I A;  3REI A;  1B6W A;  4EO5 B;  5E5A A;  3W97 D;  4G92 B;  3AZG A;  5GT3 B;  4DQY B;  4QLC B;  4WU9 C;  3LEL C;  2NZD B;  3AZE B;  3EPK A;  3MGR C;  3MGS B;  1P3A A;  5B32 D;  4YM6 B;  1TZY B;  3C1C C;  4H9N A;  3KXB C;  3AZN D;  3AV1 D;  3MGP B;  4ZBJ B;  3UTB C;  3B6F A;  4J8U D;  2CV5 D;  2IO5 B;  3O62 D;  3WTP C;  5B24 B;  4J8X B;  1P3M A;  5CPI D;  4CSR A;  3LZ1 C;  3AZH B;  4NFT A;  5BT1 C;  4UUZ B;  4QLC A;  4H9Q B;  3AZK B;  3REL C;  5GT0 A;  1AOI C;  1KX3 B;  4WJ3 C;  5B1M A;  5G49 B;  3X1V D;  3X1S D;  3KUY C;  4J8W C;  2Y2H A;  3W99 B;  5GXQ D;  1ZLA B;  2NQB D;  4LD9 D;  5FUG A;  1JFI B;  3AZJ C;  3A1K A;  1P3G A;  3KWQ A;  3AZL B;  4Z66 D;  1P3K A;  3REH D;  5B40 B;  4J8X A;  4KUD B;  1B67 A;  5B31 D;  1P3O A;  3V9R B;  1P3P A;  1M18 B;  1HQ3 C;  1P3I B;  4XUJ A;  3AZF B;  3REI C;  4X23 A;  4R8P A;  2PYO B;  3W98 D;  3MVD D;  3AZL A;  5AV8 D;  4XZQ C;  1P3A C;  3VH5 W;  4KUD A;  3MGQ A;  3X1T A;  1KU5 A;  2YFV A;  3V9R A;  2RVQ C;  3AZI B;  4YS3 B;  2ZY3 A;  4Z5T D;  3B6F C;  4ZUX A;  3UT9 D;  3WAA D;  5B2I D;  4KGC A;  2G5I C;  5AV8 B;  1P3M C;  3TU4 C;  3MNN D;  5AV9 D;  3B0C T;  3REJ D;  2YFW A;  3LEL B;  4WU9 B;  3WA9 A;  5GT0 C;  5B0Z D;  3MGR B;  3AFA D;  4NE6 A;  2VQR A;  2FJ7 D;  5B1L A;  3C1B D;  1U35 A;  4H9O B;  5AV5 D;  3AYW A;  3C1C B;  3KXB B;  4YS3 A;  1WWS A;  1P3G C;  3UTB B;  1KX4 D;  1ID3 A;  1F66 A;  1P3K C;  1EQZ A;  2HUE C; 
#chains in the Genus database with same CATH homology
 4H9R B;  4HGA C;  1H3O B;  1P3O C;  1P3P C;  2Y2O A;  3REL B;  4JJN D;  1AOI B;  3F6T A;  5B0Y A;  4XUJ C;  1P3L D;  3AN2 D;  5BNV A;  4X23 C;  4R8P C;  4KHA A;  2F8N D;  1HTA A;  3AZJ B;  5E5A D;  3AZG D;  2HIO D;  4H9P B;  3VH5 T;  3WTP A;  3MGQ C;  3X1T C;  3LZ1 A;  5BS7 A;  5CPJ D;  5B33 D;  5DNM A;  3B0B A;  5CP6 A;  3NQU A;  1HQ3 B;  4ZUX C;  1KX5 A;  2ARO D;  2BYK A;  3LJA D;  1P3F A;  3B6G D;  4KGC C;  2JSS A;  3REI B;  3AV2 C;  3KUY A;  4WU8 A;  4J8W A;  2F8N K;  2J8P A;  3FDD A;  5B2J D;  1P3B A;  3WA9 C;  5B1L C;  1P3A B;  5GT3 D;  4QLC D;  1U35 C;  2NZD D;  3AYW C;  5AVC A;  4H9N B;  3A6N A;  5B1M D;  4H9S A;  3MGS D;  3B6F B;  1M19 A;  4AWL C;  1ID3 C;  1F66 C;  1TZY D;  1P3M B;  2F8N G;  1EQZ C;  3H0M C;  4CSR B;  3VH6 A;  5AVB A;  3MGP D;  3KWQ D;  5BNX A;  4J8X D;  5B24 D;  5GT0 B;  4XZQ A;  5B1M B;  5B0Y C;  3W96 A;  3AZH D;  1P34 A;  3AZK D;  1T3U A;  3AZM C;  1KX3 D;  5FUG B;  1P3G B;  3KWQ B;  1P3K B;  3W99 D;  5AY8 C;  1ZLA D;  3UTA A;  5BS7 C;  3EPH A;  2HUE B;  3TU4 A;  1R4V A;  1S32 A;  4HGA B;  3B0C W;  3AZL D;  5DNM C;  1P3O B;  5B40 D;  5CP6 C;  1P3P B;  4KUD D;  1KX5 C;  1P3F C;  4XUJ B;  3REK A;  4CAY B;  4WU8 C;  1M18 D;  4X23 B;  5AV6 A;  4R8P B;  1P3I D;  5F99 A;  4ZUX D;  4DRB A;  1P3B C;  3AZF D;  5BO0 A;  2UWX A;  2Y2G A;  3IP4 C;  5GSU C;  3MGQ B;  5DNN C;  3NQJ B;  4J8V A;  3X1T B;  2PYO D;  5AVC C;  3A6N C;  2YFV B;  4H9S C;  1BFM A;  1N1J A;  1M19 C;  2ZM5 A;  4ZUX B;  2Y2K A;  1M1A A;  4CAY A;  4KGC B;  3AV2 B;  5CPK A;  1BH8 A;  5AVB C;  4YS3 D;  3AZI D;  3LZ0 A;  2YFW B;  3WA9 B;  3W97 A;  3W96 C;  1P34 C;  5B1L B;  3NQJ A;  1U35 B;  4WU9 D;  3LEL D;  3AYW B;  3MGR D;  2Y2I A;  2XD5 A;  5B32 A;  4AWL B;  1ID3 B;  1F66 B;  2F8N H;  3AZN A;  3C1C D;  3AV2 A;  3AV1 A;  3UTA C;  3KXB D;  1EQZ B;  4J8U A;  1Q9C A;  3UTB D;  4UPK A;  2CV5 A;  1S32 C;  4NE5 A;  3O62 A;  3WKJ C;  5CPI A;  3WTP D;  3LZ1 D;  4M6B A;  5B0Y B;  3REK C;  3B0D C;  5BT1 D;  2ZY4 A;  5BNV B;  3X1U C;  3REL D;  5AV6 C;  3AZM B;  1AOI D;  5F99 C;  2DQN C;  4E45 A;  4KHA B;  3X1S A;  3X1V A;  3KUY D;  4J8W D;  5GXQ A;  2NQB A;  3WTP B;  4J8V C;  4LD9 A;  2ZY2 A;  3LZ1 B;  3AZJ D;  3REH A;  4G92 C;  5DNM B;  5CP6 B;  3R45 B;  4G91 C;  3NQU B;  5B31 A;  3AZE C;  1KX5 B;  4WNN A;  2BYK B;  1P3F B;  1M1A C;  5CPK C;  3KUY B;  4WU8 B;  4J8W B;  3P5J B;  5C3I C;  3AZM A;  3LZ0 C;  2BYM A;  1HQ3 D;  4YM6 C;  2G5H C;  1P3B B;  3REI D;  3W97 C;  5AY8 A;  5GSU B;  1TAF A;  5JRG A;  3W98 A;  3MVD A;  5AVC B;  3A6N B;  4XZQ D;  3R45 A;  1P3A D;  1M19 B;  5B32 C;  2DF4 C;  1WWI A;  3AZN C;  3AV1 C;  4Z5T A;  2RVQ D;  5AVB B;  4J8U C;  2CV5 C;  3UT9 A;  3B6F D;  5B2I A;  3O62 C;  5CPI C;  5BNX B;  1P3M D;  4XZQ B;  3MNN A;  3W96 B;  4NE3 A;  5AV9 A;  3TU4 D;  5GSU A;  1P34 B;  5DNN A;  2CWE A;  3REJ A;  5B0Z A;  5GT0 D;  3AFA A;  2FJ7 A;  5JA4 B;  3X1V C;  3C1B A;  2ZY5 A;  3X1S C;  5AV5 A;  5KDM A;  5GXQ C;  2NQB C;  1BH9 A;  4LD9 C;  3UTA B;  3TU4 B;  4Z66 C;  1S32 B;  1P3G D;  3REH C;  1P3K D;  3WKJ B;  4Z2M G;  5B31 C;  3REK B;  3B0D B;  2XD1 A;  1P3O D;  4JJN A;  1P3P D;  5AV6 B;  5JA4 A;  1P3L A;  5F99 B;  4XUJ D;  3AN2 A;  5BO0 B;  4X23 D;  4R8P D;  3W98 C;  5JRG C;  4J8V B;  3MVD C;  1ULY A;  5AV8 C;  2HIO A;  3WKJ A;  1N1J B;  3MGQ D;  5CPJ A;  4G91 B;  3X1T D;  5B33 A;  1M1A B;  1W2E A;  5CPK B;  1BH8 B;  4Z5T C;  5C3I B;  3X1U A;  3UT9 C;  3LZ0 B;  3WAA C;  5B2I C;  2ARO A;  3LJA A;  3EG5 B;  2JE5 A;  3B6G A;  4KGC D;  3AV2 D;  3W97 B;  3MNN C;  4E44 A;  5AV9 C;  5B2J A;  3REJ C;  5B0Z C;  3WA9 D;  3AFA C;  2FJ7 C;  5GT3 A;  3C1B C;  5B1L D;  2BG1 A;  2NZD A;  5B32 B;  5AV5 C;  4WZS B;  3AZE A;  1U35 D;  3AYW D;  3AZN B;  3AV1 B;  3KSY A;  2FFF B;  3MGS A;  1KX4 C;  4J8U B;  2CV5 B;  1ID3 D;  1F66 D;  4YM6 A;  3O62 B;  1TZY A;  5CPI B;  3MGP A;  1EQZ D;  5B24 A;  4JJN C;  3VH5 A;  1P3L C;  3AZH A;  4UUZ A;  5B0Y D;  3AN2 C;  4H9Q A;  3X1S B;  3X1V B;  3AZK A;  3WTP E;  1KX3 A;  5B32 G;  5G49 A;  5GXQ B;  3AZM D;  2NQB B;  3VH6 T;  4LD9 B;  4Z66 B;  5E5A C;  3REH B;  3AZG C;  3W99 A;  2HIO C;  5AY8 D;  4Z2M H;  1ZLA A;  5CPJ C;  5JRG D;  5B31 B;  5B33 C;  1JFI A;  4WNN B;  5B40 A;  2LY8 A;  5DNM D;  1Z2C B;  5CP6 D;  2BYM B;  2ARO C;  3LJA C;  1KX5 D;  3B6G C;  1P3F D;  4DRA A;  1M18 A;  4WU8 D;  5AY8 B;  1P3I A;  2Y2P A;  5B2J C;  3W98 B;  1A7W A;  1TAF B;  5JRG B;  3MVD B;  3AZF A;  1P3B D;  2Y2J A;  3KFU G;  4EO5 C;  4Z66 A;  5GT3 C;  4QLC C;  2PYO A;  5GSU D;  2NZD C;  5DNN D;  5B1M C;  5B31 G;  5AVC D;  3A6N D;  3MGS C;  4Z5T B;  1M19 D;  3UT9 B;  3WAA B;  5B2I B;  1TZY C;  5CHL B;  2Y2N A;  3MGP C;  4ZBJ C;  3AZI A;  3MNN B;  5AVB D;  5AV9 B;  3KWQ C;  2IO5 C;  5DNN B;  3REJ B;  4J8X C;  5B24 C;  5AV8 A;  5B0Z B;  3AFA B;  3AZH C;  2FJ7 B;  3W96 D;  1P34 D;  3C1B B;  3EPL A;  3AZK C;  4WU9 A;  3LEL A;  5AV5 B;  5KDM B;  3H0L C;  1KX3 C;  3MGR A;  1BH9 B;  3H0R C;  2Y2Q A;  1KX4 B;  3WAA A;  4H9O A;  3W99 C;  3C1C A;  3EPJ A;  1ZLA C;  3KXB A;  3UTA D;  3UTB A;  3AZL C;  1S32 D;  5B40 C;  4KUD C;  3WKJ D;  4JJN B;  2Y2L A;  1P3L B;  4H9R A;  1H3O A;  3REK D;  3AN2 B;  1M18 C;  3REL A;  1AOI A;  1P3I C;  2JCH A;  3X1U D;  2Y2M A;  5AV6 D;  3AZF C;  5F99 D;  1KX4 A;  2F8N B;  2W8S A;  5E5A B;  2L5A A;  3AZG B;  2HIO B;  2PYO C;  4J8V D;  1F1E A;  5CPJ B;  5B33 B;  3AZJ A;  1PZR A;  4WV4 B;  4H9P A;  3X1U B;  3AL0 C;  2ARO B;  3LJA B;  3AZE D;  3B6G B;  2RIQ A;  1M1A D;  4YS3 C;  3AZI C;  5CPK D;  2F2A C;  1HQ3 A;  3VH6 W;  3LZ0 D;  5B2J B;  2F8N A;  4YM6 D;  3A1I A;  3REI A;  1B6W A;  4EO5 B;  5E5A A;  3W97 D;  4G92 B;  3AZG A;  5GT3 B;  4DQY B;  4QLC B;  4WU9 C;  3LEL C;  2NZD B;  3AZE B;  3EPK A;  3MGR C;  3MGS B;  1P3A A;  5B32 D;  4YM6 B;  1TZY B;  3C1C C;  4H9N A;  3KXB C;  3AZN D;  3AV1 D;  3MGP B;  4ZBJ B;  3UTB C;  3B6F A;  4J8U D;  2CV5 D;  2IO5 B;  3O62 D;  3WTP C;  5B24 B;  4J8X B;  1P3M A;  5CPI D;  4CSR A;  3LZ1 C;  3AZH B;  4NFT A;  5BT1 C;  4UUZ B;  4QLC A;  4H9Q B;  3AZK B;  3REL C;  5GT0 A;  1AOI C;  1KX3 B;  4WJ3 C;  5B1M A;  5G49 B;  3X1V D;  3X1S D;  3KUY C;  4J8W C;  2Y2H A;  3W99 B;  5GXQ D;  1ZLA B;  2NQB D;  4LD9 D;  5FUG A;  1JFI B;  3AZJ C;  3A1K A;  1P3G A;  3KWQ A;  3AZL B;  4Z66 D;  1P3K A;  3REH D;  5B40 B;  4J8X A;  4KUD B;  1B67 A;  5B31 D;  1P3O A;  3V9R B;  1P3P A;  1M18 B;  1HQ3 C;  1P3I B;  4XUJ A;  3AZF B;  3REI C;  4X23 A;  4R8P A;  2PYO B;  3W98 D;  3MVD D;  3AZL A;  5AV8 D;  4XZQ C;  1P3A C;  3VH5 W;  4KUD A;  3MGQ A;  3X1T A;  1KU5 A;  2YFV A;  3V9R A;  2RVQ C;  3AZI B;  4YS3 B;  2ZY3 A;  4Z5T D;  3B6F C;  4ZUX A;  3UT9 D;  3WAA D;  5B2I D;  4KGC A;  2G5I C;  5AV8 B;  1P3M C;  3TU4 C;  3MNN D;  5AV9 D;  3B0C T;  3REJ D;  2YFW A;  3LEL B;  4WU9 B;  3WA9 A;  5GT0 C;  5B0Z D;  3MGR B;  3AFA D;  4NE6 A;  2VQR A;  2FJ7 D;  5B1L A;  3C1B D;  1U35 A;  4H9O B;  5AV5 D;  3AYW A;  3C1C B;  3KXB B;  4YS3 A;  1WWS A;  1P3G C;  3UTB B;  1KX4 D;  1ID3 A;  1F66 A;  1P3K C;  1EQZ A;  2HUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...