3B6FA

Nucleosome core particle treated with cisplatin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fA00
1P3AB 5GT0B 4CSRB 2HIOC 5B2IC 5DNNC 5F99D 1M19C 2HIOD 5B2ID 5AV9C 3B0BA 5CPJC 3C1BD 1TAFA 5AV9D 5AY8B 2PYOC 1H3OB 1TZYB 3AN2D 1KX4A 3AZHD 3LZ1B 4KGCB 5FUGA 3W98D 5C3IB 2AROD 5AV6C 3AZIA 5AV6D 2F8NG 5B0YC 4LD9D 3AV1A 1B6WA 5B0YD 3V9RB 1KX4C 3KXBB 3W99B 3UTBB 3TU4D 5GT3A 1ID3D 3AZIC 4R8PA 1P3BC 4H9PB 3B0CW 3AV1C 1P34A 3REKD 1N1JA 5B33D 3AZND 5AV5A 1P3GC 3B6GB 4J8XC 3UT9A 2F8ND 3KWQB 1M18B 3A6NB 1P3GD 4E44A 2F8NH 1P3LA 5BNVB 4J8VB 1KX3A 1P3IC 2CV5C 4R8PC 5B32D 3AZKA 1ZLAD 3AZGB 1P3ID 5B2JA 3LJAA 3MGQA 5GXQB 3MVDC 3MGRA 3AZJA 2CV5D 1B67A 1P34C 2F8NK 3MVDD 1F1EA 5AV5C 3W97A 3UT9C 3X1VC 4JJNB 4QLCC 5B1MA 3X1VD 3X1UA 3AYWC 4QLCD 2HUEB 2HIOB 4XZQA 5B2IB 5DNNB 1P3AA 1M19B 5GT0A 3AYWD 4CSRA 4XUJD 3C1BB 1KX5C 5AV9B 5B24D 5B2JC 3LJAC 1KX5D 3REJD 4HGAC 5CPID 5AY8A 3W98B 1H3OA 3W97C 1TZYA 3LZ1A 2AROB 4KGCA 5BO0B 3AZLC 5AV6B 4XZQC 3AZFD 1P3AC 1AOIC 5GT0C 5B0YB 1WWSA 2NZDD 1AOID 3KSYA 3VH6W 5AVBD 3V9RA 4ZBJC 3TU4B 2LY8A 4KGCC 3KXBA 3AZMD 3W99A 3UTBA 5C3IC 2NQBD 1P3BB 5B0ZC 5B33B 1P3OD 5B0ZD 4H9PA 2F8NB 1P3GB 4H9RB 4J8XB 4WV4B 3B6GA 1BH8B 4J8UD 3KWQA 1M18A 3KXBC 3A6NA 1P3PC 5B32B 3UTBC 1ZLAB 1P3PD 1P3IB 2CV5B 4J8VA 3WAAC 3MVDB 3AFAC 3AZGA 5GXQA 3AFAD 3WAAD 3MGSC 4YM6C 3B6GC 3X1VB 4QLCB 3MGSD 4YM6D 4EO5C 3KWQC 3A6NC 4JJNA 3AYWB 4XUJB 4NFTA 5BS7C 5B24B 3AZED 4J8VC 2HIOA 1KX5B 5B2IA 5DNNA 1M19A 3KUYD 3C1BA 5AV9A 1WWIA 2RVQD 3VH5W 5BNXB 3MNNC 3MNND 5DNMD 5B31D 5AV8D 3W98A 4H9NB 3AZLB 3AZFB 2AROA 5GSUD 4WU8D 5BO0A 2NZDB 4XZQB 1AOIB 5F99C 5AV6A 2HUEC 1P3MC 5AVBB 5B0YA 3C1BC 4E45A 1P3MD 3AN2C 4ZBJB 4G91B 3AZHC 4YS3C 3AZMB 4YS3D 3W98C 3TU4A 4G92C 2AROC 5B0ZB 4X23C 1F66D 3LZ0D 4LD9C 1P3BA 3WTPE 4X23D 5B33A 2F8NA 1P3GA 4H9RA 4J8XA 5B32G 3TU4C 1BH8A 1P3PB 1P3KD 1ID3C 5B32A 1ZLAA 1P3IA 2CV5A 3W96D 5B40D 3AFAB 3WAAB 3MVDA 3REKC 5B33C 3AZNC 3MGSB 4YM6B 5AVCC 4EO5B 3X1VA 4QLCA 5AVCD 3AZEB 3KUYB 3AYWA 4XUJA 5B32C 1ZLAC 5B24A 3VH6A 1KX5A 3REJA 3MNNB 5BNXA 5DNMB 5AV8B 3B6FC 1BFMA 5CPKC 5GSUB 3B6FD 5CPKD 4H9NA 3AZLA 3AZFA 1ULYA 5F99B 2NZDA 4XUJC 1P3MB 3C1CD 1AOIA 5B24C 2CWEA 3R45B 3REJC 5CPIC 5AVBA 3AN2B 3AZHB 4YS3B 1Q9CA 4G92B 3AZMA 3WKJC 3RELD 3AZFC 1F66B 3WTPC 3WKJD 2BYMB 2NZDC 4X23B 4LD9B 3WTPD 3B0CT 5B0ZA 1P3OA 4M6BA 5AVBC 5B1LD 4NE5A 4G91C 4H9OB 5G49B 3AZMC 1ID3B 4DRBA 1P3PA 3AZKD 3W96B 2NQBC 3VH5A 1P3FD 1P3OC 4ZUXD 3REKB 3AFAA 3WAAA 3AZNB 5E5AC 3REIC 5B1MD 5E5AD 5AVCB 4J8UC 3MGSA 4YM6A 3O62C 3REID 3O62D 3AZEA 4UUZB 5BS7A 4WU9D 3KUYA 5B31G 1TZYD 5CP6C 3MNNA 3B6FB 5DNMA 5AV8A 5CPKB 5CP6D 5GSUA 3LELC 3UTAD 1HQ3C 3C1CB 5JA4B 3LELD 2IO5B 3AZEC 1HQ3D 1KU5A 5F99A 3KUYC 4Z2MG 1P3MA 5CHLB 4J8WC 2RVQC 3REJB 5CPIB 1S32D 3VH6T 3R45A 4J8WD 3NQJB 3AN2A 5DNMC 5B31C 5JRGD 5AV8C 3AZHA 4YS3A 1JFIB 3RELB 3WKJB 5GSUC 4Z66D 2YFWB 4WU8C 3WTPB 5BT1C 3MGPC 1F66A 5BT1D 4KUDC 2BYMA 3MGPD 5B1LB 4X23A 4LD9A 3B0DC 4KUDD 2FJ7C 2FJ7D 3AV2C 1M18D 3X1SD 4AWLB 3AV2D 1EQZD 1P3KA 2YFVB 4Z2MH 4H9OA 5G49A 1P3FB 1ID3A 2NQBB 4H9SC 2BYKB 3W96A 4ZUXB 3AZGD 1F66C 3LZ0C 1P3OB 1U35D 5E5AB 4Z5TD 3REKA 3REIB 3AZNA 4NE3A 3WA9C 4J8UB 3REHD 3O62B 4JJND 3WA9D 4NE6A 1P3KC 5AVCA 3X1TC 4WU9B 5DNND 3X1TD 1M19D 1M1AC 3W96C 4UUZA 5B40C 5CPJD 1M1AD 3VH5T 2PYOD 5CP6B 3NQUB 3UTAB 3B6FA 5CPKA 3LELB 1BH9B 1HQ3B 3C1CA 5JA4A 1S32B 1A7WA 4J8WB 4KHAB 5JRGB 5CPIA 1KX4D 5B31B 4H9QB 4Z66B 3NQJA 1JFIA 4WU8B 3RELA 3WKJA 3AZID 2YFWA 3MGPB 1P3BD 3C1CC 3WTPA 4KUDB 3AV1D 2IO5C 4CAYB 3B0DB 2FJ7B 5B1LA 3X1SB 4J8XD 3AV2B 1EQZB 5GT3C 5GT3D 4DRAA 3RELC 2YFVA 5KDMB 4R8PD 1P3FA 3LZ0B 1U35B 2NQBA 1P34D 2BYKA 4Z5TB 4ZUXA 2JSSA 5B1LC 5AV5D 3REHB 3UT9D 5E5AA 3WA9B 3REIA 1P3LC 1P3KB 1KX3C 4J8UA 3X1TB 3O62A 4WNNB 4AWLC 1P3LD 3AZKC 1KX3D 5CPJB 1R4VA 3MGQC 3AZJC 3MGRC 4WU9A 1M1AB 1P3FC 5B40B 2PYOB 5B2JD 3LJAD 3MGQD 3AZJD 3MGRD 4ZUXC 3W97D 5B1MC 5CP6A 3X1UC 3AZLD 3NQUA 3UTAA 3X1UD 4XZQD 3LELA 1P3AD 1BH9A 5GT0D 1HQ3A 4WU9C 1TAFB 1KX4B 5AY8C 1S32A 4J8WA 1TZYC 5FUGB 5AY8D 3LZ1C 4KHAA 5JRGA 3LZ1D 4KGCD 5B31A 3AZIB 4H9QA 4Z66A 3UTAC 1HTAA 4WU8A 3AV1B 3MGPA 4KUDA 1S32C 4CAYA 2FJ7A 5JRGC 3X1SA 5GT3B 3W99C 3AV2A 1EQZA 3KXBD 3W99D 5BNVA 4Z66C 4R8PB 3UTBD 1P34B 5KDMA 4H9SA 1N1JB 5AV5B 3LZ0A 1U35A 3UT9B 4Z5TA 1M18C 3B6GD 3REHA 3X1SC 1P3LB 3WA9A 3KWQD 1KX3B 1EQZC 3A6ND 4WZSB 3AZKB 3X1TA 4WNNA 5B2JB 3LJAB 3MGQB 3MGRB 4J8VD 3AZJB 4HGAB 3AZGC 5CPJA 1M1AA 5GXQC 5B40A 2PYOA 1U35C 5GXQD 2L5AA 3W97B 4Z5TC 5B1MB 3REHC 3X1UB 4JJNC
chains in the Genus database with same CATH superfamily
1P3AB 5GT0B 4CSRB 2HIOC 5B2IC 2G5HC 5F99D 5DNNC 1M19C 2HIOD 5B2ID 5AV9C 3B0BA 5CPJC 3C1BD 2J8PA 1TAFA 5AV9D 5AY8B 2PYOC 1H3OB 1TZYB 3AN2D 1KX4A 3AZHD 3LZ1B 2Y2GA 4KGCB 5FUGA 3W98D 5C3IB 2AROD 5AV6C 1Z2CB 3AZIA 5AV6D 2F8NG 5B0YC 4LD9D 3AV1A 1B6WA 5B0YD 3V9RB 1KX4C 3KXBB 3W99B 3UTBB 3TU4D 5GT3A 1ID3D 3AZIC 4R8PA 1P3BC 4H9PB 3B0CW 3AV1C 1P34A 3REKD 1N1JA 5B33D 3AZND 5AV5A 1P3GC 2XD1A 3B6GB 4J8XC 3UT9A 2F8ND 3KWQB 1M18B 3A6NB 1P3GD 4E44A 2F8NH 1P3LA 5BNVB 4J8VB 1KX3A 1P3IC 2CV5C 4R8PC 5B32D 3AZKA 1ZLAD 3AZGB 1P3ID 5B2JA 3LJAA 3MGQA 5GXQB 3MVDC 3MGRA 3AZJA 2CV5D 1B67A 3P5JB 1P34C 3MVDD 1F1EA 5AV5C 3W97A 3UT9C 3AL0C 3X1VC 4JJNB 4QLCC 5B1MA 3X1VD 3X1UA 3EPKA 4QLCD 3AYWC 2HUEB 2HIOB 4XZQA 5B2IB 5DNNB 1P3AA 1M19B 5GT0A 3AYWD 4CSRA 4XUJD 3C1BB 1KX5C 5AV9B 5B24D 5B2JC 3LJAC 1KX5D 3REJD 4HGAC 5CPID 5AY8A 3W98B 1H3OA 3W97C 1TZYA 3LZ1A 2AROB 4KGCA 5BO0B 3AZLC 5AV6B 4XZQC 3AZFD 1P3AC 1AOIC 5GT0C 5B0YB 1WWSA 2NZDD 1AOID 3KSYA 3VH6W 5AVBD 3V9RA 4ZBJC 3TU4B 2LY8A 4KGCC 3KXBA 3AZMD 3W99A 3UTBA 5C3IC 2NQBD 1P3BB 5B0ZC 5B33B 1P3OD 5B0ZD 4H9PA 2F8NB 1P3GB 2Y2MA 4H9RB 4J8XB 4WV4B 3B6GA 1BH8B 4J8UD 3KWQA 1M18A 3KXBC 3A6NA 1P3PC 5B32B 3UTBC 1ZLAB 1P3PD 1P3IB 2CV5B 3IP4C 4J8VA 3WAAC 3MVDB 3AFAC 3AZGA 5GXQA 3AFAD 3WAAD 3MGSC 4YM6C 3B6GC 2ZM5A 3X1VB 4QLCB 3MGSD 4YM6D 4EO5C 3KWQC 3A6NC 4JJNA 3AYWB 3F6TA 4XUJB 4NFTA 5BS7C 5B24B 3AZED 4J8VC 2HIOA 1KX5B 5B2IA 5DNNA 1M19A 3KUYD 3C1BA 5AV9A 1WWIA 2RVQD 3VH5W 5BNXB 3MNNC 3MNND 5DNMD 5B31D 5AV8D 3W98A 4H9NB 3AZLB 3AZFB 2AROA 5GSUD 4WU8D 5BO0A 2ZY2A 2NZDB 4XZQB 1AOIB 5F99C 5AV6A 2HUEC 1P3MC 5AVBB 5B0YA 3C1BC 2Y2KA 4E45A 1P3MD 3AN2C 4ZBJB 4G91B 3AZHC 4YS3C 3AZMB 2Y2JA 4YS3D 3W98C 3TU4A 4G92C 2AROC 5B0ZB 4X23C 1F66D 3LZ0D 4LD9C 1P3BA 3WTPE 4X23D 3EPLA 5B33A 2F8NA 1P3GA 4H9RA 3EPJA 4J8XA 5B32G 2Y2OA 3TU4C 1BH8A 2ZY5A 1P3KD 1P3PB 1ID3C 5B32A 1ZLAA 1P3IA 2CV5A 3W96D 5B40D 3AFAB 3WAAB 3MVDA 3REKC 5B33C 3AZNC 3MGSB 4YM6B 5AVCC 4EO5B 3X1VA 4QLCA 5AVCD 3AZEB 3KUYB 3AYWA 4XUJA 2JCHA 5B32C 1ZLAC 5B24A 3VH6A 1KX5A 3REJA 3MNNB 5BNXA 5DNMB 5AV8B 3B6FC 1BFMA 5CPKC 5GSUB 3B6FD 5CPKD 4H9NA 3AZLA 3AZFA 1ULYA 5F99B 2NZDA 4XUJC 1P3MB 3C1CD 1AOIA 5B24C 2CWEA 3R45B 3REJC 5CPIC 5AVBA 3AN2B 3AZHB 4YS3B 1Q9CA 4G92B 3AZMA 3WKJC 3RELD 3AZFC 1F66B 3WTPC 3WKJD 2BYMB 2NZDC 4X23B 4LD9B 3WTPD 3B0CT 5B0ZA 1P3OA 4M6BA 5AVBC 5B1LD 4NE5A 2DF4C 4G91C 4H9OB 3H0MC 5G49B 3AZMC 1ID3B 4DRBA 1P3PA 3AZKD 3W96B 2NQBC 2JE5A 3VH5A 1P3FD 1P3OC 4ZUXD 3REKB 3AFAA 3WAAA 3AZNB 5E5AC 3REIC 5B1MD 5E5AD 5AVCB 4J8UC 3MGSA 4YM6A 3O62C 3REID 3O62D 2XD5A 3A1KA 3AZEA 4UUZB 5BS7A 4WU9D 3KUYA 5B31G 1TZYD 5CP6C 3MNNA 3B6FB 5DNMA 5AV8A 5CPKB 5CP6D 5GSUA 3LELC 3UTAD 1HQ3C 2RIQA 5JA4B 3LELD 3C1CB 3H0LC 2IO5B 3AZEC 1HQ3D 1KU5A 2BG1A 5F99A 3KUYC 4Z2MG 1P3MA 5CHLB 4J8WC 2RVQC 3REJB 5CPIB 1S32D 3VH6T 2G5IC 3R45A 4J8WD 3NQJB 3AN2A 5DNMC 5B31C 5JRGD 5AV8C 3AZHA 4YS3A 1JFIB 3RELB 3WKJB 5GSUC 4Z66D 2YFWB 4WU8C 3WTPB 5BT1C 3MGPC 1F66A 5BT1D 4KUDC 2BYMA 3MGPD 5B1LB 4X23A 4LD9A 3B0DC 4UPKA 2FJ7C 4KUDD 2VQRA 2FJ7D 3AV2C 1M18D 3X1SD 4AWLB 3AV2D 1EQZD 1P3KA 2YFVB 4Z2MH 4H9OA 5G49A 1P3FB 2ZY4A 1ID3A 2NQBB 4WJ3C 4H9SC 2BYKB 3W96A 4ZUXB 2FFFB 3AZGD 3LZ0C 1F66C 1P3OB 1U35D 5E5AB 4Z5TD 3REKA 2F2AC 3REIB 3AZNA 4NE3A 3WA9C 4J8UB 3REHD 2UWXA 3O62B 4JJND 3WA9D 4NE6A 1P3KC 5AVCA 3X1TC 4WU9B 5DNND 3X1TD 1M19D 4DQYB 1M1AC 3W96C 4UUZA 5B40C 5CPJD 1M1AD 3VH5T 2PYOD 5CP6B 2Y2NA 3NQUB 3UTAB 3B6FA 5CPKA 3LELB 2Y2HA 1BH9B 1HQ3B 3C1CA 5JA4A 1S32B 1A7WA 4J8WB 2Y2QA 4KHAB 2DQNC 5JRGB 5CPIA 1KX4D 5B31B 2Y2IA 4H9QB 4Z66B 3NQJA 1JFIA 4WU8B 2Y2LA 3RELA 3WKJA 3AZID 2YFWA 3MGPB 1P3BD 3C1CC 3WTPA 4KUDB 3AV1D 2IO5C 2F8NK 4CAYB 2Y2PA 3B0DB 2FJ7B 5B1LA 3X1SB 4J8XD 3AV2B 1EQZB 5GT3C 5GT3D 4DRAA 3RELC 2YFVA 5KDMB 4R8PD 3A1IA 1P3FA 3LZ0B 1U35B 2NQBA 1P34D 2BYKA 4ZUXA 1W2EA 4Z5TB 2JSSA 5B1LC 5AV5D 3REHB 3UT9D 5E5AA 3WA9B 3REIA 1P3LC 1P3KB 1KX3C 4J8UA 3X1TB 3O62A 4WNNB 4AWLC 1P3LD 3AZKC 1KX3D 3FDDA 5CPJB 1R4VA 3MGQC 3AZJC 3MGRC 4WU9A 1M1AB 1P3FC 5B40B 2PYOB 5B2JD 3LJAD 3MGQD 3AZJD 3MGRD 4ZUXC 3W97D 5B1MC 5CP6A 3X1UC 3AZLD 3EPHA 3NQUA 3UTAA 3X1UD 4XZQD 3LELA 1P3AD 1BH9A 5GT0D 1HQ3A 4WU9C 1TAFB 1KX4B 5AY8C 1S32A 4J8WA 1T3UA 1TZYC 5FUGB 5AY8D 3LZ1C 4KHAA 5JRGA 3LZ1D 4KGCD 5B31A 3AZIB 4H9QA 4Z66A 3UTAC 1HTAA 4WU8A 2W8SA 3AV1B 3KFUG 3MGPA 4KUDA 1S32C 4CAYA 2FJ7A 5JRGC 3X1SA 5GT3B 3W99C 3AV2A 1EQZA 3KXBD 3W99D 5BNVA 4Z66C 4R8PB 3UTBD 1P34B 5KDMA 4H9SA 1N1JB 5AV5B 3LZ0A 1U35A 3UT9B 4Z5TA 1M18C 3B6GD 3REHA 3X1SC 1P3LB 3WA9A 3KWQD 1KX3B 3EG5B 3A6ND 1EQZC 4WZSB 3AZKB 3X1TA 1PZRA 4WNNA 5B2JB 3LJAB 3MGQB 3H0RC 3MGRB 4J8VD 3AZJB 4HGAB 3AZGC 5CPJA 1M1AA 5GXQC 5B40A 2PYOA 1U35C 5GXQD 2L5AA 3W97B 4Z5TC 5B1MB 2ZY3A 3REHC 3X1UB 4JJNC
chains in the Genus database with same CATH topology
1P3AB 5GT0B 4CSRB 2HIOC 5B2IC 2G5HC 5F99D 5DNNC 1M19C 2HIOD 5B2ID 5AV9C 3B0BA 5CPJC 3C1BD 2J8PA 1TAFA 5AV9D 5AY8B 2PYOC 1H3OB 1TZYB 3AN2D 1KX4A 3AZHD 3LZ1B 2Y2GA 4KGCB 5FUGA 3W98D 5C3IB 2AROD 5AV6C 1Z2CB 3AZIA 5AV6D 2F8NG 5B0YC 4LD9D 3AV1A 1B6WA 5B0YD 3V9RB 1KX4C 3KXBB 3W99B 3UTBB 3TU4D 5GT3A 1ID3D 3AZIC 4R8PA 1P3BC 4H9PB 3B0CW 3AV1C 1P34A 3REKD 1N1JA 5B33D 3AZND 5AV5A 1P3GC 2XD1A 3B6GB 4J8XC 3UT9A 2F8ND 3KWQB 1M18B 3A6NB 1P3GD 4E44A 2F8NH 1P3LA 5BNVB 4J8VB 1KX3A 1P3IC 2CV5C 4R8PC 5B32D 3AZKA 1ZLAD 3AZGB 1P3ID 5B2JA 3LJAA 3MGQA 5GXQB 3MVDC 3MGRA 3AZJA 2CV5D 1B67A 3P5JB 1P34C 3MVDD 1F1EA 5AV5C 3W97A 3UT9C 3AL0C 3X1VC 4JJNB 4QLCC 5B1MA 3X1VD 3X1UA 3EPKA 4QLCD 3AYWC 2HUEB 2HIOB 4XZQA 5B2IB 5DNNB 1P3AA 1M19B 5GT0A 3AYWD 4CSRA 4XUJD 3C1BB 1KX5C 5AV9B 5B24D 5B2JC 3LJAC 1KX5D 3REJD 4HGAC 5CPID 5AY8A 3W98B 1H3OA 3W97C 1TZYA 3LZ1A 2AROB 4KGCA 5BO0B 3AZLC 5AV6B 4XZQC 3AZFD 1P3AC 1AOIC 5GT0C 5B0YB 1WWSA 2NZDD 1AOID 3KSYA 3VH6W 5AVBD 3V9RA 4ZBJC 3TU4B 2LY8A 4KGCC 3KXBA 3AZMD 3W99A 3UTBA 5C3IC 2NQBD 1P3BB 5B0ZC 5B33B 1P3OD 5B0ZD 4H9PA 2F8NB 1P3GB 2Y2MA 4H9RB 4J8XB 4WV4B 3B6GA 1BH8B 4J8UD 3KWQA 1M18A 3KXBC 3A6NA 1P3PC 5B32B 3UTBC 1ZLAB 1P3PD 1P3IB 2CV5B 3IP4C 4J8VA 3WAAC 3MVDB 3AFAC 3AZGA 5GXQA 3AFAD 3WAAD 3MGSC 4YM6C 3B6GC 2ZM5A 3X1VB 4QLCB 3MGSD 4YM6D 4EO5C 3KWQC 3A6NC 4JJNA 3AYWB 3F6TA 4XUJB 4NFTA 5BS7C 5B24B 3AZED 4J8VC 2HIOA 1KX5B 5B2IA 5DNNA 1M19A 3KUYD 3C1BA 5AV9A 1WWIA 2RVQD 3VH5W 5BNXB 3MNNC 3MNND 5DNMD 5B31D 5AV8D 3W98A 4H9NB 3AZLB 3AZFB 2AROA 5GSUD 4WU8D 5BO0A 2ZY2A 2NZDB 4XZQB 1AOIB 5F99C 5AV6A 2HUEC 1P3MC 5AVBB 5B0YA 3C1BC 2Y2KA 4E45A 1P3MD 3AN2C 4ZBJB 4G91B 3AZHC 4YS3C 3AZMB 2Y2JA 4YS3D 3W98C 3TU4A 4G92C 2AROC 5B0ZB 4X23C 1F66D 3LZ0D 4LD9C 1P3BA 3WTPE 4X23D 3EPLA 5B33A 2F8NA 1P3GA 4H9RA 3EPJA 4J8XA 5B32G 2Y2OA 3TU4C 1BH8A 2ZY5A 1P3KD 1P3PB 1ID3C 5B32A 1ZLAA 1P3IA 2CV5A 3W96D 5B40D 3AFAB 3WAAB 3MVDA 3REKC 5B33C 3AZNC 3MGSB 4YM6B 5AVCC 4EO5B 3X1VA 4QLCA 5AVCD 3AZEB 3KUYB 3AYWA 4XUJA 2JCHA 5B32C 1ZLAC 5B24A 3VH6A 1KX5A 3REJA 3MNNB 5BNXA 5DNMB 5AV8B 3B6FC 1BFMA 5CPKC 5GSUB 3B6FD 5CPKD 4H9NA 3AZLA 3AZFA 1ULYA 5F99B 2NZDA 4XUJC 1P3MB 3C1CD 1AOIA 5B24C 2CWEA 3R45B 3REJC 5CPIC 5AVBA 3AN2B 3AZHB 4YS3B 1Q9CA 4G92B 3AZMA 3WKJC 3RELD 3AZFC 1F66B 3WTPC 3WKJD 2BYMB 2NZDC 4X23B 4LD9B 3WTPD 3B0CT 5B0ZA 1P3OA 4M6BA 5AVBC 5B1LD 4NE5A 2DF4C 4G91C 4H9OB 3H0MC 5G49B 3AZMC 1ID3B 4DRBA 1P3PA 3AZKD 3W96B 2NQBC 2JE5A 3VH5A 1P3FD 1P3OC 4ZUXD 3REKB 3AFAA 3WAAA 3AZNB 5E5AC 3REIC 5B1MD 5E5AD 5AVCB 4J8UC 3MGSA 4YM6A 3O62C 3REID 3O62D 2XD5A 3A1KA 3AZEA 4UUZB 5BS7A 4WU9D 3KUYA 5B31G 1TZYD 5CP6C 3MNNA 3B6FB 5DNMA 5AV8A 5CPKB 5CP6D 5GSUA 3LELC 3UTAD 1HQ3C 2RIQA 5JA4B 3LELD 3C1CB 3H0LC 2IO5B 3AZEC 1HQ3D 1KU5A 2BG1A 5F99A 3KUYC 4Z2MG 1P3MA 5CHLB 4J8WC 2RVQC 3REJB 5CPIB 1S32D 3VH6T 2G5IC 3R45A 4J8WD 3NQJB 3AN2A 5DNMC 5B31C 5JRGD 5AV8C 3AZHA 4YS3A 1JFIB 3RELB 3WKJB 5GSUC 4Z66D 2YFWB 4WU8C 3WTPB 5BT1C 3MGPC 1F66A 5BT1D 4KUDC 2BYMA 3MGPD 5B1LB 4X23A 4LD9A 3B0DC 4UPKA 2FJ7C 4KUDD 2VQRA 2FJ7D 3AV2C 1M18D 3X1SD 4AWLB 3AV2D 1EQZD 1P3KA 2YFVB 4Z2MH 4H9OA 5G49A 1P3FB 2ZY4A 1ID3A 2NQBB 4WJ3C 4H9SC 2BYKB 3W96A 4ZUXB 2FFFB 3AZGD 3LZ0C 1F66C 1P3OB 1U35D 5E5AB 4Z5TD 3REKA 2F2AC 3REIB 3AZNA 4NE3A 3WA9C 4J8UB 3REHD 2UWXA 3O62B 4JJND 3WA9D 4NE6A 1P3KC 5AVCA 3X1TC 4WU9B 5DNND 3X1TD 1M19D 4DQYB 1M1AC 3W96C 4UUZA 5B40C 5CPJD 1M1AD 3VH5T 2PYOD 5CP6B 2Y2NA 3NQUB 3UTAB 3B6FA 5CPKA 3LELB 2Y2HA 1BH9B 1HQ3B 3C1CA 5JA4A 1S32B 1A7WA 4J8WB 2Y2QA 4KHAB 2DQNC 5JRGB 5CPIA 1KX4D 5B31B 2Y2IA 4H9QB 4Z66B 3NQJA 1JFIA 4WU8B 2Y2LA 3RELA 3WKJA 3AZID 2YFWA 3MGPB 1P3BD 3C1CC 3WTPA 4KUDB 3AV1D 2IO5C 2F8NK 4CAYB 2Y2PA 3B0DB 2FJ7B 5B1LA 3X1SB 4J8XD 3AV2B 1EQZB 5GT3C 5GT3D 4DRAA 3RELC 2YFVA 5KDMB 4R8PD 3A1IA 1P3FA 3LZ0B 1U35B 2NQBA 1P34D 2BYKA 4ZUXA 1W2EA 4Z5TB 2JSSA 5B1LC 5AV5D 3REHB 3UT9D 5E5AA 3WA9B 3REIA 1P3LC 1P3KB 1KX3C 4J8UA 3X1TB 3O62A 4WNNB 4AWLC 1P3LD 3AZKC 1KX3D 3FDDA 5CPJB 1R4VA 3MGQC 3AZJC 3MGRC 4WU9A 1M1AB 1P3FC 5B40B 2PYOB 5B2JD 3LJAD 3MGQD 3AZJD 3MGRD 4ZUXC 3W97D 5B1MC 5CP6A 3X1UC 3AZLD 3EPHA 3NQUA 3UTAA 3X1UD 4XZQD 3LELA 1P3AD 1BH9A 5GT0D 1HQ3A 4WU9C 1TAFB 1KX4B 5AY8C 1S32A 4J8WA 1T3UA 1TZYC 5FUGB 5AY8D 3LZ1C 4KHAA 5JRGA 3LZ1D 4KGCD 5B31A 3AZIB 4H9QA 4Z66A 3UTAC 1HTAA 4WU8A 2W8SA 3AV1B 3KFUG 3MGPA 4KUDA 1S32C 4CAYA 2FJ7A 5JRGC 3X1SA 5GT3B 3W99C 3AV2A 1EQZA 3KXBD 3W99D 5BNVA 4Z66C 4R8PB 3UTBD 1P34B 5KDMA 4H9SA 1N1JB 5AV5B 3LZ0A 1U35A 3UT9B 4Z5TA 1M18C 3B6GD 3REHA 3X1SC 1P3LB 3WA9A 3KWQD 1KX3B 3EG5B 3A6ND 1EQZC 4WZSB 3AZKB 3X1TA 1PZRA 4WNNA 5B2JB 3LJAB 3MGQB 3H0RC 3MGRB 4J8VD 3AZJB 4HGAB 3AZGC 5CPJA 1M1AA 5GXQC 5B40A 2PYOA 1U35C 5GXQD 2L5AA 3W97B 4Z5TC 5B1MB 2ZY3A 3REHC 3X1UB 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A B;  5GT0 B;  4CSR B;  2HIO C;  5B2I C;  5DNN C;  5F99 D;  1M19 C;  2HIO D;  5B2I D;  5AV9 C;  3B0B A;  5CPJ C;  3C1B D;  1TAF A;  5AV9 D;  5AY8 B;  2PYO C;  1H3O B;  1TZY B;  3AN2 D;  1KX4 A;  3AZH D;  3LZ1 B;  4KGC B;  5FUG A;  3W98 D;  5C3I B;  2ARO D;  5AV6 C;  3AZI A;  5AV6 D;  2F8N G;  5B0Y C;  4LD9 D;  3AV1 A;  1B6W A;  5B0Y D;  3V9R B;  1KX4 C;  3KXB B;  3W99 B;  3UTB B;  3TU4 D;  5GT3 A;  1ID3 D;  3AZI C;  4R8P A;  1P3B C;  4H9P B;  3B0C W;  3AV1 C;  1P34 A;  3REK D;  1N1J A;  5B33 D;  3AZN D;  5AV5 A;  1P3G C;  3B6G B;  4J8X C;  3UT9 A;  2F8N D;  3KWQ B;  1M18 B;  3A6N B;  1P3G D;  4E44 A;  2F8N H;  1P3L A;  5BNV B;  4J8V B;  1KX3 A;  1P3I C;  2CV5 C;  4R8P C;  5B32 D;  3AZK A;  1ZLA D;  3AZG B;  1P3I D;  5B2J A;  3LJA A;  3MGQ A;  5GXQ B;  3MVD C;  3MGR A;  3AZJ A;  2CV5 D;  1B67 A;  1P34 C;  2F8N K;  3MVD D;  1F1E A;  5AV5 C;  3W97 A;  3UT9 C;  3X1V C;  4JJN B;  4QLC C;  5B1M A;  3X1V D;  3X1U A;  3AYW C;  4QLC D;  2HUE B;  2HIO B;  4XZQ A;  5B2I B;  5DNN B;  1P3A A;  1M19 B;  5GT0 A;  3AYW D;  4CSR A;  4XUJ D;  3C1B B;  1KX5 C;  5AV9 B;  5B24 D;  5B2J C;  3LJA C;  1KX5 D;  3REJ D;  4HGA C;  5CPI D;  5AY8 A;  3W98 B;  1H3O A;  3W97 C;  1TZY A;  3LZ1 A;  2ARO B;  4KGC A;  5BO0 B;  3AZL C;  5AV6 B;  4XZQ C;  3AZF D;  1P3A C;  1AOI C;  5GT0 C;  5B0Y B;  1WWS A;  2NZD D;  1AOI D;  3KSY A;  3VH6 W;  5AVB D;  3V9R A;  4ZBJ C;  3TU4 B;  2LY8 A;  4KGC C;  3KXB A;  3AZM D;  3W99 A;  3UTB A;  5C3I C;  2NQB D;  1P3B B;  5B0Z C;  5B33 B;  1P3O D;  5B0Z D;  4H9P A;  2F8N B;  1P3G B;  4H9R B;  4J8X B;  4WV4 B;  3B6G A;  1BH8 B;  4J8U D;  3KWQ A;  1M18 A;  3KXB C;  3A6N A;  1P3P C;  5B32 B;  3UTB C;  1ZLA B;  1P3P D;  1P3I B;  2CV5 B;  4J8V A;  3WAA C;  3MVD B;  3AFA C;  3AZG A;  5GXQ A;  3AFA D;  3WAA D;  3MGS C;  4YM6 C;  3B6G C;  3X1V B;  4QLC B;  3MGS D;  4YM6 D;  4EO5 C;  3KWQ C;  3A6N C;  4JJN A;  3AYW B;  4XUJ B;  4NFT A;  5BS7 C;  5B24 B;  3AZE D;  4J8V C;  2HIO A;  1KX5 B;  5B2I A;  5DNN A;  1M19 A;  3KUY D;  3C1B A;  5AV9 A;  1WWI A;  2RVQ D;  3VH5 W;  5BNX B;  3MNN C;  3MNN D;  5DNM D;  5B31 D;  5AV8 D;  3W98 A;  4H9N B;  3AZL B;  3AZF B;  2ARO A;  5GSU D;  4WU8 D;  5BO0 A;  2NZD B;  4XZQ B;  1AOI B;  5F99 C;  5AV6 A;  2HUE C;  1P3M C;  5AVB B;  5B0Y A;  3C1B C;  4E45 A;  1P3M D;  3AN2 C;  4ZBJ B;  4G91 B;  3AZH C;  4YS3 C;  3AZM B;  4YS3 D;  3W98 C;  3TU4 A;  4G92 C;  2ARO C;  5B0Z B;  4X23 C;  1F66 D;  3LZ0 D;  4LD9 C;  1P3B A;  3WTP E;  4X23 D;  5B33 A;  2F8N A;  1P3G A;  4H9R A;  4J8X A;  5B32 G;  3TU4 C;  1BH8 A;  1P3P B;  1P3K D;  1ID3 C;  5B32 A;  1ZLA A;  1P3I A;  2CV5 A;  3W96 D;  5B40 D;  3AFA B;  3WAA B;  3MVD A;  3REK C;  5B33 C;  3AZN C;  3MGS B;  4YM6 B;  5AVC C;  4EO5 B;  3X1V A;  4QLC A;  5AVC D;  3AZE B;  3KUY B;  3AYW A;  4XUJ A;  5B32 C;  1ZLA C;  5B24 A;  3VH6 A;  1KX5 A;  3REJ A;  3MNN B;  5BNX A;  5DNM B;  5AV8 B;  3B6F C;  1BFM A;  5CPK C;  5GSU B;  3B6F D;  5CPK D;  4H9N A;  3AZL A;  3AZF A;  1ULY A;  5F99 B;  2NZD A;  4XUJ C;  1P3M B;  3C1C D;  1AOI A;  5B24 C;  2CWE A;  3R45 B;  3REJ C;  5CPI C;  5AVB A;  3AN2 B;  3AZH B;  4YS3 B;  1Q9C A;  4G92 B;  3AZM A;  3WKJ C;  3REL D;  3AZF C;  1F66 B;  3WTP C;  3WKJ D;  2BYM B;  2NZD C;  4X23 B;  4LD9 B;  3WTP D;  3B0C T;  5B0Z A;  1P3O A;  4M6B A;  5AVB C;  5B1L D;  4NE5 A;  4G91 C;  4H9O B;  5G49 B;  3AZM C;  1ID3 B;  4DRB A;  1P3P A;  3AZK D;  3W96 B;  2NQB C;  3VH5 A;  1P3F D;  1P3O C;  4ZUX D;  3REK B;  3AFA A;  3WAA A;  3AZN B;  5E5A C;  3REI C;  5B1M D;  5E5A D;  5AVC B;  4J8U C;  3MGS A;  4YM6 A;  3O62 C;  3REI D;  3O62 D;  3AZE A;  4UUZ B;  5BS7 A;  4WU9 D;  3KUY A;  5B31 G;  1TZY D;  5CP6 C;  3MNN A;  3B6F B;  5DNM A;  5AV8 A;  5CPK B;  5CP6 D;  5GSU A;  3LEL C;  3UTA D;  1HQ3 C;  3C1C B;  5JA4 B;  3LEL D;  2IO5 B;  3AZE C;  1HQ3 D;  1KU5 A;  5F99 A;  3KUY C;  4Z2M G;  1P3M A;  5CHL B;  4J8W C;  2RVQ C;  3REJ B;  5CPI B;  1S32 D;  3VH6 T;  3R45 A;  4J8W D;  3NQJ B;  3AN2 A;  5DNM C;  5B31 C;  5JRG D;  5AV8 C;  3AZH A;  4YS3 A;  1JFI B;  3REL B;  3WKJ B;  5GSU C;  4Z66 D;  2YFW B;  4WU8 C;  3WTP B;  5BT1 C;  3MGP C;  1F66 A;  5BT1 D;  4KUD C;  2BYM A;  3MGP D;  5B1L B;  4X23 A;  4LD9 A;  3B0D C;  4KUD D;  2FJ7 C;  2FJ7 D;  3AV2 C;  1M18 D;  3X1S D;  4AWL B;  3AV2 D;  1EQZ D;  1P3K A;  2YFV B;  4Z2M H;  4H9O A;  5G49 A;  1P3F B;  1ID3 A;  2NQB B;  4H9S C;  2BYK B;  3W96 A;  4ZUX B;  3AZG D;  1F66 C;  3LZ0 C;  1P3O B;  1U35 D;  5E5A B;  4Z5T D;  3REK A;  3REI B;  3AZN A;  4NE3 A;  3WA9 C;  4J8U B;  3REH D;  3O62 B;  4JJN D;  3WA9 D;  4NE6 A;  1P3K C;  5AVC A;  3X1T C;  4WU9 B;  5DNN D;  3X1T D;  1M19 D;  1M1A C;  3W96 C;  4UUZ A;  5B40 C;  5CPJ D;  1M1A D;  3VH5 T;  2PYO D;  5CP6 B;  3NQU B;  3UTA B;  3B6F A;  5CPK A;  3LEL B;  1BH9 B;  1HQ3 B;  3C1C A;  5JA4 A;  1S32 B;  1A7W A;  4J8W B;  4KHA B;  5JRG B;  5CPI A;  1KX4 D;  5B31 B;  4H9Q B;  4Z66 B;  3NQJ A;  1JFI A;  4WU8 B;  3REL A;  3WKJ A;  3AZI D;  2YFW A;  3MGP B;  1P3B D;  3C1C C;  3WTP A;  4KUD B;  3AV1 D;  2IO5 C;  4CAY B;  3B0D B;  2FJ7 B;  5B1L A;  3X1S B;  4J8X D;  3AV2 B;  1EQZ B;  5GT3 C;  5GT3 D;  4DRA A;  3REL C;  2YFV A;  5KDM B;  4R8P D;  1P3F A;  3LZ0 B;  1U35 B;  2NQB A;  1P34 D;  2BYK A;  4Z5T B;  4ZUX A;  2JSS A;  5B1L C;  5AV5 D;  3REH B;  3UT9 D;  5E5A A;  3WA9 B;  3REI A;  1P3L C;  1P3K B;  1KX3 C;  4J8U A;  3X1T B;  3O62 A;  4WNN B;  4AWL C;  1P3L D;  3AZK C;  1KX3 D;  5CPJ B;  1R4V A;  3MGQ C;  3AZJ C;  3MGR C;  4WU9 A;  1M1A B;  1P3F C;  5B40 B;  2PYO B;  5B2J D;  3LJA D;  3MGQ D;  3AZJ D;  3MGR D;  4ZUX C;  3W97 D;  5B1M C;  5CP6 A;  3X1U C;  3AZL D;  3NQU A;  3UTA A;  3X1U D;  4XZQ D;  3LEL A;  1P3A D;  1BH9 A;  5GT0 D;  1HQ3 A;  4WU9 C;  1TAF B;  1KX4 B;  5AY8 C;  1S32 A;  4J8W A;  1TZY C;  5FUG B;  5AY8 D;  3LZ1 C;  4KHA A;  5JRG A;  3LZ1 D;  4KGC D;  5B31 A;  3AZI B;  4H9Q A;  4Z66 A;  3UTA C;  1HTA A;  4WU8 A;  3AV1 B;  3MGP A;  4KUD A;  1S32 C;  4CAY A;  2FJ7 A;  5JRG C;  3X1S A;  5GT3 B;  3W99 C;  3AV2 A;  1EQZ A;  3KXB D;  3W99 D;  5BNV A;  4Z66 C;  4R8P B;  3UTB D;  1P34 B;  5KDM A;  4H9S A;  1N1J B;  5AV5 B;  3LZ0 A;  1U35 A;  3UT9 B;  4Z5T A;  1M18 C;  3B6G D;  3REH A;  3X1S C;  1P3L B;  3WA9 A;  3KWQ D;  1KX3 B;  1EQZ C;  3A6N D;  4WZS B;  3AZK B;  3X1T A;  4WNN A;  5B2J B;  3LJA B;  3MGQ B;  3MGR B;  4J8V D;  3AZJ B;  4HGA B;  3AZG C;  5CPJ A;  1M1A A;  5GXQ C;  5B40 A;  2PYO A;  1U35 C;  5GXQ D;  2L5A A;  3W97 B;  4Z5T C;  5B1M B;  3REH C;  3X1U B;  4JJN C; 
#chains in the Genus database with same CATH topology
 1P3A B;  5GT0 B;  4CSR B;  2HIO C;  5B2I C;  2G5H C;  5F99 D;  5DNN C;  1M19 C;  2HIO D;  5B2I D;  5AV9 C;  3B0B A;  5CPJ C;  3C1B D;  2J8P A;  1TAF A;  5AV9 D;  5AY8 B;  2PYO C;  1H3O B;  1TZY B;  3AN2 D;  1KX4 A;  3AZH D;  3LZ1 B;  2Y2G A;  4KGC B;  5FUG A;  3W98 D;  5C3I B;  2ARO D;  5AV6 C;  1Z2C B;  3AZI A;  5AV6 D;  2F8N G;  5B0Y C;  4LD9 D;  3AV1 A;  1B6W A;  5B0Y D;  3V9R B;  1KX4 C;  3KXB B;  3W99 B;  3UTB B;  3TU4 D;  5GT3 A;  1ID3 D;  3AZI C;  4R8P A;  1P3B C;  4H9P B;  3B0C W;  3AV1 C;  1P34 A;  3REK D;  1N1J A;  5B33 D;  3AZN D;  5AV5 A;  1P3G C;  2XD1 A;  3B6G B;  4J8X C;  3UT9 A;  2F8N D;  3KWQ B;  1M18 B;  3A6N B;  1P3G D;  4E44 A;  2F8N H;  1P3L A;  5BNV B;  4J8V B;  1KX3 A;  1P3I C;  2CV5 C;  4R8P C;  5B32 D;  3AZK A;  1ZLA D;  3AZG B;  1P3I D;  5B2J A;  3LJA A;  3MGQ A;  5GXQ B;  3MVD C;  3MGR A;  3AZJ A;  2CV5 D;  1B67 A;  3P5J B;  1P34 C;  3MVD D;  1F1E A;  5AV5 C;  3W97 A;  3UT9 C;  3AL0 C;  3X1V C;  4JJN B;  4QLC C;  5B1M A;  3X1V D;  3X1U A;  3EPK A;  4QLC D;  3AYW C;  2HUE B;  2HIO B;  4XZQ A;  5B2I B;  5DNN B;  1P3A A;  1M19 B;  5GT0 A;  3AYW D;  4CSR A;  4XUJ D;  3C1B B;  1KX5 C;  5AV9 B;  5B24 D;  5B2J C;  3LJA C;  1KX5 D;  3REJ D;  4HGA C;  5CPI D;  5AY8 A;  3W98 B;  1H3O A;  3W97 C;  1TZY A;  3LZ1 A;  2ARO B;  4KGC A;  5BO0 B;  3AZL C;  5AV6 B;  4XZQ C;  3AZF D;  1P3A C;  1AOI C;  5GT0 C;  5B0Y B;  1WWS A;  2NZD D;  1AOI D;  3KSY A;  3VH6 W;  5AVB D;  3V9R A;  4ZBJ C;  3TU4 B;  2LY8 A;  4KGC C;  3KXB A;  3AZM D;  3W99 A;  3UTB A;  5C3I C;  2NQB D;  1P3B B;  5B0Z C;  5B33 B;  1P3O D;  5B0Z D;  4H9P A;  2F8N B;  1P3G B;  2Y2M A;  4H9R B;  4J8X B;  4WV4 B;  3B6G A;  1BH8 B;  4J8U D;  3KWQ A;  1M18 A;  3KXB C;  3A6N A;  1P3P C;  5B32 B;  3UTB C;  1ZLA B;  1P3P D;  1P3I B;  2CV5 B;  3IP4 C;  4J8V A;  3WAA C;  3MVD B;  3AFA C;  3AZG A;  5GXQ A;  3AFA D;  3WAA D;  3MGS C;  4YM6 C;  3B6G C;  2ZM5 A;  3X1V B;  4QLC B;  3MGS D;  4YM6 D;  4EO5 C;  3KWQ C;  3A6N C;  4JJN A;  3AYW B;  3F6T A;  4XUJ B;  4NFT A;  5BS7 C;  5B24 B;  3AZE D;  4J8V C;  2HIO A;  1KX5 B;  5B2I A;  5DNN A;  1M19 A;  3KUY D;  3C1B A;  5AV9 A;  1WWI A;  2RVQ D;  3VH5 W;  5BNX B;  3MNN C;  3MNN D;  5DNM D;  5B31 D;  5AV8 D;  3W98 A;  4H9N B;  3AZL B;  3AZF B;  2ARO A;  5GSU D;  4WU8 D;  5BO0 A;  2ZY2 A;  2NZD B;  4XZQ B;  1AOI B;  5F99 C;  5AV6 A;  2HUE C;  1P3M C;  5AVB B;  5B0Y A;  3C1B C;  2Y2K A;  4E45 A;  1P3M D;  3AN2 C;  4ZBJ B;  4G91 B;  3AZH C;  4YS3 C;  3AZM B;  2Y2J A;  4YS3 D;  3W98 C;  3TU4 A;  4G92 C;  2ARO C;  5B0Z B;  4X23 C;  1F66 D;  3LZ0 D;  4LD9 C;  1P3B A;  3WTP E;  4X23 D;  3EPL A;  5B33 A;  2F8N A;  1P3G A;  4H9R A;  3EPJ A;  4J8X A;  5B32 G;  2Y2O A;  3TU4 C;  1BH8 A;  2ZY5 A;  1P3K D;  1P3P B;  1ID3 C;  5B32 A;  1ZLA A;  1P3I A;  2CV5 A;  3W96 D;  5B40 D;  3AFA B;  3WAA B;  3MVD A;  3REK C;  5B33 C;  3AZN C;  3MGS B;  4YM6 B;  5AVC C;  4EO5 B;  3X1V A;  4QLC A;  5AVC D;  3AZE B;  3KUY B;  3AYW A;  4XUJ A;  2JCH A;  5B32 C;  1ZLA C;  5B24 A;  3VH6 A;  1KX5 A;  3REJ A;  3MNN B;  5BNX A;  5DNM B;  5AV8 B;  3B6F C;  1BFM A;  5CPK C;  5GSU B;  3B6F D;  5CPK D;  4H9N A;  3AZL A;  3AZF A;  1ULY A;  5F99 B;  2NZD A;  4XUJ C;  1P3M B;  3C1C D;  1AOI A;  5B24 C;  2CWE A;  3R45 B;  3REJ C;  5CPI C;  5AVB A;  3AN2 B;  3AZH B;  4YS3 B;  1Q9C A;  4G92 B;  3AZM A;  3WKJ C;  3REL D;  3AZF C;  1F66 B;  3WTP C;  3WKJ D;  2BYM B;  2NZD C;  4X23 B;  4LD9 B;  3WTP D;  3B0C T;  5B0Z A;  1P3O A;  4M6B A;  5AVB C;  5B1L D;  4NE5 A;  2DF4 C;  4G91 C;  4H9O B;  3H0M C;  5G49 B;  3AZM C;  1ID3 B;  4DRB A;  1P3P A;  3AZK D;  3W96 B;  2NQB C;  2JE5 A;  3VH5 A;  1P3F D;  1P3O C;  4ZUX D;  3REK B;  3AFA A;  3WAA A;  3AZN B;  5E5A C;  3REI C;  5B1M D;  5E5A D;  5AVC B;  4J8U C;  3MGS A;  4YM6 A;  3O62 C;  3REI D;  3O62 D;  2XD5 A;  3A1K A;  3AZE A;  4UUZ B;  5BS7 A;  4WU9 D;  3KUY A;  5B31 G;  1TZY D;  5CP6 C;  3MNN A;  3B6F B;  5DNM A;  5AV8 A;  5CPK B;  5CP6 D;  5GSU A;  3LEL C;  3UTA D;  1HQ3 C;  2RIQ A;  5JA4 B;  3LEL D;  3C1C B;  3H0L C;  2IO5 B;  3AZE C;  1HQ3 D;  1KU5 A;  2BG1 A;  5F99 A;  3KUY C;  4Z2M G;  1P3M A;  5CHL B;  4J8W C;  2RVQ C;  3REJ B;  5CPI B;  1S32 D;  3VH6 T;  2G5I C;  3R45 A;  4J8W D;  3NQJ B;  3AN2 A;  5DNM C;  5B31 C;  5JRG D;  5AV8 C;  3AZH A;  4YS3 A;  1JFI B;  3REL B;  3WKJ B;  5GSU C;  4Z66 D;  2YFW B;  4WU8 C;  3WTP B;  5BT1 C;  3MGP C;  1F66 A;  5BT1 D;  4KUD C;  2BYM A;  3MGP D;  5B1L B;  4X23 A;  4LD9 A;  3B0D C;  4UPK A;  2FJ7 C;  4KUD D;  2VQR A;  2FJ7 D;  3AV2 C;  1M18 D;  3X1S D;  4AWL B;  3AV2 D;  1EQZ D;  1P3K A;  2YFV B;  4Z2M H;  4H9O A;  5G49 A;  1P3F B;  2ZY4 A;  1ID3 A;  2NQB B;  4WJ3 C;  4H9S C;  2BYK B;  3W96 A;  4ZUX B;  2FFF B;  3AZG D;  3LZ0 C;  1F66 C;  1P3O B;  1U35 D;  5E5A B;  4Z5T D;  3REK A;  2F2A C;  3REI B;  3AZN A;  4NE3 A;  3WA9 C;  4J8U B;  3REH D;  2UWX A;  3O62 B;  4JJN D;  3WA9 D;  4NE6 A;  1P3K C;  5AVC A;  3X1T C;  4WU9 B;  5DNN D;  3X1T D;  1M19 D;  4DQY B;  1M1A C;  3W96 C;  4UUZ A;  5B40 C;  5CPJ D;  1M1A D;  3VH5 T;  2PYO D;  5CP6 B;  2Y2N A;  3NQU B;  3UTA B;  3B6F A;  5CPK A;  3LEL B;  2Y2H A;  1BH9 B;  1HQ3 B;  3C1C A;  5JA4 A;  1S32 B;  1A7W A;  4J8W B;  2Y2Q A;  4KHA B;  2DQN C;  5JRG B;  5CPI A;  1KX4 D;  5B31 B;  2Y2I A;  4H9Q B;  4Z66 B;  3NQJ A;  1JFI A;  4WU8 B;  2Y2L A;  3REL A;  3WKJ A;  3AZI D;  2YFW A;  3MGP B;  1P3B D;  3C1C C;  3WTP A;  4KUD B;  3AV1 D;  2IO5 C;  2F8N K;  4CAY B;  2Y2P A;  3B0D B;  2FJ7 B;  5B1L A;  3X1S B;  4J8X D;  3AV2 B;  1EQZ B;  5GT3 C;  5GT3 D;  4DRA A;  3REL C;  2YFV A;  5KDM B;  4R8P D;  3A1I A;  1P3F A;  3LZ0 B;  1U35 B;  2NQB A;  1P34 D;  2BYK A;  4ZUX A;  1W2E A;  4Z5T B;  2JSS A;  5B1L C;  5AV5 D;  3REH B;  3UT9 D;  5E5A A;  3WA9 B;  3REI A;  1P3L C;  1P3K B;  1KX3 C;  4J8U A;  3X1T B;  3O62 A;  4WNN B;  4AWL C;  1P3L D;  3AZK C;  1KX3 D;  3FDD A;  5CPJ B;  1R4V A;  3MGQ C;  3AZJ C;  3MGR C;  4WU9 A;  1M1A B;  1P3F C;  5B40 B;  2PYO B;  5B2J D;  3LJA D;  3MGQ D;  3AZJ D;  3MGR D;  4ZUX C;  3W97 D;  5B1M C;  5CP6 A;  3X1U C;  3AZL D;  3EPH A;  3NQU A;  3UTA A;  3X1U D;  4XZQ D;  3LEL A;  1P3A D;  1BH9 A;  5GT0 D;  1HQ3 A;  4WU9 C;  1TAF B;  1KX4 B;  5AY8 C;  1S32 A;  4J8W A;  1T3U A;  1TZY C;  5FUG B;  5AY8 D;  3LZ1 C;  4KHA A;  5JRG A;  3LZ1 D;  4KGC D;  5B31 A;  3AZI B;  4H9Q A;  4Z66 A;  3UTA C;  1HTA A;  4WU8 A;  2W8S A;  3AV1 B;  3KFU G;  3MGP A;  4KUD A;  1S32 C;  4CAY A;  2FJ7 A;  5JRG C;  3X1S A;  5GT3 B;  3W99 C;  3AV2 A;  1EQZ A;  3KXB D;  3W99 D;  5BNV A;  4Z66 C;  4R8P B;  3UTB D;  1P34 B;  5KDM A;  4H9S A;  1N1J B;  5AV5 B;  3LZ0 A;  1U35 A;  3UT9 B;  4Z5T A;  1M18 C;  3B6G D;  3REH A;  3X1S C;  1P3L B;  3WA9 A;  3KWQ D;  1KX3 B;  3EG5 B;  3A6N D;  1EQZ C;  4WZS B;  3AZK B;  3X1T A;  1PZR A;  4WNN A;  5B2J B;  3LJA B;  3MGQ B;  3H0R C;  3MGR B;  4J8V D;  3AZJ B;  4HGA B;  3AZG C;  5CPJ A;  1M1A A;  5GXQ C;  5B40 A;  2PYO A;  1U35 C;  5GXQ D;  2L5A A;  3W97 B;  4Z5T C;  5B1M B;  2ZY3 A;  3REH C;  3X1U B;  4JJN C; 
#chains in the Genus database with same CATH homology
 1P3A B;  5GT0 B;  4CSR B;  2HIO C;  5B2I C;  2G5H C;  5F99 D;  5DNN C;  1M19 C;  2HIO D;  5B2I D;  5AV9 C;  3B0B A;  5CPJ C;  3C1B D;  2J8P A;  1TAF A;  5AV9 D;  5AY8 B;  2PYO C;  1H3O B;  1TZY B;  3AN2 D;  1KX4 A;  3AZH D;  3LZ1 B;  2Y2G A;  4KGC B;  5FUG A;  3W98 D;  5C3I B;  2ARO D;  5AV6 C;  1Z2C B;  3AZI A;  5AV6 D;  2F8N G;  5B0Y C;  4LD9 D;  3AV1 A;  1B6W A;  5B0Y D;  3V9R B;  1KX4 C;  3KXB B;  3W99 B;  3UTB B;  3TU4 D;  5GT3 A;  1ID3 D;  3AZI C;  4R8P A;  1P3B C;  4H9P B;  3B0C W;  3AV1 C;  1P34 A;  3REK D;  1N1J A;  5B33 D;  3AZN D;  5AV5 A;  1P3G C;  2XD1 A;  3B6G B;  4J8X C;  3UT9 A;  2F8N D;  3KWQ B;  1M18 B;  3A6N B;  1P3G D;  4E44 A;  2F8N H;  1P3L A;  5BNV B;  4J8V B;  1KX3 A;  1P3I C;  2CV5 C;  4R8P C;  5B32 D;  3AZK A;  1ZLA D;  3AZG B;  1P3I D;  5B2J A;  3LJA A;  3MGQ A;  5GXQ B;  3MVD C;  3MGR A;  3AZJ A;  2CV5 D;  1B67 A;  3P5J B;  1P34 C;  3MVD D;  1F1E A;  5AV5 C;  3W97 A;  3UT9 C;  3AL0 C;  3X1V C;  4JJN B;  4QLC C;  5B1M A;  3X1V D;  3X1U A;  3EPK A;  4QLC D;  3AYW C;  2HUE B;  2HIO B;  4XZQ A;  5B2I B;  5DNN B;  1P3A A;  1M19 B;  5GT0 A;  3AYW D;  4CSR A;  4XUJ D;  3C1B B;  1KX5 C;  5AV9 B;  5B24 D;  5B2J C;  3LJA C;  1KX5 D;  3REJ D;  4HGA C;  5CPI D;  5AY8 A;  3W98 B;  1H3O A;  3W97 C;  1TZY A;  3LZ1 A;  2ARO B;  4KGC A;  5BO0 B;  3AZL C;  5AV6 B;  4XZQ C;  3AZF D;  1P3A C;  1AOI C;  5GT0 C;  5B0Y B;  1WWS A;  2NZD D;  1AOI D;  3KSY A;  3VH6 W;  5AVB D;  3V9R A;  4ZBJ C;  3TU4 B;  2LY8 A;  4KGC C;  3KXB A;  3AZM D;  3W99 A;  3UTB A;  5C3I C;  2NQB D;  1P3B B;  5B0Z C;  5B33 B;  1P3O D;  5B0Z D;  4H9P A;  2F8N B;  1P3G B;  2Y2M A;  4H9R B;  4J8X B;  4WV4 B;  3B6G A;  1BH8 B;  4J8U D;  3KWQ A;  1M18 A;  3KXB C;  3A6N A;  1P3P C;  5B32 B;  3UTB C;  1ZLA B;  1P3P D;  1P3I B;  2CV5 B;  3IP4 C;  4J8V A;  3WAA C;  3MVD B;  3AFA C;  3AZG A;  5GXQ A;  3AFA D;  3WAA D;  3MGS C;  4YM6 C;  3B6G C;  2ZM5 A;  3X1V B;  4QLC B;  3MGS D;  4YM6 D;  4EO5 C;  3KWQ C;  3A6N C;  4JJN A;  3AYW B;  3F6T A;  4XUJ B;  4NFT A;  5BS7 C;  5B24 B;  3AZE D;  4J8V C;  2HIO A;  1KX5 B;  5B2I A;  5DNN A;  1M19 A;  3KUY D;  3C1B A;  5AV9 A;  1WWI A;  2RVQ D;  3VH5 W;  5BNX B;  3MNN C;  3MNN D;  5DNM D;  5B31 D;  5AV8 D;  3W98 A;  4H9N B;  3AZL B;  3AZF B;  2ARO A;  5GSU D;  4WU8 D;  5BO0 A;  2ZY2 A;  2NZD B;  4XZQ B;  1AOI B;  5F99 C;  5AV6 A;  2HUE C;  1P3M C;  5AVB B;  5B0Y A;  3C1B C;  2Y2K A;  4E45 A;  1P3M D;  3AN2 C;  4ZBJ B;  4G91 B;  3AZH C;  4YS3 C;  3AZM B;  2Y2J A;  4YS3 D;  3W98 C;  3TU4 A;  4G92 C;  2ARO C;  5B0Z B;  4X23 C;  1F66 D;  3LZ0 D;  4LD9 C;  1P3B A;  3WTP E;  4X23 D;  3EPL A;  5B33 A;  2F8N A;  1P3G A;  4H9R A;  3EPJ A;  4J8X A;  5B32 G;  2Y2O A;  3TU4 C;  1BH8 A;  2ZY5 A;  1P3K D;  1P3P B;  1ID3 C;  5B32 A;  1ZLA A;  1P3I A;  2CV5 A;  3W96 D;  5B40 D;  3AFA B;  3WAA B;  3MVD A;  3REK C;  5B33 C;  3AZN C;  3MGS B;  4YM6 B;  5AVC C;  4EO5 B;  3X1V A;  4QLC A;  5AVC D;  3AZE B;  3KUY B;  3AYW A;  4XUJ A;  2JCH A;  5B32 C;  1ZLA C;  5B24 A;  3VH6 A;  1KX5 A;  3REJ A;  3MNN B;  5BNX A;  5DNM B;  5AV8 B;  3B6F C;  1BFM A;  5CPK C;  5GSU B;  3B6F D;  5CPK D;  4H9N A;  3AZL A;  3AZF A;  1ULY A;  5F99 B;  2NZD A;  4XUJ C;  1P3M B;  3C1C D;  1AOI A;  5B24 C;  2CWE A;  3R45 B;  3REJ C;  5CPI C;  5AVB A;  3AN2 B;  3AZH B;  4YS3 B;  1Q9C A;  4G92 B;  3AZM A;  3WKJ C;  3REL D;  3AZF C;  1F66 B;  3WTP C;  3WKJ D;  2BYM B;  2NZD C;  4X23 B;  4LD9 B;  3WTP D;  3B0C T;  5B0Z A;  1P3O A;  4M6B A;  5AVB C;  5B1L D;  4NE5 A;  2DF4 C;  4G91 C;  4H9O B;  3H0M C;  5G49 B;  3AZM C;  1ID3 B;  4DRB A;  1P3P A;  3AZK D;  3W96 B;  2NQB C;  2JE5 A;  3VH5 A;  1P3F D;  1P3O C;  4ZUX D;  3REK B;  3AFA A;  3WAA A;  3AZN B;  5E5A C;  3REI C;  5B1M D;  5E5A D;  5AVC B;  4J8U C;  3MGS A;  4YM6 A;  3O62 C;  3REI D;  3O62 D;  2XD5 A;  3A1K A;  3AZE A;  4UUZ B;  5BS7 A;  4WU9 D;  3KUY A;  5B31 G;  1TZY D;  5CP6 C;  3MNN A;  3B6F B;  5DNM A;  5AV8 A;  5CPK B;  5CP6 D;  5GSU A;  3LEL C;  3UTA D;  1HQ3 C;  2RIQ A;  5JA4 B;  3LEL D;  3C1C B;  3H0L C;  2IO5 B;  3AZE C;  1HQ3 D;  1KU5 A;  2BG1 A;  5F99 A;  3KUY C;  4Z2M G;  1P3M A;  5CHL B;  4J8W C;  2RVQ C;  3REJ B;  5CPI B;  1S32 D;  3VH6 T;  2G5I C;  3R45 A;  4J8W D;  3NQJ B;  3AN2 A;  5DNM C;  5B31 C;  5JRG D;  5AV8 C;  3AZH A;  4YS3 A;  1JFI B;  3REL B;  3WKJ B;  5GSU C;  4Z66 D;  2YFW B;  4WU8 C;  3WTP B;  5BT1 C;  3MGP C;  1F66 A;  5BT1 D;  4KUD C;  2BYM A;  3MGP D;  5B1L B;  4X23 A;  4LD9 A;  3B0D C;  4UPK A;  2FJ7 C;  4KUD D;  2VQR A;  2FJ7 D;  3AV2 C;  1M18 D;  3X1S D;  4AWL B;  3AV2 D;  1EQZ D;  1P3K A;  2YFV B;  4Z2M H;  4H9O A;  5G49 A;  1P3F B;  2ZY4 A;  1ID3 A;  2NQB B;  4WJ3 C;  4H9S C;  2BYK B;  3W96 A;  4ZUX B;  2FFF B;  3AZG D;  3LZ0 C;  1F66 C;  1P3O B;  1U35 D;  5E5A B;  4Z5T D;  3REK A;  2F2A C;  3REI B;  3AZN A;  4NE3 A;  3WA9 C;  4J8U B;  3REH D;  2UWX A;  3O62 B;  4JJN D;  3WA9 D;  4NE6 A;  1P3K C;  5AVC A;  3X1T C;  4WU9 B;  5DNN D;  3X1T D;  1M19 D;  4DQY B;  1M1A C;  3W96 C;  4UUZ A;  5B40 C;  5CPJ D;  1M1A D;  3VH5 T;  2PYO D;  5CP6 B;  2Y2N A;  3NQU B;  3UTA B;  3B6F A;  5CPK A;  3LEL B;  2Y2H A;  1BH9 B;  1HQ3 B;  3C1C A;  5JA4 A;  1S32 B;  1A7W A;  4J8W B;  2Y2Q A;  4KHA B;  2DQN C;  5JRG B;  5CPI A;  1KX4 D;  5B31 B;  2Y2I A;  4H9Q B;  4Z66 B;  3NQJ A;  1JFI A;  4WU8 B;  2Y2L A;  3REL A;  3WKJ A;  3AZI D;  2YFW A;  3MGP B;  1P3B D;  3C1C C;  3WTP A;  4KUD B;  3AV1 D;  2IO5 C;  2F8N K;  4CAY B;  2Y2P A;  3B0D B;  2FJ7 B;  5B1L A;  3X1S B;  4J8X D;  3AV2 B;  1EQZ B;  5GT3 C;  5GT3 D;  4DRA A;  3REL C;  2YFV A;  5KDM B;  4R8P D;  3A1I A;  1P3F A;  3LZ0 B;  1U35 B;  2NQB A;  1P34 D;  2BYK A;  4ZUX A;  1W2E A;  4Z5T B;  2JSS A;  5B1L C;  5AV5 D;  3REH B;  3UT9 D;  5E5A A;  3WA9 B;  3REI A;  1P3L C;  1P3K B;  1KX3 C;  4J8U A;  3X1T B;  3O62 A;  4WNN B;  4AWL C;  1P3L D;  3AZK C;  1KX3 D;  3FDD A;  5CPJ B;  1R4V A;  3MGQ C;  3AZJ C;  3MGR C;  4WU9 A;  1M1A B;  1P3F C;  5B40 B;  2PYO B;  5B2J D;  3LJA D;  3MGQ D;  3AZJ D;  3MGR D;  4ZUX C;  3W97 D;  5B1M C;  5CP6 A;  3X1U C;  3AZL D;  3EPH A;  3NQU A;  3UTA A;  3X1U D;  4XZQ D;  3LEL A;  1P3A D;  1BH9 A;  5GT0 D;  1HQ3 A;  4WU9 C;  1TAF B;  1KX4 B;  5AY8 C;  1S32 A;  4J8W A;  1T3U A;  1TZY C;  5FUG B;  5AY8 D;  3LZ1 C;  4KHA A;  5JRG A;  3LZ1 D;  4KGC D;  5B31 A;  3AZI B;  4H9Q A;  4Z66 A;  3UTA C;  1HTA A;  4WU8 A;  2W8S A;  3AV1 B;  3KFU G;  3MGP A;  4KUD A;  1S32 C;  4CAY A;  2FJ7 A;  5JRG C;  3X1S A;  5GT3 B;  3W99 C;  3AV2 A;  1EQZ A;  3KXB D;  3W99 D;  5BNV A;  4Z66 C;  4R8P B;  3UTB D;  1P34 B;  5KDM A;  4H9S A;  1N1J B;  5AV5 B;  3LZ0 A;  1U35 A;  3UT9 B;  4Z5T A;  1M18 C;  3B6G D;  3REH A;  3X1S C;  1P3L B;  3WA9 A;  3KWQ D;  1KX3 B;  3EG5 B;  3A6N D;  1EQZ C;  4WZS B;  3AZK B;  3X1T A;  1PZR A;  4WNN A;  5B2J B;  3LJA B;  3MGQ B;  3H0R C;  3MGR B;  4J8V D;  3AZJ B;  4HGA B;  3AZG C;  5CPJ A;  1M1A A;  5GXQ C;  5B40 A;  2PYO A;  1U35 C;  5GXQ D;  2L5A A;  3W97 B;  4Z5T C;  5B1M B;  2ZY3 A;  3REH C;  3X1U B;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...