3B6FB

Nucleosome core particle treated with cisplatin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fB00
5AVBD 4H9SA 1KX3D 4H9NA 4E44A 5C3IB 5B40C 2FJ7B 1HQ3B 1P3IA 1P3LB 1P3FC 3AV2B 3AZFC 3MGPD 2NQBC 1KU5A 5GSUC 3C1CD 3B0DC 5AV9C 4J8WC 1KX5A 5B33D 1P3GC 5B2IC 5AVBB 1N1JA 3X1SC 3REHD 3AZIC 3WKJC 2IO5B 5CP6C 1ZLAA 3MNNA 3A6NC 3LELA 5DNNA 4Z66D 5GT3B 5GT0B 4H9OA 4M6BA 3AN2B 3REIB 5DNMB 3NQUA 3W96B 1S32D 2F8NG 1KX4A 2PYOA 3WTPA 3C1BC 3AZLA 4KGCC 5JRGA 3B6FA 3MGQC 3MNND 4AWLB 3NQJB 4Z5TA 5BNVA 5DNND 3LELD 1TAFA 4QLCA 5B0YC 4JJNA 4XUJA 3MVDC 4WU9B 1P3PD 5B1MA 3W97D 2AROC 4J8VA 3WAAD 1M19B 1AOIC 5B2JA 1KX4D 3MGSC 5B32C 3LJAB 2PYOD 1TZYB 5BO0A 5JRGD 1M1AB 3B6FD 3W97B 3AYWA 3X1TC 3VH6T 5F99B 1KX3C 3WAAB 1BH8B 4WU8D 4XUJD 4YM6D 3UT9B 1P3FD 5AV5D 3LZ1B 3AZFD 3MGPC 4J8VD 3RELD 5B32G 3C1CC 4WNNA 3AZMB 1P3KA 4H9PB 4J8WD 3AV1B 1BH9B 5B2JD 4DRAA 2HUEB 5AY8A 5B33C 3W99A 5B0ZB 3KUYA 3X1UC 3VH6W 3REHC 3AZID 5B40B 4YM6B 2F8ND 2YFVA 3AYWD 1P3FB 4H9SC 4NE3A 5CP6D 3AZFB 3RELB 2NQBB 1P3MD 4J8XA 5GSUB 3B0DB 5AV9B 4Z66C 4J8WB 1P3GB 5B2IB 3X1SB 4ZUXA 3B6GD 3AZIB 3X1VA 5AY8D 2F8NB 3REKA 1S32C 3KUYD 2L5AA 5CP6B 5GXQA 4LD9D 3C1BD 4UUZA 5AV8A 3MNNC 1EQZA 4J8XD 3LELC 5DNNC 4XZQA 5CPKA 1M18A 4EO5C 2NZDD 1P3PC 1P34A 4Z2MG 3X1VD 2AROD 4KHAA 3C1BB 4H9QA 1AOID 1KX4C 2PYOC 4G92C 3AZLC 1ID3D 5AV8D 5JRGC 1P3BD 5B0YB 3MGRA 3B6FC 1EQZD 2NZDB 3MVDB 5BNXB 4XZQD 2BYKB 2AROB 3VH6A 4WU8C 5CPKD 2RVQD 3LZ0A 4XUJC 4YM6C 4JJNC 1M18D 1AOIB 4CAYA 1P34D 5B1MC 5AV5C 3MGSB 3AZEA 5B32B 1JFIB 3RELC 4J8VC 3KXBA 1F66A 1ID3B 5B2JC 3AFAA 5CPIA 5AV6A 5G49B 4NE5A 3X1TB 2YFWB 3X1UD 1KX3B 3AN2A 3REIA 3TU4A 3MGRD 5JA4B 4E45A 3AYWC 1U35A 3MGPB 3WA9A 1P3MC 2HIOA 3LZ0D 3C1CB 1P3ID 3AZED 5B33B 5E5AA 3KXBD 1P3KC 1F66D 3W98A 3X1UB 3REHB 3B6GC 3AFAD 5AY8C 5CPID 3W99C 5AV6D 1KX5D 3R45B 5B24A 3KUYC 4H9NB 3UTBA 3TU4D 4LD9C 1P3IB 5B1LA 4Z66B 5B31A 3O62A 1M19A 1ZLAD 5FUGA 3WA9D 4X23A 4J8XC 2HIOD 3AZGA 5CPJA 3AZKA 1KX5B 4KUDA 1S32B 2NZDC 1N1JB 1ULYA 3W98D 3X1VC 3REKC 1BH8A 5B24D 3MNNB 3UT9A 1F1EA 3LELB 3WTPD 5DNNB 5B1LD 3AZLD 2CV5A 1ID3C 5KDMA 5B31D 5AV8C 3O62D 1P3BC 1EQZC 1BH9A 4R8PA 4EO5B 4X23D 4Z5TD 1P3PB 4XZQC 3AZGD 3NQUB 5CPJD 3AZKD 4QLCD 5CPKC 2RVQC 4JJND 1M18C 4KUDD 5B40A 1P34C 5B1MD 1KX4B 2PYOB 4G92B 3AZLB 4H9RB 5JRGB 3B6FB 4Z5TB 5BNVB 1P3GA 1H3OA 4HGAB 5BS7A 3V9RA 4QLCB 4WU8B 3MGRC 4JJNB 4XUJB 5B1MB 1P3AA 5AV5B 3WKJA 5AVCA 4J8VB 3KSYA 3LZ0C 2JSSA 3A6NA 1P3IC 5B2JB 3AZEC 5BO0B 3KXBC 1F66C 1P3KD 4YS3A 3AZJA 3AFAC 3REJA 5CPIC 1KX5C 5AV6C 3W99D 1HTAA 3AZHA 3AYWB 4WV4B 3TU4C 1P3MB 4J8UA 1U35C 4KGCA 1A7WA 5AVCD 1ZLAC 3WA9C 3B0CT 2HIOC 4WNNB 3MGQA 1P3KB 3UTAA 3B6GB 4CSRA 2BYMA 4NE6A 5AY8B 3W99B 3AZNA 1P3OA 3VH5T 3KUYB 3W98C 3KWQA 4ZUXD 4YS3D 3AZJD 4LD9B 3REJD 3REKD 5B24C 2YFVB 3AZHD 2FJ7A 1HQ3A 5GXQD 1P3LA 3UTBC 4J8XB 4J8UD 3WTPC 3B0CW 5B1LC 3AV2A 5B31C 3O62C 4X23C 3VH5W 4Z5TC 3AZGC 3UTAD 5CPJC 5G49A 4HGAC 3X1VB 5AVBA 3AZKC 4QLCC 4NFTA 3REKB 3AZND 4KUDC 5GXQB 3KWQD 4UUZB 5AV8B 2FJ7D 1P3BB 4ZBJC 1EQZB 5B31G 5GT3A 5GT0A 3AV2D 4XZQB 1R4VA 2CV5C 5CPKB 5DNMA 1M18B 1P34B 3W96A 3R45A 4KHAB 4H9QB 4Z66A 2CWEA 3NQJA 3MGRB 5GT3D 5GT0D 1S32A 5BS7C 3AN2D 3REID 4WU9A 5DNMD 3LZ0B 5CHLB 4CAYB 1BFMA 3W96D 1U35D 1P3AC 3AZEB 5AVCC 5BT1D 3KXBB 1F66B 4WZSB 3LJAA 1TZYA 3AFAB 5CPIB 5AV6B 1WWIA 5E5AD 1M1AA 3VH5A 1P3PA 4ZUXC 4YS3C 3W97A 3TU4B 3REJC 3AZJC 5F99A 3WAAA 3AZHC 1U35B 5GXQC 1ZLAB 3UTBD 4WU9D 3WA9B 1Q9CA 2F8NH 2HIOB 4J8UC 3LZ1A 4H9OB 3AZMA 1M19D 4H9RA 4H9PA 5E5AB 3AV1A 3W98B 3LJAD 3UTAC 1TZYD 5B0ZA 4G91C 3AZNC 1P3OC 4WU8A 5B24B 1M1AD 4YM6A 3KWQC 3UTBB 1P3FA 5AV5A 3WTPB 5B1LB 5F99D 3AZFA 3RELA 2NQBA 5C3IC 5B31B 5GSUA 5AV9A 1HQ3C 3O62B 2FJ7C 1P3LC 4J8WA 5FUGB 3UT9D 4X23B 3AV2C 3LZ1D 3AZGB 2CV5D 5CPJB 5B2IA 3AZKB 1TAFB 3AZMD 3X1SA 4KUDB 3AV1D 4R8PD 3AZIA 2F8NA 5B0ZD 5AVBC 5CP6A 1P3MA 5B40D 4ZBJB 2IO5C 2CV5B 2NQBD 5KDMB 5GSUD 5AV9D 3B6GA 4R8PB 5GT3C 5GT0C 1P3GD 2LY8A 5B2ID 3AN2C 3REIC 5DNMC 3X1SD 4LD9A 3W96C 3C1BA 1P3AD 3WKJD 5BT1C 3A6ND 2F8NK 1B67A 5E5AC 5B0YA 1H3OB 4AWLC 3V9RB 4DRBA 3MVDA 2NZDA 5BNXA 2BYKA 2AROA 1WWSA 1P3AB 3WKJB 5AVCB 1AOIA 4WU9C 3A6NB 3MGSA 1JFIA 5B32A 1B6WA 1ID3A 1M19C 4KGCD 1P3BA 3MGQD 3LJAC 1TZYC 4ZUXB 3AZJB 3X1TA 3REJB 4YS3B 2YFWA 1KX3A 1P3OD 3AZHB 1M1AC 5B0YD 3B0BA 5JA4A 3MVDD 3W97C 4J8UB 5F99C 4Z2MH 3WAAC 3MGPA 3WTPE 3C1CA 1HQ3D 4KGCB 1P3LD 3UT9C 3MGQB 3MGSD 5B33A 5B32D 3LZ1C 3UTAB 4CSRB 2BYMB 4G91B 3AZMC 3X1UA 3AZNB 1P3OB 3REHA 3AV1C 4R8PC 2HUEC 3KWQB 5B0ZC 3X1TD
chains in the Genus database with same CATH superfamily
5AVBD 4H9SA 1KX3D 4H9NA 4E44A 5C3IB 5B40C 2FJ7B 1HQ3B 1P3IA 1P3LB 1P3FC 3AV2B 3AZFC 3MGPD 2NQBC 1KU5A 5GSUC 3P5JB 3B0DC 5AV9C 3C1CD 2XD5A 3IP4C 4J8WC 1KX5A 5B33D 1P3GC 2BG1A 5B2IC 5AVBB 1N1JA 3X1SC 3REHD 3AZIC 3WKJC 2IO5B 5CP6C 1ZLAA 3MNNA 3A6NC 3LELA 5DNNA 4Z66D 5GT3B 5GT0B 4H9OA 4M6BA 3AN2B 3REIB 5DNMB 3NQUA 3W96B 2Y2OA 1S32D 2F8NG 1KX4A 2PYOA 3WTPA 3C1BC 3AZLA 4KGCC 5JRGA 3B6FA 3MGQC 3MNND 4AWLB 3NQJB 4Z5TA 5BNVA 5DNND 3LELD 2Y2HA 1TAFA 2ZY3A 4QLCA 5B0YC 4JJNA 4XUJA 3MVDC 4WU9B 1P3PD 5B1MA 3W97D 2AROC 4J8VA 3WAAD 1M19B 2Y2NA 2Y2GA 1AOIC 5B2JA 1KX4D 3MGSC 5B32C 3LJAB 2PYOD 1TZYB 5BO0A 2Y2JA 5JRGD 1M1AB 3B6FD 3W97B 3AYWA 3X1TC 2Y2QA 3VH6T 5F99B 1KX3C 3WAAB 2J8PA 1BH8B 4WU8D 4XUJD 4YM6D 3UT9B 2UWXA 1P3FD 5AV5D 3H0RC 3LZ1B 3AZFD 3MGPC 4J8VD 3RELD 5B32G 3C1CC 4WNNA 3AZMB 1P3KA 4H9PB 3EPKA 4J8WD 3AV1B 1Z2CB 1BH9B 5B2JD 4DRAA 2HUEB 5AY8A 5B33C 3W99A 5B0ZB 3KUYA 3X1UC 3VH6W 3REHC 3AZID 5B40B 4YM6B 2F8ND 2YFVA 3AYWD 1P3FB 4H9SC 4NE3A 5CP6D 3AZFB 3RELB 2NQBB 1P3MD 4J8XA 5GSUB 3B0DB 5AV9B 2Y2PA 4Z66C 4J8WB 2VQRA 3A1KA 1P3GB 5B2IB 3X1SB 4ZUXA 3B6GD 3AZIB 3X1VA 5AY8D 2F8NB 3REKA 1S32C 3KUYD 2L5AA 5CP6B 5GXQA 3EG5B 4LD9D 3C1BD 4UUZA 5AV8A 3MNNC 1EQZA 4J8XD 3LELC 5DNNC 4XZQA 5CPKA 1M18A 4EO5C 2NZDD 1P3PC 1P34A 4Z2MG 2FFFB 3X1VD 2AROD 3AL0C 4KHAA 3C1BB 4H9QA 1AOID 1KX4C 2PYOC 4G92C 3AZLC 1ID3D 3H0MC 5AV8D 5JRGC 1P3BD 5B0YB 3MGRA 3B6FC 1EQZD 2NZDB 3MVDB 5BNXB 4XZQD 2BYKB 2AROB 3VH6A 4WU8C 5CPKD 2RVQD 3LZ0A 4XUJC 4YM6C 4JJNC 1M18D 1AOIB 4CAYA 1P34D 5B1MC 5AV5C 3MGSB 3AZEA 5B32B 1JFIB 3RELC 4J8VC 3KXBA 1F66A 1ID3B 5B2JC 3AFAA 5CPIA 5AV6A 5G49B 4NE5A 3X1TB 2RIQA 2YFWB 3X1UD 1KX3B 3AN2A 3REIA 3TU4A 3MGRD 5JA4B 4E45A 3AYWC 1U35A 3MGPB 3WA9A 1P3MC 2HIOA 3LZ0D 3C1CB 1P3ID 3AZED 5B33B 5E5AA 3KXBD 1P3KC 1F66D 3W98A 3X1UB 3REHB 3B6GC 3AFAD 5AY8C 5CPID 3W99C 5AV6D 1KX5D 3R45B 5B24A 3KUYC 4H9NB 3UTBA 3TU4D 4LD9C 1P3IB 5B1LA 4Z66B 5B31A 3O62A 1M19A 1ZLAD 5FUGA 2ZY5A 3WA9D 4X23A 4J8XC 2HIOD 3AZGA 5CPJA 3AZKA 1KX5B 4KUDA 1S32B 2NZDC 1N1JB 1ULYA 3W98D 3X1VC 3REKC 1BH8A 5B24D 3MNNB 3UT9A 1F1EA 3LELB 3WTPD 5DNNB 5B1LD 3AZLD 2CV5A 1ID3C 5KDMA 5B31D 5AV8C 3O62D 1P3BC 1EQZC 1BH9A 4R8PA 4EO5B 4X23D 4Z5TD 1P3PB 2ZY2A 4XZQC 3AZGD 3NQUB 5CPJD 4WJ3C 3AZKD 4QLCD 5CPKC 2RVQC 4JJND 1M18C 4KUDD 5B40A 1P34C 5B1MD 1KX4B 3H0LC 2PYOB 4G92B 3AZLB 4H9RB 5JRGB 3B6FB 4Z5TB 5BNVB 1P3GA 1H3OA 4HGAB 5BS7A 3V9RA 4QLCB 4WU8B 3MGRC 4JJNB 4XUJB 5B1MB 1P3AA 5AV5B 3WKJA 5AVCA 4J8VB 3KSYA 3LZ0C 2JSSA 3A6NA 1P3IC 3EPHA 5B2JB 3AZEC 5BO0B 3KXBC 1F66C 1P3KD 4YS3A 3AZJA 3AFAC 3REJA 5CPIC 1KX5C 5AV6C 3W99D 1HTAA 3AZHA 3AYWB 4WV4B 3TU4C 1P3MB 4J8UA 1U35C 4KGCA 1A7WA 5AVCD 1ZLAC 3WA9C 3B0CT 2HIOC 4WNNB 3MGQA 1P3KB 3UTAA 3B6GB 4CSRA 2BYMA 4NE6A 5AY8B 3W99B 3AZNA 1P3OA 3VH5T 3KUYB 3W98C 3KWQA 4ZUXD 4YS3D 3AZJD 2XD1A 3REJD 4LD9B 2DF4C 3REKD 5B24C 2YFVB 3AZHD 2FJ7A 1HQ3A 5GXQD 1P3LA 3UTBC 4J8XB 4J8UD 3WTPC 3B0CW 5B1LC 3AV2A 5B31C 3O62C 4X23C 3VH5W 4Z5TC 3AZGC 3UTAD 2W8SA 5G49A 4HGAC 3X1VB 5CPJC 5AVBA 3AZKC 4QLCC 4NFTA 3REKB 3AZND 4KUDC 5GXQB 3KWQD 4UUZB 5AV8B 2FJ7D 1P3BB 4ZBJC 1EQZB 5B31G 5GT3A 5GT0A 3AV2D 4XZQB 1R4VA 2CV5C 5CPKB 5DNMA 1M18B 1P34B 3W96A 3R45A 4KHAB 4H9QB 4Z66A 2CWEA 3NQJA 2Y2MA 3MGRB 5GT3D 5GT0D 1S32A 5BS7C 3AN2D 3EPJA 3REID 5DNMD 4WU9A 3LZ0B 5CHLB 4CAYB 1BFMA 3W96D 1U35D 1P3AC 3AZEB 5AVCC 5BT1D 3KXBB 1F66B 4WZSB 3LJAA 1PZRA 1TZYA 3AFAB 5CPIB 5AV6B 3FDDA 1WWIA 5E5AD 1M1AA 4UPKA 3VH5A 1P3PA 4ZUXC 4YS3C 3W97A 3TU4B 3REJC 3AZJC 5F99A 3WAAA 3AZHC 1U35B 5GXQC 1ZLAB 3UTBD 4WU9D 3WA9B 1Q9CA 2F8NH 2HIOB 4J8UC 2F2AC 3LZ1A 4H9OB 3AZMA 1M19D 4H9RA 4H9PA 5E5AB 3AV1A 3W98B 3LJAD 3UTAC 1TZYD 5B0ZA 2Y2IA 4G91C 3AZNC 1P3OC 3A1IA 4WU8A 5B24B 1M1AD 4YM6A 3KWQC 2G5HC 3UTBB 1P3FA 5AV5A 3WTPB 5B1LB 5F99D 3AZFA 3RELA 2NQBA 2DQNC 5C3IC 5B31B 5GSUA 5AV9A 1HQ3C 3O62B 2FJ7C 1P3LC 4J8WA 5FUGB 3UT9D 4X23B 3AV2C 3LZ1D 3AZGB 2CV5D 5CPJB 5B2IA 3AZKB 1TAFB 3AZMD 3X1SA 2ZM5A 4KUDB 3AV1D 4R8PD 3AZIA 2F8NA 5B0ZD 5AVBC 5CP6A 1P3MA 5B40D 2Y2KA 4ZBJB 2IO5C 2Y2LA 2CV5B 2NQBD 5KDMB 5GSUD 5AV9D 3B6GA 4R8PB 5GT3C 5GT0C 3EPLA 1P3GD 2LY8A 5B2ID 3AN2C 3REIC 5DNMC 3X1SD 4LD9A 3W96C 3C1BA 1P3AD 3F6TA 3WKJD 5BT1C 3KFUG 3A6ND 1W2EA 2F8NK 1B67A 4DQYB 5E5AC 5B0YA 1H3OB 4AWLC 2JCHA 3V9RB 4DRBA 3MVDA 2NZDA 5BNXA 2BYKA 2AROA 1WWSA 1P3AB 3WKJB 5AVCB 1AOIA 2G5IC 4WU9C 3A6NB 3MGSA 1JFIA 5B32A 1B6WA 1ID3A 1M19C 4KGCD 1P3BA 3MGQD 3LJAC 1TZYC 4ZUXB 3AZJB 3X1TA 3REJB 4YS3B 2YFWA 1KX3A 1P3OD 3AZHB 1M1AC 5B0YD 3B0BA 5JA4A 3MVDD 3W97C 4J8UB 5F99C 4Z2MH 2JE5A 3WAAC 3MGPA 3WTPE 3C1CA 1HQ3D 4KGCB 1P3LD 3UT9C 1T3UA 2ZY4A 3MGSD 3MGQB 5B33A 5B32D 3LZ1C 3UTAB 4CSRB 2BYMB 4G91B 3AZMC 3X1UA 3AZNB 1P3OB 3REHA 3AV1C 4R8PC 2HUEC 3KWQB 5B0ZC 3X1TD
chains in the Genus database with same CATH topology
5AVBD 4H9SA 1KX3D 4H9NA 4E44A 5C3IB 5B40C 2FJ7B 1HQ3B 1P3IA 1P3LB 1P3FC 3AV2B 3AZFC 3MGPD 2NQBC 1KU5A 5GSUC 3P5JB 3B0DC 5AV9C 3C1CD 2XD5A 3IP4C 4J8WC 1KX5A 5B33D 1P3GC 2BG1A 5B2IC 5AVBB 1N1JA 3X1SC 3REHD 3AZIC 3WKJC 2IO5B 5CP6C 1ZLAA 3MNNA 3A6NC 3LELA 5DNNA 4Z66D 5GT3B 5GT0B 4H9OA 4M6BA 3AN2B 3REIB 5DNMB 3NQUA 3W96B 2Y2OA 1S32D 2F8NG 1KX4A 2PYOA 3WTPA 3C1BC 3AZLA 4KGCC 5JRGA 3B6FA 3MGQC 3MNND 4AWLB 3NQJB 4Z5TA 5BNVA 5DNND 3LELD 2Y2HA 1TAFA 2ZY3A 4QLCA 5B0YC 4JJNA 4XUJA 3MVDC 4WU9B 1P3PD 5B1MA 3W97D 2AROC 4J8VA 3WAAD 1M19B 2Y2NA 2Y2GA 1AOIC 5B2JA 1KX4D 3MGSC 5B32C 3LJAB 2PYOD 1TZYB 5BO0A 2Y2JA 5JRGD 1M1AB 3B6FD 3W97B 3AYWA 3X1TC 2Y2QA 3VH6T 5F99B 1KX3C 3WAAB 2J8PA 1BH8B 4WU8D 4XUJD 4YM6D 3UT9B 2UWXA 1P3FD 5AV5D 3H0RC 3LZ1B 3AZFD 3MGPC 4J8VD 3RELD 5B32G 3C1CC 4WNNA 3AZMB 1P3KA 4H9PB 3EPKA 4J8WD 3AV1B 1Z2CB 1BH9B 5B2JD 4DRAA 2HUEB 5AY8A 5B33C 3W99A 5B0ZB 3KUYA 3X1UC 3VH6W 3REHC 3AZID 5B40B 4YM6B 2F8ND 2YFVA 3AYWD 1P3FB 4H9SC 4NE3A 5CP6D 3AZFB 3RELB 2NQBB 1P3MD 4J8XA 5GSUB 3B0DB 5AV9B 2Y2PA 4Z66C 4J8WB 2VQRA 3A1KA 1P3GB 5B2IB 3X1SB 4ZUXA 3B6GD 3AZIB 3X1VA 5AY8D 2F8NB 3REKA 1S32C 3KUYD 2L5AA 5CP6B 5GXQA 3EG5B 4LD9D 3C1BD 4UUZA 5AV8A 3MNNC 1EQZA 4J8XD 3LELC 5DNNC 4XZQA 5CPKA 1M18A 4EO5C 2NZDD 1P3PC 1P34A 4Z2MG 2FFFB 3X1VD 2AROD 3AL0C 4KHAA 3C1BB 4H9QA 1AOID 1KX4C 2PYOC 4G92C 3AZLC 1ID3D 3H0MC 5AV8D 5JRGC 1P3BD 5B0YB 3MGRA 3B6FC 1EQZD 2NZDB 3MVDB 5BNXB 4XZQD 2BYKB 2AROB 3VH6A 4WU8C 5CPKD 2RVQD 3LZ0A 4XUJC 4YM6C 4JJNC 1M18D 1AOIB 4CAYA 1P34D 5B1MC 5AV5C 3MGSB 3AZEA 5B32B 1JFIB 3RELC 4J8VC 3KXBA 1F66A 1ID3B 5B2JC 3AFAA 5CPIA 5AV6A 5G49B 4NE5A 3X1TB 2RIQA 2YFWB 3X1UD 1KX3B 3AN2A 3REIA 3TU4A 3MGRD 5JA4B 4E45A 3AYWC 1U35A 3MGPB 3WA9A 1P3MC 2HIOA 3LZ0D 3C1CB 1P3ID 3AZED 5B33B 5E5AA 3KXBD 1P3KC 1F66D 3W98A 3X1UB 3REHB 3B6GC 3AFAD 5AY8C 5CPID 3W99C 5AV6D 1KX5D 3R45B 5B24A 3KUYC 4H9NB 3UTBA 3TU4D 4LD9C 1P3IB 5B1LA 4Z66B 5B31A 3O62A 1M19A 1ZLAD 5FUGA 2ZY5A 3WA9D 4X23A 4J8XC 2HIOD 3AZGA 5CPJA 3AZKA 1KX5B 4KUDA 1S32B 2NZDC 1N1JB 1ULYA 3W98D 3X1VC 3REKC 1BH8A 5B24D 3MNNB 3UT9A 1F1EA 3LELB 3WTPD 5DNNB 5B1LD 3AZLD 2CV5A 1ID3C 5KDMA 5B31D 5AV8C 3O62D 1P3BC 1EQZC 1BH9A 4R8PA 4EO5B 4X23D 4Z5TD 1P3PB 2ZY2A 4XZQC 3AZGD 3NQUB 5CPJD 4WJ3C 3AZKD 4QLCD 5CPKC 2RVQC 4JJND 1M18C 4KUDD 5B40A 1P34C 5B1MD 1KX4B 3H0LC 2PYOB 4G92B 3AZLB 4H9RB 5JRGB 3B6FB 4Z5TB 5BNVB 1P3GA 1H3OA 4HGAB 5BS7A 3V9RA 4QLCB 4WU8B 3MGRC 4JJNB 4XUJB 5B1MB 1P3AA 5AV5B 3WKJA 5AVCA 4J8VB 3KSYA 3LZ0C 2JSSA 3A6NA 1P3IC 3EPHA 5B2JB 3AZEC 5BO0B 3KXBC 1F66C 1P3KD 4YS3A 3AZJA 3AFAC 3REJA 5CPIC 1KX5C 5AV6C 3W99D 1HTAA 3AZHA 3AYWB 4WV4B 3TU4C 1P3MB 4J8UA 1U35C 4KGCA 1A7WA 5AVCD 1ZLAC 3WA9C 3B0CT 2HIOC 4WNNB 3MGQA 1P3KB 3UTAA 3B6GB 4CSRA 2BYMA 4NE6A 5AY8B 3W99B 3AZNA 1P3OA 3VH5T 3KUYB 3W98C 3KWQA 4ZUXD 4YS3D 3AZJD 2XD1A 3REJD 4LD9B 2DF4C 3REKD 5B24C 2YFVB 3AZHD 2FJ7A 1HQ3A 5GXQD 1P3LA 3UTBC 4J8XB 4J8UD 3WTPC 3B0CW 5B1LC 3AV2A 5B31C 3O62C 4X23C 3VH5W 4Z5TC 3AZGC 3UTAD 2W8SA 5G49A 4HGAC 3X1VB 5CPJC 5AVBA 3AZKC 4QLCC 4NFTA 3REKB 3AZND 4KUDC 5GXQB 3KWQD 4UUZB 5AV8B 2FJ7D 1P3BB 4ZBJC 1EQZB 5B31G 5GT3A 5GT0A 3AV2D 4XZQB 1R4VA 2CV5C 5CPKB 5DNMA 1M18B 1P34B 3W96A 3R45A 4KHAB 4H9QB 4Z66A 2CWEA 3NQJA 2Y2MA 3MGRB 5GT3D 5GT0D 1S32A 5BS7C 3AN2D 3EPJA 3REID 5DNMD 4WU9A 3LZ0B 5CHLB 4CAYB 1BFMA 3W96D 1U35D 1P3AC 3AZEB 5AVCC 5BT1D 3KXBB 1F66B 4WZSB 3LJAA 1PZRA 1TZYA 3AFAB 5CPIB 5AV6B 3FDDA 1WWIA 5E5AD 1M1AA 4UPKA 3VH5A 1P3PA 4ZUXC 4YS3C 3W97A 3TU4B 3REJC 3AZJC 5F99A 3WAAA 3AZHC 1U35B 5GXQC 1ZLAB 3UTBD 4WU9D 3WA9B 1Q9CA 2F8NH 2HIOB 4J8UC 2F2AC 3LZ1A 4H9OB 3AZMA 1M19D 4H9RA 4H9PA 5E5AB 3AV1A 3W98B 3LJAD 3UTAC 1TZYD 5B0ZA 2Y2IA 4G91C 3AZNC 1P3OC 3A1IA 4WU8A 5B24B 1M1AD 4YM6A 3KWQC 2G5HC 3UTBB 1P3FA 5AV5A 3WTPB 5B1LB 5F99D 3AZFA 3RELA 2NQBA 2DQNC 5C3IC 5B31B 5GSUA 5AV9A 1HQ3C 3O62B 2FJ7C 1P3LC 4J8WA 5FUGB 3UT9D 4X23B 3AV2C 3LZ1D 3AZGB 2CV5D 5CPJB 5B2IA 3AZKB 1TAFB 3AZMD 3X1SA 2ZM5A 4KUDB 3AV1D 4R8PD 3AZIA 2F8NA 5B0ZD 5AVBC 5CP6A 1P3MA 5B40D 2Y2KA 4ZBJB 2IO5C 2Y2LA 2CV5B 2NQBD 5KDMB 5GSUD 5AV9D 3B6GA 4R8PB 5GT3C 5GT0C 3EPLA 1P3GD 2LY8A 5B2ID 3AN2C 3REIC 5DNMC 3X1SD 4LD9A 3W96C 3C1BA 1P3AD 3F6TA 3WKJD 5BT1C 3KFUG 3A6ND 1W2EA 2F8NK 1B67A 4DQYB 5E5AC 5B0YA 1H3OB 4AWLC 2JCHA 3V9RB 4DRBA 3MVDA 2NZDA 5BNXA 2BYKA 2AROA 1WWSA 1P3AB 3WKJB 5AVCB 1AOIA 2G5IC 4WU9C 3A6NB 3MGSA 1JFIA 5B32A 1B6WA 1ID3A 1M19C 4KGCD 1P3BA 3MGQD 3LJAC 1TZYC 4ZUXB 3AZJB 3X1TA 3REJB 4YS3B 2YFWA 1KX3A 1P3OD 3AZHB 1M1AC 5B0YD 3B0BA 5JA4A 3MVDD 3W97C 4J8UB 5F99C 4Z2MH 2JE5A 3WAAC 3MGPA 3WTPE 3C1CA 1HQ3D 4KGCB 1P3LD 3UT9C 1T3UA 2ZY4A 3MGSD 3MGQB 5B33A 5B32D 3LZ1C 3UTAB 4CSRB 2BYMB 4G91B 3AZMC 3X1UA 3AZNB 1P3OB 3REHA 3AV1C 4R8PC 2HUEC 3KWQB 5B0ZC 3X1TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB D;  4H9S A;  1KX3 D;  4H9N A;  4E44 A;  5C3I B;  5B40 C;  2FJ7 B;  1HQ3 B;  1P3I A;  1P3L B;  1P3F C;  3AV2 B;  3AZF C;  3MGP D;  2NQB C;  1KU5 A;  5GSU C;  3C1C D;  3B0D C;  5AV9 C;  4J8W C;  1KX5 A;  5B33 D;  1P3G C;  5B2I C;  5AVB B;  1N1J A;  3X1S C;  3REH D;  3AZI C;  3WKJ C;  2IO5 B;  5CP6 C;  1ZLA A;  3MNN A;  3A6N C;  3LEL A;  5DNN A;  4Z66 D;  5GT3 B;  5GT0 B;  4H9O A;  4M6B A;  3AN2 B;  3REI B;  5DNM B;  3NQU A;  3W96 B;  1S32 D;  2F8N G;  1KX4 A;  2PYO A;  3WTP A;  3C1B C;  3AZL A;  4KGC C;  5JRG A;  3B6F A;  3MGQ C;  3MNN D;  4AWL B;  3NQJ B;  4Z5T A;  5BNV A;  5DNN D;  3LEL D;  1TAF A;  4QLC A;  5B0Y C;  4JJN A;  4XUJ A;  3MVD C;  4WU9 B;  1P3P D;  5B1M A;  3W97 D;  2ARO C;  4J8V A;  3WAA D;  1M19 B;  1AOI C;  5B2J A;  1KX4 D;  3MGS C;  5B32 C;  3LJA B;  2PYO D;  1TZY B;  5BO0 A;  5JRG D;  1M1A B;  3B6F D;  3W97 B;  3AYW A;  3X1T C;  3VH6 T;  5F99 B;  1KX3 C;  3WAA B;  1BH8 B;  4WU8 D;  4XUJ D;  4YM6 D;  3UT9 B;  1P3F D;  5AV5 D;  3LZ1 B;  3AZF D;  3MGP C;  4J8V D;  3REL D;  5B32 G;  3C1C C;  4WNN A;  3AZM B;  1P3K A;  4H9P B;  4J8W D;  3AV1 B;  1BH9 B;  5B2J D;  4DRA A;  2HUE B;  5AY8 A;  5B33 C;  3W99 A;  5B0Z B;  3KUY A;  3X1U C;  3VH6 W;  3REH C;  3AZI D;  5B40 B;  4YM6 B;  2F8N D;  2YFV A;  3AYW D;  1P3F B;  4H9S C;  4NE3 A;  5CP6 D;  3AZF B;  3REL B;  2NQB B;  1P3M D;  4J8X A;  5GSU B;  3B0D B;  5AV9 B;  4Z66 C;  4J8W B;  1P3G B;  5B2I B;  3X1S B;  4ZUX A;  3B6G D;  3AZI B;  3X1V A;  5AY8 D;  2F8N B;  3REK A;  1S32 C;  3KUY D;  2L5A A;  5CP6 B;  5GXQ A;  4LD9 D;  3C1B D;  4UUZ A;  5AV8 A;  3MNN C;  1EQZ A;  4J8X D;  3LEL C;  5DNN C;  4XZQ A;  5CPK A;  1M18 A;  4EO5 C;  2NZD D;  1P3P C;  1P34 A;  4Z2M G;  3X1V D;  2ARO D;  4KHA A;  3C1B B;  4H9Q A;  1AOI D;  1KX4 C;  2PYO C;  4G92 C;  3AZL C;  1ID3 D;  5AV8 D;  5JRG C;  1P3B D;  5B0Y B;  3MGR A;  3B6F C;  1EQZ D;  2NZD B;  3MVD B;  5BNX B;  4XZQ D;  2BYK B;  2ARO B;  3VH6 A;  4WU8 C;  5CPK D;  2RVQ D;  3LZ0 A;  4XUJ C;  4YM6 C;  4JJN C;  1M18 D;  1AOI B;  4CAY A;  1P34 D;  5B1M C;  5AV5 C;  3MGS B;  3AZE A;  5B32 B;  1JFI B;  3REL C;  4J8V C;  3KXB A;  1F66 A;  1ID3 B;  5B2J C;  3AFA A;  5CPI A;  5AV6 A;  5G49 B;  4NE5 A;  3X1T B;  2YFW B;  3X1U D;  1KX3 B;  3AN2 A;  3REI A;  3TU4 A;  3MGR D;  5JA4 B;  4E45 A;  3AYW C;  1U35 A;  3MGP B;  3WA9 A;  1P3M C;  2HIO A;  3LZ0 D;  3C1C B;  1P3I D;  3AZE D;  5B33 B;  5E5A A;  3KXB D;  1P3K C;  1F66 D;  3W98 A;  3X1U B;  3REH B;  3B6G C;  3AFA D;  5AY8 C;  5CPI D;  3W99 C;  5AV6 D;  1KX5 D;  3R45 B;  5B24 A;  3KUY C;  4H9N B;  3UTB A;  3TU4 D;  4LD9 C;  1P3I B;  5B1L A;  4Z66 B;  5B31 A;  3O62 A;  1M19 A;  1ZLA D;  5FUG A;  3WA9 D;  4X23 A;  4J8X C;  2HIO D;  3AZG A;  5CPJ A;  3AZK A;  1KX5 B;  4KUD A;  1S32 B;  2NZD C;  1N1J B;  1ULY A;  3W98 D;  3X1V C;  3REK C;  1BH8 A;  5B24 D;  3MNN B;  3UT9 A;  1F1E A;  3LEL B;  3WTP D;  5DNN B;  5B1L D;  3AZL D;  2CV5 A;  1ID3 C;  5KDM A;  5B31 D;  5AV8 C;  3O62 D;  1P3B C;  1EQZ C;  1BH9 A;  4R8P A;  4EO5 B;  4X23 D;  4Z5T D;  1P3P B;  4XZQ C;  3AZG D;  3NQU B;  5CPJ D;  3AZK D;  4QLC D;  5CPK C;  2RVQ C;  4JJN D;  1M18 C;  4KUD D;  5B40 A;  1P34 C;  5B1M D;  1KX4 B;  2PYO B;  4G92 B;  3AZL B;  4H9R B;  5JRG B;  3B6F B;  4Z5T B;  5BNV B;  1P3G A;  1H3O A;  4HGA B;  5BS7 A;  3V9R A;  4QLC B;  4WU8 B;  3MGR C;  4JJN B;  4XUJ B;  5B1M B;  1P3A A;  5AV5 B;  3WKJ A;  5AVC A;  4J8V B;  3KSY A;  3LZ0 C;  2JSS A;  3A6N A;  1P3I C;  5B2J B;  3AZE C;  5BO0 B;  3KXB C;  1F66 C;  1P3K D;  4YS3 A;  3AZJ A;  3AFA C;  3REJ A;  5CPI C;  1KX5 C;  5AV6 C;  3W99 D;  1HTA A;  3AZH A;  3AYW B;  4WV4 B;  3TU4 C;  1P3M B;  4J8U A;  1U35 C;  4KGC A;  1A7W A;  5AVC D;  1ZLA C;  3WA9 C;  3B0C T;  2HIO C;  4WNN B;  3MGQ A;  1P3K B;  3UTA A;  3B6G B;  4CSR A;  2BYM A;  4NE6 A;  5AY8 B;  3W99 B;  3AZN A;  1P3O A;  3VH5 T;  3KUY B;  3W98 C;  3KWQ A;  4ZUX D;  4YS3 D;  3AZJ D;  4LD9 B;  3REJ D;  3REK D;  5B24 C;  2YFV B;  3AZH D;  2FJ7 A;  1HQ3 A;  5GXQ D;  1P3L A;  3UTB C;  4J8X B;  4J8U D;  3WTP C;  3B0C W;  5B1L C;  3AV2 A;  5B31 C;  3O62 C;  4X23 C;  3VH5 W;  4Z5T C;  3AZG C;  3UTA D;  5CPJ C;  5G49 A;  4HGA C;  3X1V B;  5AVB A;  3AZK C;  4QLC C;  4NFT A;  3REK B;  3AZN D;  4KUD C;  5GXQ B;  3KWQ D;  4UUZ B;  5AV8 B;  2FJ7 D;  1P3B B;  4ZBJ C;  1EQZ B;  5B31 G;  5GT3 A;  5GT0 A;  3AV2 D;  4XZQ B;  1R4V A;  2CV5 C;  5CPK B;  5DNM A;  1M18 B;  1P34 B;  3W96 A;  3R45 A;  4KHA B;  4H9Q B;  4Z66 A;  2CWE A;  3NQJ A;  3MGR B;  5GT3 D;  5GT0 D;  1S32 A;  5BS7 C;  3AN2 D;  3REI D;  4WU9 A;  5DNM D;  3LZ0 B;  5CHL B;  4CAY B;  1BFM A;  3W96 D;  1U35 D;  1P3A C;  3AZE B;  5AVC C;  5BT1 D;  3KXB B;  1F66 B;  4WZS B;  3LJA A;  1TZY A;  3AFA B;  5CPI B;  5AV6 B;  1WWI A;  5E5A D;  1M1A A;  3VH5 A;  1P3P A;  4ZUX C;  4YS3 C;  3W97 A;  3TU4 B;  3REJ C;  3AZJ C;  5F99 A;  3WAA A;  3AZH C;  1U35 B;  5GXQ C;  1ZLA B;  3UTB D;  4WU9 D;  3WA9 B;  1Q9C A;  2F8N H;  2HIO B;  4J8U C;  3LZ1 A;  4H9O B;  3AZM A;  1M19 D;  4H9R A;  4H9P A;  5E5A B;  3AV1 A;  3W98 B;  3LJA D;  3UTA C;  1TZY D;  5B0Z A;  4G91 C;  3AZN C;  1P3O C;  4WU8 A;  5B24 B;  1M1A D;  4YM6 A;  3KWQ C;  3UTB B;  1P3F A;  5AV5 A;  3WTP B;  5B1L B;  5F99 D;  3AZF A;  3REL A;  2NQB A;  5C3I C;  5B31 B;  5GSU A;  5AV9 A;  1HQ3 C;  3O62 B;  2FJ7 C;  1P3L C;  4J8W A;  5FUG B;  3UT9 D;  4X23 B;  3AV2 C;  3LZ1 D;  3AZG B;  2CV5 D;  5CPJ B;  5B2I A;  3AZK B;  1TAF B;  3AZM D;  3X1S A;  4KUD B;  3AV1 D;  4R8P D;  3AZI A;  2F8N A;  5B0Z D;  5AVB C;  5CP6 A;  1P3M A;  5B40 D;  4ZBJ B;  2IO5 C;  2CV5 B;  2NQB D;  5KDM B;  5GSU D;  5AV9 D;  3B6G A;  4R8P B;  5GT3 C;  5GT0 C;  1P3G D;  2LY8 A;  5B2I D;  3AN2 C;  3REI C;  5DNM C;  3X1S D;  4LD9 A;  3W96 C;  3C1B A;  1P3A D;  3WKJ D;  5BT1 C;  3A6N D;  2F8N K;  1B67 A;  5E5A C;  5B0Y A;  1H3O B;  4AWL C;  3V9R B;  4DRB A;  3MVD A;  2NZD A;  5BNX A;  2BYK A;  2ARO A;  1WWS A;  1P3A B;  3WKJ B;  5AVC B;  1AOI A;  4WU9 C;  3A6N B;  3MGS A;  1JFI A;  5B32 A;  1B6W A;  1ID3 A;  1M19 C;  4KGC D;  1P3B A;  3MGQ D;  3LJA C;  1TZY C;  4ZUX B;  3AZJ B;  3X1T A;  3REJ B;  4YS3 B;  2YFW A;  1KX3 A;  1P3O D;  3AZH B;  1M1A C;  5B0Y D;  3B0B A;  5JA4 A;  3MVD D;  3W97 C;  4J8U B;  5F99 C;  4Z2M H;  3WAA C;  3MGP A;  3WTP E;  3C1C A;  1HQ3 D;  4KGC B;  1P3L D;  3UT9 C;  3MGQ B;  3MGS D;  5B33 A;  5B32 D;  3LZ1 C;  3UTA B;  4CSR B;  2BYM B;  4G91 B;  3AZM C;  3X1U A;  3AZN B;  1P3O B;  3REH A;  3AV1 C;  4R8P C;  2HUE C;  3KWQ B;  5B0Z C;  3X1T D; 
#chains in the Genus database with same CATH topology
 5AVB D;  4H9S A;  1KX3 D;  4H9N A;  4E44 A;  5C3I B;  5B40 C;  2FJ7 B;  1HQ3 B;  1P3I A;  1P3L B;  1P3F C;  3AV2 B;  3AZF C;  3MGP D;  2NQB C;  1KU5 A;  5GSU C;  3P5J B;  3B0D C;  5AV9 C;  3C1C D;  2XD5 A;  3IP4 C;  4J8W C;  1KX5 A;  5B33 D;  1P3G C;  2BG1 A;  5B2I C;  5AVB B;  1N1J A;  3X1S C;  3REH D;  3AZI C;  3WKJ C;  2IO5 B;  5CP6 C;  1ZLA A;  3MNN A;  3A6N C;  3LEL A;  5DNN A;  4Z66 D;  5GT3 B;  5GT0 B;  4H9O A;  4M6B A;  3AN2 B;  3REI B;  5DNM B;  3NQU A;  3W96 B;  2Y2O A;  1S32 D;  2F8N G;  1KX4 A;  2PYO A;  3WTP A;  3C1B C;  3AZL A;  4KGC C;  5JRG A;  3B6F A;  3MGQ C;  3MNN D;  4AWL B;  3NQJ B;  4Z5T A;  5BNV A;  5DNN D;  3LEL D;  2Y2H A;  1TAF A;  2ZY3 A;  4QLC A;  5B0Y C;  4JJN A;  4XUJ A;  3MVD C;  4WU9 B;  1P3P D;  5B1M A;  3W97 D;  2ARO C;  4J8V A;  3WAA D;  1M19 B;  2Y2N A;  2Y2G A;  1AOI C;  5B2J A;  1KX4 D;  3MGS C;  5B32 C;  3LJA B;  2PYO D;  1TZY B;  5BO0 A;  2Y2J A;  5JRG D;  1M1A B;  3B6F D;  3W97 B;  3AYW A;  3X1T C;  2Y2Q A;  3VH6 T;  5F99 B;  1KX3 C;  3WAA B;  2J8P A;  1BH8 B;  4WU8 D;  4XUJ D;  4YM6 D;  3UT9 B;  2UWX A;  1P3F D;  5AV5 D;  3H0R C;  3LZ1 B;  3AZF D;  3MGP C;  4J8V D;  3REL D;  5B32 G;  3C1C C;  4WNN A;  3AZM B;  1P3K A;  4H9P B;  3EPK A;  4J8W D;  3AV1 B;  1Z2C B;  1BH9 B;  5B2J D;  4DRA A;  2HUE B;  5AY8 A;  5B33 C;  3W99 A;  5B0Z B;  3KUY A;  3X1U C;  3VH6 W;  3REH C;  3AZI D;  5B40 B;  4YM6 B;  2F8N D;  2YFV A;  3AYW D;  1P3F B;  4H9S C;  4NE3 A;  5CP6 D;  3AZF B;  3REL B;  2NQB B;  1P3M D;  4J8X A;  5GSU B;  3B0D B;  5AV9 B;  2Y2P A;  4Z66 C;  4J8W B;  2VQR A;  3A1K A;  1P3G B;  5B2I B;  3X1S B;  4ZUX A;  3B6G D;  3AZI B;  3X1V A;  5AY8 D;  2F8N B;  3REK A;  1S32 C;  3KUY D;  2L5A A;  5CP6 B;  5GXQ A;  3EG5 B;  4LD9 D;  3C1B D;  4UUZ A;  5AV8 A;  3MNN C;  1EQZ A;  4J8X D;  3LEL C;  5DNN C;  4XZQ A;  5CPK A;  1M18 A;  4EO5 C;  2NZD D;  1P3P C;  1P34 A;  4Z2M G;  2FFF B;  3X1V D;  2ARO D;  3AL0 C;  4KHA A;  3C1B B;  4H9Q A;  1AOI D;  1KX4 C;  2PYO C;  4G92 C;  3AZL C;  1ID3 D;  3H0M C;  5AV8 D;  5JRG C;  1P3B D;  5B0Y B;  3MGR A;  3B6F C;  1EQZ D;  2NZD B;  3MVD B;  5BNX B;  4XZQ D;  2BYK B;  2ARO B;  3VH6 A;  4WU8 C;  5CPK D;  2RVQ D;  3LZ0 A;  4XUJ C;  4YM6 C;  4JJN C;  1M18 D;  1AOI B;  4CAY A;  1P34 D;  5B1M C;  5AV5 C;  3MGS B;  3AZE A;  5B32 B;  1JFI B;  3REL C;  4J8V C;  3KXB A;  1F66 A;  1ID3 B;  5B2J C;  3AFA A;  5CPI A;  5AV6 A;  5G49 B;  4NE5 A;  3X1T B;  2RIQ A;  2YFW B;  3X1U D;  1KX3 B;  3AN2 A;  3REI A;  3TU4 A;  3MGR D;  5JA4 B;  4E45 A;  3AYW C;  1U35 A;  3MGP B;  3WA9 A;  1P3M C;  2HIO A;  3LZ0 D;  3C1C B;  1P3I D;  3AZE D;  5B33 B;  5E5A A;  3KXB D;  1P3K C;  1F66 D;  3W98 A;  3X1U B;  3REH B;  3B6G C;  3AFA D;  5AY8 C;  5CPI D;  3W99 C;  5AV6 D;  1KX5 D;  3R45 B;  5B24 A;  3KUY C;  4H9N B;  3UTB A;  3TU4 D;  4LD9 C;  1P3I B;  5B1L A;  4Z66 B;  5B31 A;  3O62 A;  1M19 A;  1ZLA D;  5FUG A;  2ZY5 A;  3WA9 D;  4X23 A;  4J8X C;  2HIO D;  3AZG A;  5CPJ A;  3AZK A;  1KX5 B;  4KUD A;  1S32 B;  2NZD C;  1N1J B;  1ULY A;  3W98 D;  3X1V C;  3REK C;  1BH8 A;  5B24 D;  3MNN B;  3UT9 A;  1F1E A;  3LEL B;  3WTP D;  5DNN B;  5B1L D;  3AZL D;  2CV5 A;  1ID3 C;  5KDM A;  5B31 D;  5AV8 C;  3O62 D;  1P3B C;  1EQZ C;  1BH9 A;  4R8P A;  4EO5 B;  4X23 D;  4Z5T D;  1P3P B;  2ZY2 A;  4XZQ C;  3AZG D;  3NQU B;  5CPJ D;  4WJ3 C;  3AZK D;  4QLC D;  5CPK C;  2RVQ C;  4JJN D;  1M18 C;  4KUD D;  5B40 A;  1P34 C;  5B1M D;  1KX4 B;  3H0L C;  2PYO B;  4G92 B;  3AZL B;  4H9R B;  5JRG B;  3B6F B;  4Z5T B;  5BNV B;  1P3G A;  1H3O A;  4HGA B;  5BS7 A;  3V9R A;  4QLC B;  4WU8 B;  3MGR C;  4JJN B;  4XUJ B;  5B1M B;  1P3A A;  5AV5 B;  3WKJ A;  5AVC A;  4J8V B;  3KSY A;  3LZ0 C;  2JSS A;  3A6N A;  1P3I C;  3EPH A;  5B2J B;  3AZE C;  5BO0 B;  3KXB C;  1F66 C;  1P3K D;  4YS3 A;  3AZJ A;  3AFA C;  3REJ A;  5CPI C;  1KX5 C;  5AV6 C;  3W99 D;  1HTA A;  3AZH A;  3AYW B;  4WV4 B;  3TU4 C;  1P3M B;  4J8U A;  1U35 C;  4KGC A;  1A7W A;  5AVC D;  1ZLA C;  3WA9 C;  3B0C T;  2HIO C;  4WNN B;  3MGQ A;  1P3K B;  3UTA A;  3B6G B;  4CSR A;  2BYM A;  4NE6 A;  5AY8 B;  3W99 B;  3AZN A;  1P3O A;  3VH5 T;  3KUY B;  3W98 C;  3KWQ A;  4ZUX D;  4YS3 D;  3AZJ D;  2XD1 A;  3REJ D;  4LD9 B;  2DF4 C;  3REK D;  5B24 C;  2YFV B;  3AZH D;  2FJ7 A;  1HQ3 A;  5GXQ D;  1P3L A;  3UTB C;  4J8X B;  4J8U D;  3WTP C;  3B0C W;  5B1L C;  3AV2 A;  5B31 C;  3O62 C;  4X23 C;  3VH5 W;  4Z5T C;  3AZG C;  3UTA D;  2W8S A;  5G49 A;  4HGA C;  3X1V B;  5CPJ C;  5AVB A;  3AZK C;  4QLC C;  4NFT A;  3REK B;  3AZN D;  4KUD C;  5GXQ B;  3KWQ D;  4UUZ B;  5AV8 B;  2FJ7 D;  1P3B B;  4ZBJ C;  1EQZ B;  5B31 G;  5GT3 A;  5GT0 A;  3AV2 D;  4XZQ B;  1R4V A;  2CV5 C;  5CPK B;  5DNM A;  1M18 B;  1P34 B;  3W96 A;  3R45 A;  4KHA B;  4H9Q B;  4Z66 A;  2CWE A;  3NQJ A;  2Y2M A;  3MGR B;  5GT3 D;  5GT0 D;  1S32 A;  5BS7 C;  3AN2 D;  3EPJ A;  3REI D;  5DNM D;  4WU9 A;  3LZ0 B;  5CHL B;  4CAY B;  1BFM A;  3W96 D;  1U35 D;  1P3A C;  3AZE B;  5AVC C;  5BT1 D;  3KXB B;  1F66 B;  4WZS B;  3LJA A;  1PZR A;  1TZY A;  3AFA B;  5CPI B;  5AV6 B;  3FDD A;  1WWI A;  5E5A D;  1M1A A;  4UPK A;  3VH5 A;  1P3P A;  4ZUX C;  4YS3 C;  3W97 A;  3TU4 B;  3REJ C;  3AZJ C;  5F99 A;  3WAA A;  3AZH C;  1U35 B;  5GXQ C;  1ZLA B;  3UTB D;  4WU9 D;  3WA9 B;  1Q9C A;  2F8N H;  2HIO B;  4J8U C;  2F2A C;  3LZ1 A;  4H9O B;  3AZM A;  1M19 D;  4H9R A;  4H9P A;  5E5A B;  3AV1 A;  3W98 B;  3LJA D;  3UTA C;  1TZY D;  5B0Z A;  2Y2I A;  4G91 C;  3AZN C;  1P3O C;  3A1I A;  4WU8 A;  5B24 B;  1M1A D;  4YM6 A;  3KWQ C;  2G5H C;  3UTB B;  1P3F A;  5AV5 A;  3WTP B;  5B1L B;  5F99 D;  3AZF A;  3REL A;  2NQB A;  2DQN C;  5C3I C;  5B31 B;  5GSU A;  5AV9 A;  1HQ3 C;  3O62 B;  2FJ7 C;  1P3L C;  4J8W A;  5FUG B;  3UT9 D;  4X23 B;  3AV2 C;  3LZ1 D;  3AZG B;  2CV5 D;  5CPJ B;  5B2I A;  3AZK B;  1TAF B;  3AZM D;  3X1S A;  2ZM5 A;  4KUD B;  3AV1 D;  4R8P D;  3AZI A;  2F8N A;  5B0Z D;  5AVB C;  5CP6 A;  1P3M A;  5B40 D;  2Y2K A;  4ZBJ B;  2IO5 C;  2Y2L A;  2CV5 B;  2NQB D;  5KDM B;  5GSU D;  5AV9 D;  3B6G A;  4R8P B;  5GT3 C;  5GT0 C;  3EPL A;  1P3G D;  2LY8 A;  5B2I D;  3AN2 C;  3REI C;  5DNM C;  3X1S D;  4LD9 A;  3W96 C;  3C1B A;  1P3A D;  3F6T A;  3WKJ D;  5BT1 C;  3KFU G;  3A6N D;  1W2E A;  2F8N K;  1B67 A;  4DQY B;  5E5A C;  5B0Y A;  1H3O B;  4AWL C;  2JCH A;  3V9R B;  4DRB A;  3MVD A;  2NZD A;  5BNX A;  2BYK A;  2ARO A;  1WWS A;  1P3A B;  3WKJ B;  5AVC B;  1AOI A;  2G5I C;  4WU9 C;  3A6N B;  3MGS A;  1JFI A;  5B32 A;  1B6W A;  1ID3 A;  1M19 C;  4KGC D;  1P3B A;  3MGQ D;  3LJA C;  1TZY C;  4ZUX B;  3AZJ B;  3X1T A;  3REJ B;  4YS3 B;  2YFW A;  1KX3 A;  1P3O D;  3AZH B;  1M1A C;  5B0Y D;  3B0B A;  5JA4 A;  3MVD D;  3W97 C;  4J8U B;  5F99 C;  4Z2M H;  2JE5 A;  3WAA C;  3MGP A;  3WTP E;  3C1C A;  1HQ3 D;  4KGC B;  1P3L D;  3UT9 C;  1T3U A;  2ZY4 A;  3MGS D;  3MGQ B;  5B33 A;  5B32 D;  3LZ1 C;  3UTA B;  4CSR B;  2BYM B;  4G91 B;  3AZM C;  3X1U A;  3AZN B;  1P3O B;  3REH A;  3AV1 C;  4R8P C;  2HUE C;  3KWQ B;  5B0Z C;  3X1T D; 
#chains in the Genus database with same CATH homology
 5AVB D;  4H9S A;  1KX3 D;  4H9N A;  4E44 A;  5C3I B;  5B40 C;  2FJ7 B;  1HQ3 B;  1P3I A;  1P3L B;  1P3F C;  3AV2 B;  3AZF C;  3MGP D;  2NQB C;  1KU5 A;  5GSU C;  3P5J B;  3B0D C;  5AV9 C;  3C1C D;  2XD5 A;  3IP4 C;  4J8W C;  1KX5 A;  5B33 D;  1P3G C;  2BG1 A;  5B2I C;  5AVB B;  1N1J A;  3X1S C;  3REH D;  3AZI C;  3WKJ C;  2IO5 B;  5CP6 C;  1ZLA A;  3MNN A;  3A6N C;  3LEL A;  5DNN A;  4Z66 D;  5GT3 B;  5GT0 B;  4H9O A;  4M6B A;  3AN2 B;  3REI B;  5DNM B;  3NQU A;  3W96 B;  2Y2O A;  1S32 D;  2F8N G;  1KX4 A;  2PYO A;  3WTP A;  3C1B C;  3AZL A;  4KGC C;  5JRG A;  3B6F A;  3MGQ C;  3MNN D;  4AWL B;  3NQJ B;  4Z5T A;  5BNV A;  5DNN D;  3LEL D;  2Y2H A;  1TAF A;  2ZY3 A;  4QLC A;  5B0Y C;  4JJN A;  4XUJ A;  3MVD C;  4WU9 B;  1P3P D;  5B1M A;  3W97 D;  2ARO C;  4J8V A;  3WAA D;  1M19 B;  2Y2N A;  2Y2G A;  1AOI C;  5B2J A;  1KX4 D;  3MGS C;  5B32 C;  3LJA B;  2PYO D;  1TZY B;  5BO0 A;  2Y2J A;  5JRG D;  1M1A B;  3B6F D;  3W97 B;  3AYW A;  3X1T C;  2Y2Q A;  3VH6 T;  5F99 B;  1KX3 C;  3WAA B;  2J8P A;  1BH8 B;  4WU8 D;  4XUJ D;  4YM6 D;  3UT9 B;  2UWX A;  1P3F D;  5AV5 D;  3H0R C;  3LZ1 B;  3AZF D;  3MGP C;  4J8V D;  3REL D;  5B32 G;  3C1C C;  4WNN A;  3AZM B;  1P3K A;  4H9P B;  3EPK A;  4J8W D;  3AV1 B;  1Z2C B;  1BH9 B;  5B2J D;  4DRA A;  2HUE B;  5AY8 A;  5B33 C;  3W99 A;  5B0Z B;  3KUY A;  3X1U C;  3VH6 W;  3REH C;  3AZI D;  5B40 B;  4YM6 B;  2F8N D;  2YFV A;  3AYW D;  1P3F B;  4H9S C;  4NE3 A;  5CP6 D;  3AZF B;  3REL B;  2NQB B;  1P3M D;  4J8X A;  5GSU B;  3B0D B;  5AV9 B;  2Y2P A;  4Z66 C;  4J8W B;  2VQR A;  3A1K A;  1P3G B;  5B2I B;  3X1S B;  4ZUX A;  3B6G D;  3AZI B;  3X1V A;  5AY8 D;  2F8N B;  3REK A;  1S32 C;  3KUY D;  2L5A A;  5CP6 B;  5GXQ A;  3EG5 B;  4LD9 D;  3C1B D;  4UUZ A;  5AV8 A;  3MNN C;  1EQZ A;  4J8X D;  3LEL C;  5DNN C;  4XZQ A;  5CPK A;  1M18 A;  4EO5 C;  2NZD D;  1P3P C;  1P34 A;  4Z2M G;  2FFF B;  3X1V D;  2ARO D;  3AL0 C;  4KHA A;  3C1B B;  4H9Q A;  1AOI D;  1KX4 C;  2PYO C;  4G92 C;  3AZL C;  1ID3 D;  3H0M C;  5AV8 D;  5JRG C;  1P3B D;  5B0Y B;  3MGR A;  3B6F C;  1EQZ D;  2NZD B;  3MVD B;  5BNX B;  4XZQ D;  2BYK B;  2ARO B;  3VH6 A;  4WU8 C;  5CPK D;  2RVQ D;  3LZ0 A;  4XUJ C;  4YM6 C;  4JJN C;  1M18 D;  1AOI B;  4CAY A;  1P34 D;  5B1M C;  5AV5 C;  3MGS B;  3AZE A;  5B32 B;  1JFI B;  3REL C;  4J8V C;  3KXB A;  1F66 A;  1ID3 B;  5B2J C;  3AFA A;  5CPI A;  5AV6 A;  5G49 B;  4NE5 A;  3X1T B;  2RIQ A;  2YFW B;  3X1U D;  1KX3 B;  3AN2 A;  3REI A;  3TU4 A;  3MGR D;  5JA4 B;  4E45 A;  3AYW C;  1U35 A;  3MGP B;  3WA9 A;  1P3M C;  2HIO A;  3LZ0 D;  3C1C B;  1P3I D;  3AZE D;  5B33 B;  5E5A A;  3KXB D;  1P3K C;  1F66 D;  3W98 A;  3X1U B;  3REH B;  3B6G C;  3AFA D;  5AY8 C;  5CPI D;  3W99 C;  5AV6 D;  1KX5 D;  3R45 B;  5B24 A;  3KUY C;  4H9N B;  3UTB A;  3TU4 D;  4LD9 C;  1P3I B;  5B1L A;  4Z66 B;  5B31 A;  3O62 A;  1M19 A;  1ZLA D;  5FUG A;  2ZY5 A;  3WA9 D;  4X23 A;  4J8X C;  2HIO D;  3AZG A;  5CPJ A;  3AZK A;  1KX5 B;  4KUD A;  1S32 B;  2NZD C;  1N1J B;  1ULY A;  3W98 D;  3X1V C;  3REK C;  1BH8 A;  5B24 D;  3MNN B;  3UT9 A;  1F1E A;  3LEL B;  3WTP D;  5DNN B;  5B1L D;  3AZL D;  2CV5 A;  1ID3 C;  5KDM A;  5B31 D;  5AV8 C;  3O62 D;  1P3B C;  1EQZ C;  1BH9 A;  4R8P A;  4EO5 B;  4X23 D;  4Z5T D;  1P3P B;  2ZY2 A;  4XZQ C;  3AZG D;  3NQU B;  5CPJ D;  4WJ3 C;  3AZK D;  4QLC D;  5CPK C;  2RVQ C;  4JJN D;  1M18 C;  4KUD D;  5B40 A;  1P34 C;  5B1M D;  1KX4 B;  3H0L C;  2PYO B;  4G92 B;  3AZL B;  4H9R B;  5JRG B;  3B6F B;  4Z5T B;  5BNV B;  1P3G A;  1H3O A;  4HGA B;  5BS7 A;  3V9R A;  4QLC B;  4WU8 B;  3MGR C;  4JJN B;  4XUJ B;  5B1M B;  1P3A A;  5AV5 B;  3WKJ A;  5AVC A;  4J8V B;  3KSY A;  3LZ0 C;  2JSS A;  3A6N A;  1P3I C;  3EPH A;  5B2J B;  3AZE C;  5BO0 B;  3KXB C;  1F66 C;  1P3K D;  4YS3 A;  3AZJ A;  3AFA C;  3REJ A;  5CPI C;  1KX5 C;  5AV6 C;  3W99 D;  1HTA A;  3AZH A;  3AYW B;  4WV4 B;  3TU4 C;  1P3M B;  4J8U A;  1U35 C;  4KGC A;  1A7W A;  5AVC D;  1ZLA C;  3WA9 C;  3B0C T;  2HIO C;  4WNN B;  3MGQ A;  1P3K B;  3UTA A;  3B6G B;  4CSR A;  2BYM A;  4NE6 A;  5AY8 B;  3W99 B;  3AZN A;  1P3O A;  3VH5 T;  3KUY B;  3W98 C;  3KWQ A;  4ZUX D;  4YS3 D;  3AZJ D;  2XD1 A;  3REJ D;  4LD9 B;  2DF4 C;  3REK D;  5B24 C;  2YFV B;  3AZH D;  2FJ7 A;  1HQ3 A;  5GXQ D;  1P3L A;  3UTB C;  4J8X B;  4J8U D;  3WTP C;  3B0C W;  5B1L C;  3AV2 A;  5B31 C;  3O62 C;  4X23 C;  3VH5 W;  4Z5T C;  3AZG C;  3UTA D;  2W8S A;  5G49 A;  4HGA C;  3X1V B;  5CPJ C;  5AVB A;  3AZK C;  4QLC C;  4NFT A;  3REK B;  3AZN D;  4KUD C;  5GXQ B;  3KWQ D;  4UUZ B;  5AV8 B;  2FJ7 D;  1P3B B;  4ZBJ C;  1EQZ B;  5B31 G;  5GT3 A;  5GT0 A;  3AV2 D;  4XZQ B;  1R4V A;  2CV5 C;  5CPK B;  5DNM A;  1M18 B;  1P34 B;  3W96 A;  3R45 A;  4KHA B;  4H9Q B;  4Z66 A;  2CWE A;  3NQJ A;  2Y2M A;  3MGR B;  5GT3 D;  5GT0 D;  1S32 A;  5BS7 C;  3AN2 D;  3EPJ A;  3REI D;  5DNM D;  4WU9 A;  3LZ0 B;  5CHL B;  4CAY B;  1BFM A;  3W96 D;  1U35 D;  1P3A C;  3AZE B;  5AVC C;  5BT1 D;  3KXB B;  1F66 B;  4WZS B;  3LJA A;  1PZR A;  1TZY A;  3AFA B;  5CPI B;  5AV6 B;  3FDD A;  1WWI A;  5E5A D;  1M1A A;  4UPK A;  3VH5 A;  1P3P A;  4ZUX C;  4YS3 C;  3W97 A;  3TU4 B;  3REJ C;  3AZJ C;  5F99 A;  3WAA A;  3AZH C;  1U35 B;  5GXQ C;  1ZLA B;  3UTB D;  4WU9 D;  3WA9 B;  1Q9C A;  2F8N H;  2HIO B;  4J8U C;  2F2A C;  3LZ1 A;  4H9O B;  3AZM A;  1M19 D;  4H9R A;  4H9P A;  5E5A B;  3AV1 A;  3W98 B;  3LJA D;  3UTA C;  1TZY D;  5B0Z A;  2Y2I A;  4G91 C;  3AZN C;  1P3O C;  3A1I A;  4WU8 A;  5B24 B;  1M1A D;  4YM6 A;  3KWQ C;  2G5H C;  3UTB B;  1P3F A;  5AV5 A;  3WTP B;  5B1L B;  5F99 D;  3AZF A;  3REL A;  2NQB A;  2DQN C;  5C3I C;  5B31 B;  5GSU A;  5AV9 A;  1HQ3 C;  3O62 B;  2FJ7 C;  1P3L C;  4J8W A;  5FUG B;  3UT9 D;  4X23 B;  3AV2 C;  3LZ1 D;  3AZG B;  2CV5 D;  5CPJ B;  5B2I A;  3AZK B;  1TAF B;  3AZM D;  3X1S A;  2ZM5 A;  4KUD B;  3AV1 D;  4R8P D;  3AZI A;  2F8N A;  5B0Z D;  5AVB C;  5CP6 A;  1P3M A;  5B40 D;  2Y2K A;  4ZBJ B;  2IO5 C;  2Y2L A;  2CV5 B;  2NQB D;  5KDM B;  5GSU D;  5AV9 D;  3B6G A;  4R8P B;  5GT3 C;  5GT0 C;  3EPL A;  1P3G D;  2LY8 A;  5B2I D;  3AN2 C;  3REI C;  5DNM C;  3X1S D;  4LD9 A;  3W96 C;  3C1B A;  1P3A D;  3F6T A;  3WKJ D;  5BT1 C;  3KFU G;  3A6N D;  1W2E A;  2F8N K;  1B67 A;  4DQY B;  5E5A C;  5B0Y A;  1H3O B;  4AWL C;  2JCH A;  3V9R B;  4DRB A;  3MVD A;  2NZD A;  5BNX A;  2BYK A;  2ARO A;  1WWS A;  1P3A B;  3WKJ B;  5AVC B;  1AOI A;  2G5I C;  4WU9 C;  3A6N B;  3MGS A;  1JFI A;  5B32 A;  1B6W A;  1ID3 A;  1M19 C;  4KGC D;  1P3B A;  3MGQ D;  3LJA C;  1TZY C;  4ZUX B;  3AZJ B;  3X1T A;  3REJ B;  4YS3 B;  2YFW A;  1KX3 A;  1P3O D;  3AZH B;  1M1A C;  5B0Y D;  3B0B A;  5JA4 A;  3MVD D;  3W97 C;  4J8U B;  5F99 C;  4Z2M H;  2JE5 A;  3WAA C;  3MGP A;  3WTP E;  3C1C A;  1HQ3 D;  4KGC B;  1P3L D;  3UT9 C;  1T3U A;  2ZY4 A;  3MGS D;  3MGQ B;  5B33 A;  5B32 D;  3LZ1 C;  3UTA B;  4CSR B;  2BYM B;  4G91 B;  3AZM C;  3X1U A;  3AZN B;  1P3O B;  3REH A;  3AV1 C;  4R8P C;  2HUE C;  3KWQ B;  5B0Z C;  3X1T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...