3B6FD

Nucleosome core particle treated with cisplatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 101
sequence length 101
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fD00
3UT9B 3AZEA 3W99C 2F8NB 5BNXB 3REHB 4UUZA 3AZHD 4KUDB 5CPKD 1P34D 3UTAB 5GT0D 3LELC 3KWQC 1M18B 4NFTA 3W96A 3AFAC 3RELA 5C3IC 3C1CD 1KX5D 2BYMB 4H9QA 3LZ1C 5GXQC 4H9RB 1P3LA 5B1LA 4WU8D 3C1BC 5E5AB 4J8VC 4KHAA 5GT3D 4Z5TA 3TU4B 5GSUA 1M19C 3REJD 3WKJD 3MGQD 3LZ0B 1P3KA 1EQZD 1P3IA 1BFMA 1HQ3A 5B2IC 4WU9C 5CHLB 4J8WB 4XZQA 5CPJA 1P3AD 1H3OA 5AV8A 4ZBJB 4YM6D 4LD9D 3UTBB 2AROA 5CPIC 3VH6A 2CWEA 5B31A 4ZUXA 3REHD 2F8ND 2YFWB 1ZLAB 3W97D 3UTAD 3AZFA 3X1SC 4NE6A 1M18D 3VH5T 3C1CC 3X1VC 3MGSC 3X1SA 1ID3C 1KX3B 2JSSA 1U35B 4R8PA 3B6FC 4H9NB 5E5AD 3AN2B 3TU4D 1BH8B 1P3GA 4YS3C 3WTPE 5F99A 5B0ZB 3AV2B 2NZDC 1F1EA 4WV4B 1P3MB 4Z66B 3LZ0D 1F66B 3W98A 3REKB 5KDMB 5B33B 3NQUB 3MVDA 3KXBC 3AZMA 2FJ7C 1AOIB 5CP6B 4H9OA 5B40A 3UT9C 3AV1B 3LJAB 5DNMA 3UTBD 4AWLB 4KUDC 4HGAB 5B2JB 3MNNC 2HUEC 4WNNB 1M18C 5B24A 2IO5B 4J8XB 1KX3D 2HIOA 1P3FA 1P3OC 4CSRB 3W96B 4Z2MG 3AN2D 4H9QB 3VH6T 2PYOB 3A6ND 5AV6A 3AYWB 1TZYA 5B0ZD 3AV2D 4KHAB 4Z66D 1F66D 3KUYC 3REKD 5GSUB 5B33D 4J8WC 1P34B 3AZGA 5B32G 1P3KB 4XUJA 4ZBJC 4G91B 3REIC 1AOID 3B0DC 1P3IB 1HQ3B 3UTBC 4NE5A 1P3PD 3LJAD 1P3BA 2LY8A 5G49B 5CPJB 4E45A 4DRAA 1ZLAC 5AV8B 5B32C 5B2JD 2CV5D 3B6GA 5JRGA 2AROB 3AZED 3REJB 5B31B 3MGQB 4ZUXB 4X23C 1ULYA 5B0YA 3AZFB 1U35C 5BO0A 1S32C 5AVBA 4X23A 5BNVB 3X1TA 3W96D 2NQBC 3RELD 1S32A 1WWIA 3X1UC 5B0ZC 3MGPB 5AY8A 5BS7A 3AV2C 3AYWD 4NE3A 1P3MC 3AZKC 5B1LD 1JFIB 3WA9A 3WTPA 4Z5TD 1KX4C 3O62A 5GSUD 4KGCA 3W97B 3WAAC 5F99B 1AOIC 5CP6C 3W99A 5JA4A 4CAYB 1P3KD 3W98B 5BT1C 3AV1C 1P3ID 1HQ3D 1M1AC 3WAAA 5DNNC 3LELA 3KWQA 5CPJD 3AFAA 5AV8D 5DNNA 1HTAA 5B40B 4EO5C 1N1JA 3NQJB 3LZ1A 4J8UC 2IO5C 5GXQA 2AROD 4J8XC 5B31D 5FUGA 4ZUXD 3C1BA 3MGRC 4J8VA 3AZJC 1R4VA 3AZFD 1M19A 4JJNC 5B1MC 2BYKA 3AZNC 5AV9C 2PYOC 3AYWC 5B2IA 4WU9A 1P3FB 3MGPD 5AV9A 4R8PD 3AZHC 5CPKC 1P34C 5GT0C 5AV6B 1P3GD 5F99D 5AVCB 2RVQD 5AV5B 5CPIA 3W98D 5B31G 1KX5C 3AZGB 3AZMD 4XUJB 3AZIB 4WU8C 3C1CA 4H9SC 3X1VA 5GT3C 5B40D 3MGSA 3AZLB 4G92C 1ID3A 1P3BB 5DNMD 3REJC 3WKJC 3MGQC 3A6NB 4H9SA 1Q9CA 5GT3A 1EQZC 3B6FA 5JRGB 2F8NG 4YS3A 2NZDA 1P3AC 5B24D 4M6BA 4YM6C 3MGPC 4LD9C 2HIOD 4QLCB 1P3FD 3KXBA 1P3PB 3X1TB 2FJ7A 3REHC 3W97C 3UTAC 3UT9A 2CV5B 5AY8B 5AV6D 5BNXA 4KUDA 1TZYD 5AVCD 5AV5D 3AZEB 3WA9B 4UUZB 1KU5A 3MNNA 1TAFA 1M18A 3AZGD 3W99B 5JA4B 4XUJD 3AZID 5E5AC 3AZLD 3RELB 3TU4C 1P3BD 3KWQB 4H9RA 1P3OA 1P3LB 3LZ0C 5B1LB 5C3IB 1N1JB 3B6GD 3LZ1B 4Z5TB 5JRGD 4H9PA 5FUGB 3C1BB 4Z2MH 3KUYA 1M19B 4J8WA 4QLCD 3X1TD 4XZQB 3REIA 1H3OB 3UTBA 5AVCC 5AY8D 5AV5C 1B67A 2YFVA 3WA9D 1ZLAA 3WTPD 5B32A 3O62D 1KX3C 4KGCD 3AZIC 3W99D 3AZLC 3AN2C 3LELD 3A6NC 3X1SB 1U35A 3KWQD 2NQBA 3AFAD 4R8PB 3X1VB 4Z66C 1P3LD 3MGSB 1F66C 3REKC 1ID3B 3X1UA 5B33C 5B0ZA 3LZ1D 3AV2A 5GXQD 1P3GB 1P3MA 3AZKA 3C1BD 3B6FB 4J8VD 4QLCC 1P3PC 1KX4A 1M19D 3LJAC 2NZDB 3MVDB 4AWLC 1AOIA 5CP6A 4HGAC 3AZMB 4XZQD 5B2JC 2CV5C 3AV1A 3B0CW 1M1AA 4H9OB 4WZSB 4WU9D 3KXBB 3AZEC 5DNMB 2FJ7B 5B2JA 4WNNA 3B0BA 4DRBA 4J8UA 5CPID 4J8XA 3W96C 3MGRA 5B24B 3V9RA 3MNNB 3RELC 1TAFB 2HUEB 3AZJA 4CSRA 4E44A 3X1SD 2HIOB 1P3LC 5B1LC 4JJNA 5B1MA 3KSYA 3AZNA 2PYOA 3X1VD 4Z5TC 3MGSD 3AYWA 5GSUC 1ID3D 1BH9A 1P3OB 1P3KC 1TZYB 4G91C 3AZHA 3B6FD 5CPKA 1P3IC 1HQ3C 1P34A 5GT0A 4H9PB 4YS3D 2NZDD 4XZQC 5CPJC 3MVDD 2F8NK 5AV8C 3KUYB 2L5AA 1KX5A 5G49A 3KXBD 2AROC 5B31C 2FJ7D 4WU8A 4ZUXC 3REIB 3B0DB 3UT9D 3AZFC 3WKJA 3REJA 3R45A 3MGQA 3B6GB 4KUDD 2YFVB 3VH5W 5B32B 1EQZA 5B0YB 3MNND 5BNVA 4R8PC 5BO0B 1P3AA 5AVBB 4X23B 4YM6A 3MGPA 4LD9A 2F8NH 1P3GC 1S32B 1P3OD 5F99C 1JFIA 2RVQC 2NQBB 2F8NA 3REHA 3W98C 3X1UB 3WTPB 3W97A 3UTAA 3MVDC 3O62B 4CAYA 3AZKB 3AZMC 4KGCB 1WWSA 5B40C 3KUYD 1KX4B 5DNMC 4J8WD 3WAAB 2BYMA 3LELB 3REID 5E5AA 1M1AB 3AFAB 3NQJA 5DNNB 1A7WA 3TU4A 5B24C 5GXQB 1ZLAD 5B32D 3LZ0A 4EO5B 5B0YD 4J8VB 2HIOC 4J8UB 1P3FC 5AVBD 4X23D 3MGRB 3V9RB 2BYKB 3AZJB 5AV6C 3VH6W 1U35D 1S32D 5B2IB 4JJNB 1TZYC 4WU9B 5B1MB 2NQBD 3AZNB 5AV9B 2YFWA 3X1UD 1BH9B 5AVCA 3AZGC 5AV5A 1P3MD 3AZKD 4XUJC 3AZHB 5CPIB 5CPKB 1KX4D 5GT0B 1KX3A 1P3BC 3WAAD 3AZIA 1B6WA 5CP6D 3AZLA 5BT1D 3AV1D 4H9NA 3C1CB 3AN2A 1M1AD 1KX5B 3B6GC 5DNND 3A6NA 1BH8A 5JRGC 4WU8B 5B0YC 5GT3B 4Z66A 1F66A 4G92B 3REKA 3WKJB 5KDMA 3R45B 5B33A 3NQUA 5AVBC 4J8UD 4J8XD 3X1TC 4YS3B 1EQZB 3MGRD 3VH5A 4QLCA 1P3PA 3AZJD 5AY8C 5BS7C 3LJAA 1P3AB 5B2ID 4JJND 5B1MD 3WA9C 3WTPC 5AV9D 3AZND 2PYOD 3B0CT 4YM6B 2CV5A 4LD9B 3O62C 4KGCC
chains in the Genus database with same CATH superfamily
3UT9B 3AZEA 3W99C 2F8NB 5BNXB 3REHB 4UUZA 3AZHD 4KUDB 5CPKD 1P34D 3UTAB 5GT0D 3LELC 3KWQC 1M18B 4NFTA 3W96A 3AFAC 3RELA 5C3IC 3C1CD 1KX5D 2BYMB 4H9QA 3LZ1C 5GXQC 4H9RB 1P3LA 5B1LA 4WU8D 3C1BC 5E5AB 4J8VC 4KHAA 5GT3D 4Z5TA 2FFFB 3TU4B 5GSUA 1M19C 3REJD 3WKJD 3MGQD 3LZ0B 1P3KA 1EQZD 1P3IA 1BFMA 1HQ3A 5B2IC 4WU9C 5CHLB 4J8WB 4XZQA 5CPJA 1P3AD 1H3OA 5AV8A 4ZBJB 4YM6D 4LD9D 3UTBB 2AROA 5CPIC 3VH6A 2CWEA 5B31A 4ZUXA 3REHD 2F8ND 2YFWB 2Y2QA 1ZLAB 3W97D 3UTAD 3AZFA 3X1SC 4NE6A 1M18D 3VH5T 3C1CC 3X1VC 3MGSC 3X1SA 1ID3C 1KX3B 2JSSA 1U35B 4R8PA 3B6FC 4H9NB 5E5AD 3AN2B 2Y2KA 3TU4D 1BH8B 1P3GA 4YS3C 3WTPE 5F99A 5B0ZB 3AV2B 2NZDC 1F1EA 4WV4B 1P3MB 4Z66B 3LZ0D 1F66B 3W98A 3REKB 5KDMB 5B33B 2BG1A 3NQUB 3MVDA 3KXBC 3AZMA 2FJ7C 1AOIB 1Z2CB 5CP6B 4H9OA 5B40A 3UT9C 3AV1B 3LJAB 5DNMA 3UTBD 4AWLB 4KUDC 4HGAB 4UPKA 5B2JB 3MNNC 2HUEC 1W2EA 4WNNB 1M18C 5B24A 2IO5B 4J8XB 1KX3D 2HIOA 1P3FA 1P3OC 4CSRB 3W96B 4Z2MG 3AN2D 2XD1A 4H9QB 3VH6T 2PYOB 2J8PA 3A6ND 5AV6A 3AYWB 1TZYA 5B0ZD 3AV2D 4KHAB 4Z66D 1F66D 3KUYC 3REKD 5GSUB 5B33D 4J8WC 1P34B 3AZGA 5B32G 3F6TA 1P3KB 4XUJA 4ZBJC 4G91B 3REIC 1AOID 3B0DC 1P3IB 1HQ3B 3UTBC 4NE5A 1P3PD 3LJAD 1P3BA 2LY8A 5G49B 5CPJB 3KFUG 4E45A 4DRAA 1ZLAC 5AV8B 5B32C 5B2JD 2CV5D 3B6GA 5JRGA 2AROB 3AZED 3REJB 5B31B 2RIQA 3A1IA 4ZUXB 3MGQB 4X23C 1ULYA 5B0YA 3AZFB 3H0RC 2ZM5A 1U35C 5BO0A 1S32C 5AVBA 4X23A 5BNVB 3X1TA 3W96D 2NQBC 3RELD 1S32A 1WWIA 3X1UC 5B0ZC 3MGPB 5AY8A 5BS7A 3AV2C 3AYWD 4NE3A 1P3MC 3AZKC 5B1LD 1JFIB 3WA9A 3WTPA 4Z5TD 1KX4C 3O62A 5GSUD 4KGCA 3W97B 3WAAC 5F99B 1AOIC 5CP6C 3W99A 5JA4A 4CAYB 1P3KD 3W98B 5BT1C 3AV1C 1P3ID 1HQ3D 1M1AC 3WAAA 5DNNC 3LELA 3KWQA 5CPJD 3AFAA 2Y2IA 5AV8D 5DNNA 1HTAA 5B40B 4EO5C 1N1JA 3NQJB 3LZ1A 4J8UC 2IO5C 5GXQA 2AROD 4J8XC 5B31D 2Y2LA 5FUGA 4ZUXD 3MGRC 3C1BA 4J8VA 3FDDA 3AZJC 1R4VA 2Y2JA 3AZFD 1M19A 2ZY2A 4JJNC 5B1MC 2BYKA 3AZNC 5AV9C 2PYOC 3AYWC 5B2IA 4WU9A 1P3FB 4DQYB 3MGPD 5AV9A 4R8PD 3AZHC 5CPKC 1P34C 5GT0C 5AV6B 1P3GD 5F99D 5AVCB 2RVQD 5AV5B 5CPIA 3W98D 2W8SA 5B31G 1KX5C 3AZGB 3AZMD 4XUJB 3AZIB 4WU8C 3C1CA 4H9SC 3X1VA 5GT3C 5B40D 3MGSA 3AZLB 4G92C 1ID3A 1P3BB 5DNMD 3EPJA 3REJC 3WKJC 3MGQC 3A6NB 4H9SA 1Q9CA 5GT3A 1EQZC 3B6FA 3EPLA 5JRGB 2F8NG 4YS3A 2NZDA 1P3AC 5B24D 4M6BA 4YM6C 3MGPC 4LD9C 2HIOD 4QLCB 1P3FD 3KXBA 1P3PB 3X1TB 2FJ7A 3REHC 3W97C 3UTAC 3UT9A 2CV5B 5AY8B 5AV6D 2DF4C 5BNXA 4KUDA 1TZYD 5AVCD 5AV5D 3AZEB 3WA9B 4UUZB 1KU5A 3MNNA 1TAFA 1M18A 3AZGD 3W99B 5JA4B 4XUJD 3AZID 5E5AC 2Y2HA 3AZLD 3RELB 3TU4C 1P3BD 2Y2MA 4H9RA 3KWQB 1P3OA 1P3LB 3LZ0C 5B1LB 5C3IB 1N1JB 3B6GD 2XD5A 3LZ1B 4Z5TB 5JRGD 4H9PA 5FUGB 3C1BB 4Z2MH 3KUYA 1M19B 4J8WA 4QLCD 3X1TD 4XZQB 3REIA 1H3OB 3UTBA 5AVCC 5AY8D 5AV5C 1PZRA 1B67A 2YFVA 3WA9D 1ZLAA 3WTPD 5B32A 3O62D 2DQNC 1KX3C 4KGCD 2ZY4A 3AZIC 3W99D 3AZLC 3AN2C 3LELD 3A6NC 3X1SB 1U35A 3KWQD 2NQBA 3AFAD 4R8PB 3X1VB 4Z66C 1P3LD 3MGSB 1F66C 3REKC 1ID3B 3X1UA 5B33C 5B0ZA 3LZ1D 3AV2A 5GXQD 1P3GB 1P3MA 3AZKA 3C1BD 3B6FB 4J8VD 4QLCC 1P3PC 1KX4A 1M19D 3LJAC 2NZDB 2ZY3A 3MVDB 4AWLC 1AOIA 5CP6A 2F2AC 4HGAC 3AZMB 4XZQD 5B2JC 2CV5C 3AV1A 3B0CW 1M1AA 4H9OB 4WZSB 4WU9D 3KXBB 3AZEC 5DNMB 3P5JB 2FJ7B 5B2JA 4WNNA 3B0BA 4DRBA 4J8UA 5CPID 4J8XA 3W96C 3MGRA 5B24B 3V9RA 3MNNB 3RELC 1TAFB 2HUEB 3AZJA 4CSRA 4E44A 3X1SD 2HIOB 1P3LC 5B1LC 4JJNA 5B1MA 3KSYA 3AZNA 2PYOA 3X1VD 4Z5TC 3MGSD 2ZY5A 2Y2GA 5GSUC 3AYWA 1ID3D 1BH9A 1P3OB 3H0MC 1P3KC 1TZYB 4G91C 3AZHA 3B6FD 5CPKA 1P3IC 1HQ3C 1P34A 5GT0A 4H9PB 4YS3D 2NZDD 4XZQC 5CPJC 3MVDD 2F8NK 5AV8C 3KUYB 2L5AA 1KX5A 5G49A 3KXBD 2AROC 4WJ3C 5B31C 2FJ7D 4WU8A 4ZUXC 3REIB 3B0DB 3UT9D 3AZFC 3WKJA 3REJA 3R45A 3MGQA 3B6GB 4KUDD 2YFVB 3VH5W 5B32B 1EQZA 5B0YB 3MNND 2G5IC 5BNVA 4R8PC 3A1KA 5BO0B 5AVBB 4X23B 1P3AA 4YM6A 3MGPA 4LD9A 2F8NH 1P3GC 1S32B 1P3OD 5F99C 1JFIA 2RVQC 2NQBB 2F8NA 3EG5B 3REHA 3W98C 3X1UB 3WTPB 3W97A 3UTAA 3MVDC 3O62B 4CAYA 3AZKB 3AZMC 4KGCB 1WWSA 5B40C 3KUYD 1KX4B 5DNMC 4J8WD 3WAAB 2BYMA 3LELB 2G5HC 3REID 5E5AA 1M1AB 3AFAB 3NQJA 5DNNB 1A7WA 3TU4A 1T3UA 5B24C 5GXQB 1ZLAD 5B32D 3LZ0A 4EO5B 5B0YD 4J8VB 2HIOC 3IP4C 4J8UB 1P3FC 5AVBD 4X23D 3MGRB 3V9RB 2BYKB 3AZJB 5AV6C 3VH6W 1U35D 1S32D 5B2IB 4JJNB 1TZYC 4WU9B 5B1MB 2NQBD 3AZNB 5AV9B 2YFWA 3AL0C 3X1UD 1BH9B 5AVCA 3AZGC 5AV5A 1P3MD 3AZKD 4XUJC 3AZHB 5CPIB 5CPKB 1KX4D 5GT0B 1KX3A 1P3BC 3WAAD 3AZIA 1B6WA 5CP6D 3AZLA 5BT1D 3AV1D 4H9NA 3C1CB 3AN2A 1M1AD 1KX5B 3B6GC 5DNND 3A6NA 1BH8A 5JRGC 4WU8B 5B0YC 2JCHA 2VQRA 5GT3B 4Z66A 3EPKA 1F66A 4G92B 3REKA 2Y2OA 5KDMA 3WKJB 3R45B 5B33A 3NQUA 3H0LC 5AVBC 4J8UD 2Y2PA 4J8XD 3X1TC 3EPHA 4YS3B 1EQZB 3MGRD 2UWXA 3VH5A 4QLCA 1P3PA 3AZJD 5AY8C 5BS7C 3LJAA 1P3AB 5B2ID 4JJND 5B1MD 2Y2NA 2JE5A 3WA9C 3WTPC 5AV9D 3AZND 2PYOD 3B0CT 4YM6B 2CV5A 4LD9B 3O62C 4KGCC
chains in the Genus database with same CATH topology
3UT9B 3AZEA 3W99C 2F8NB 5BNXB 3REHB 4UUZA 3AZHD 4KUDB 5CPKD 1P34D 3UTAB 5GT0D 3LELC 3KWQC 1M18B 4NFTA 3W96A 3AFAC 3RELA 5C3IC 3C1CD 1KX5D 2BYMB 4H9QA 3LZ1C 5GXQC 4H9RB 1P3LA 5B1LA 4WU8D 3C1BC 5E5AB 4J8VC 4KHAA 5GT3D 4Z5TA 2FFFB 3TU4B 5GSUA 1M19C 3REJD 3WKJD 3MGQD 3LZ0B 1P3KA 1EQZD 1P3IA 1BFMA 1HQ3A 5B2IC 4WU9C 5CHLB 4J8WB 4XZQA 5CPJA 1P3AD 1H3OA 5AV8A 4ZBJB 4YM6D 4LD9D 3UTBB 2AROA 5CPIC 3VH6A 2CWEA 5B31A 4ZUXA 3REHD 2F8ND 2YFWB 2Y2QA 1ZLAB 3W97D 3UTAD 3AZFA 3X1SC 4NE6A 1M18D 3VH5T 3C1CC 3X1VC 3MGSC 3X1SA 1ID3C 1KX3B 2JSSA 1U35B 4R8PA 3B6FC 4H9NB 5E5AD 3AN2B 2Y2KA 3TU4D 1BH8B 1P3GA 4YS3C 3WTPE 5F99A 5B0ZB 3AV2B 2NZDC 1F1EA 4WV4B 1P3MB 4Z66B 3LZ0D 1F66B 3W98A 3REKB 5KDMB 5B33B 2BG1A 3NQUB 3MVDA 3KXBC 3AZMA 2FJ7C 1AOIB 1Z2CB 5CP6B 4H9OA 5B40A 3UT9C 3AV1B 3LJAB 5DNMA 3UTBD 4AWLB 4KUDC 4HGAB 4UPKA 5B2JB 3MNNC 2HUEC 1W2EA 4WNNB 1M18C 5B24A 2IO5B 4J8XB 1KX3D 2HIOA 1P3FA 1P3OC 4CSRB 3W96B 4Z2MG 3AN2D 2XD1A 4H9QB 3VH6T 2PYOB 2J8PA 3A6ND 5AV6A 3AYWB 1TZYA 5B0ZD 3AV2D 4KHAB 4Z66D 1F66D 3KUYC 3REKD 5GSUB 5B33D 4J8WC 1P34B 3AZGA 5B32G 3F6TA 1P3KB 4XUJA 4ZBJC 4G91B 3REIC 1AOID 3B0DC 1P3IB 1HQ3B 3UTBC 4NE5A 1P3PD 3LJAD 1P3BA 2LY8A 5G49B 5CPJB 3KFUG 4E45A 4DRAA 1ZLAC 5AV8B 5B32C 5B2JD 2CV5D 3B6GA 5JRGA 2AROB 3AZED 3REJB 5B31B 2RIQA 3A1IA 4ZUXB 3MGQB 4X23C 1ULYA 5B0YA 3AZFB 3H0RC 2ZM5A 1U35C 5BO0A 1S32C 5AVBA 4X23A 5BNVB 3X1TA 3W96D 2NQBC 3RELD 1S32A 1WWIA 3X1UC 5B0ZC 3MGPB 5AY8A 5BS7A 3AV2C 3AYWD 4NE3A 1P3MC 3AZKC 5B1LD 1JFIB 3WA9A 3WTPA 4Z5TD 1KX4C 3O62A 5GSUD 4KGCA 3W97B 3WAAC 5F99B 1AOIC 5CP6C 3W99A 5JA4A 4CAYB 1P3KD 3W98B 5BT1C 3AV1C 1P3ID 1HQ3D 1M1AC 3WAAA 5DNNC 3LELA 3KWQA 5CPJD 3AFAA 2Y2IA 5AV8D 5DNNA 1HTAA 5B40B 4EO5C 1N1JA 3NQJB 3LZ1A 4J8UC 2IO5C 5GXQA 2AROD 4J8XC 5B31D 2Y2LA 5FUGA 4ZUXD 3MGRC 3C1BA 4J8VA 3FDDA 3AZJC 1R4VA 2Y2JA 3AZFD 1M19A 2ZY2A 4JJNC 5B1MC 2BYKA 3AZNC 5AV9C 2PYOC 3AYWC 5B2IA 4WU9A 1P3FB 4DQYB 3MGPD 5AV9A 4R8PD 3AZHC 5CPKC 1P34C 5GT0C 5AV6B 1P3GD 5F99D 5AVCB 2RVQD 5AV5B 5CPIA 3W98D 2W8SA 5B31G 1KX5C 3AZGB 3AZMD 4XUJB 3AZIB 4WU8C 3C1CA 4H9SC 3X1VA 5GT3C 5B40D 3MGSA 3AZLB 4G92C 1ID3A 1P3BB 5DNMD 3EPJA 3REJC 3WKJC 3MGQC 3A6NB 4H9SA 1Q9CA 5GT3A 1EQZC 3B6FA 3EPLA 5JRGB 2F8NG 4YS3A 2NZDA 1P3AC 5B24D 4M6BA 4YM6C 3MGPC 4LD9C 2HIOD 4QLCB 1P3FD 3KXBA 1P3PB 3X1TB 2FJ7A 3REHC 3W97C 3UTAC 3UT9A 2CV5B 5AY8B 5AV6D 2DF4C 5BNXA 4KUDA 1TZYD 5AVCD 5AV5D 3AZEB 3WA9B 4UUZB 1KU5A 3MNNA 1TAFA 1M18A 3AZGD 3W99B 5JA4B 4XUJD 3AZID 5E5AC 2Y2HA 3AZLD 3RELB 3TU4C 1P3BD 2Y2MA 4H9RA 3KWQB 1P3OA 1P3LB 3LZ0C 5B1LB 5C3IB 1N1JB 3B6GD 2XD5A 3LZ1B 4Z5TB 5JRGD 4H9PA 5FUGB 3C1BB 4Z2MH 3KUYA 1M19B 4J8WA 4QLCD 3X1TD 4XZQB 3REIA 1H3OB 3UTBA 5AVCC 5AY8D 5AV5C 1PZRA 1B67A 2YFVA 3WA9D 1ZLAA 3WTPD 5B32A 3O62D 2DQNC 1KX3C 4KGCD 2ZY4A 3AZIC 3W99D 3AZLC 3AN2C 3LELD 3A6NC 3X1SB 1U35A 3KWQD 2NQBA 3AFAD 4R8PB 3X1VB 4Z66C 1P3LD 3MGSB 1F66C 3REKC 1ID3B 3X1UA 5B33C 5B0ZA 3LZ1D 3AV2A 5GXQD 1P3GB 1P3MA 3AZKA 3C1BD 3B6FB 4J8VD 4QLCC 1P3PC 1KX4A 1M19D 3LJAC 2NZDB 2ZY3A 3MVDB 4AWLC 1AOIA 5CP6A 2F2AC 4HGAC 3AZMB 4XZQD 5B2JC 2CV5C 3AV1A 3B0CW 1M1AA 4H9OB 4WZSB 4WU9D 3KXBB 3AZEC 5DNMB 3P5JB 2FJ7B 5B2JA 4WNNA 3B0BA 4DRBA 4J8UA 5CPID 4J8XA 3W96C 3MGRA 5B24B 3V9RA 3MNNB 3RELC 1TAFB 2HUEB 3AZJA 4CSRA 4E44A 3X1SD 2HIOB 1P3LC 5B1LC 4JJNA 5B1MA 3KSYA 3AZNA 2PYOA 3X1VD 4Z5TC 3MGSD 2ZY5A 2Y2GA 5GSUC 3AYWA 1ID3D 1BH9A 1P3OB 3H0MC 1P3KC 1TZYB 4G91C 3AZHA 3B6FD 5CPKA 1P3IC 1HQ3C 1P34A 5GT0A 4H9PB 4YS3D 2NZDD 4XZQC 5CPJC 3MVDD 2F8NK 5AV8C 3KUYB 2L5AA 1KX5A 5G49A 3KXBD 2AROC 4WJ3C 5B31C 2FJ7D 4WU8A 4ZUXC 3REIB 3B0DB 3UT9D 3AZFC 3WKJA 3REJA 3R45A 3MGQA 3B6GB 4KUDD 2YFVB 3VH5W 5B32B 1EQZA 5B0YB 3MNND 2G5IC 5BNVA 4R8PC 3A1KA 5BO0B 5AVBB 4X23B 1P3AA 4YM6A 3MGPA 4LD9A 2F8NH 1P3GC 1S32B 1P3OD 5F99C 1JFIA 2RVQC 2NQBB 2F8NA 3EG5B 3REHA 3W98C 3X1UB 3WTPB 3W97A 3UTAA 3MVDC 3O62B 4CAYA 3AZKB 3AZMC 4KGCB 1WWSA 5B40C 3KUYD 1KX4B 5DNMC 4J8WD 3WAAB 2BYMA 3LELB 2G5HC 3REID 5E5AA 1M1AB 3AFAB 3NQJA 5DNNB 1A7WA 3TU4A 1T3UA 5B24C 5GXQB 1ZLAD 5B32D 3LZ0A 4EO5B 5B0YD 4J8VB 2HIOC 3IP4C 4J8UB 1P3FC 5AVBD 4X23D 3MGRB 3V9RB 2BYKB 3AZJB 5AV6C 3VH6W 1U35D 1S32D 5B2IB 4JJNB 1TZYC 4WU9B 5B1MB 2NQBD 3AZNB 5AV9B 2YFWA 3AL0C 3X1UD 1BH9B 5AVCA 3AZGC 5AV5A 1P3MD 3AZKD 4XUJC 3AZHB 5CPIB 5CPKB 1KX4D 5GT0B 1KX3A 1P3BC 3WAAD 3AZIA 1B6WA 5CP6D 3AZLA 5BT1D 3AV1D 4H9NA 3C1CB 3AN2A 1M1AD 1KX5B 3B6GC 5DNND 3A6NA 1BH8A 5JRGC 4WU8B 5B0YC 2JCHA 2VQRA 5GT3B 4Z66A 3EPKA 1F66A 4G92B 3REKA 2Y2OA 5KDMA 3WKJB 3R45B 5B33A 3NQUA 3H0LC 5AVBC 4J8UD 2Y2PA 4J8XD 3X1TC 3EPHA 4YS3B 1EQZB 3MGRD 2UWXA 3VH5A 4QLCA 1P3PA 3AZJD 5AY8C 5BS7C 3LJAA 1P3AB 5B2ID 4JJND 5B1MD 2Y2NA 2JE5A 3WA9C 3WTPC 5AV9D 3AZND 2PYOD 3B0CT 4YM6B 2CV5A 4LD9B 3O62C 4KGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 B;  3AZE A;  3W99 C;  2F8N B;  5BNX B;  3REH B;  4UUZ A;  3AZH D;  4KUD B;  5CPK D;  1P34 D;  3UTA B;  5GT0 D;  3LEL C;  3KWQ C;  1M18 B;  4NFT A;  3W96 A;  3AFA C;  3REL A;  5C3I C;  3C1C D;  1KX5 D;  2BYM B;  4H9Q A;  3LZ1 C;  5GXQ C;  4H9R B;  1P3L A;  5B1L A;  4WU8 D;  3C1B C;  5E5A B;  4J8V C;  4KHA A;  5GT3 D;  4Z5T A;  3TU4 B;  5GSU A;  1M19 C;  3REJ D;  3WKJ D;  3MGQ D;  3LZ0 B;  1P3K A;  1EQZ D;  1P3I A;  1BFM A;  1HQ3 A;  5B2I C;  4WU9 C;  5CHL B;  4J8W B;  4XZQ A;  5CPJ A;  1P3A D;  1H3O A;  5AV8 A;  4ZBJ B;  4YM6 D;  4LD9 D;  3UTB B;  2ARO A;  5CPI C;  3VH6 A;  2CWE A;  5B31 A;  4ZUX A;  3REH D;  2F8N D;  2YFW B;  1ZLA B;  3W97 D;  3UTA D;  3AZF A;  3X1S C;  4NE6 A;  1M18 D;  3VH5 T;  3C1C C;  3X1V C;  3MGS C;  3X1S A;  1ID3 C;  1KX3 B;  2JSS A;  1U35 B;  4R8P A;  3B6F C;  4H9N B;  5E5A D;  3AN2 B;  3TU4 D;  1BH8 B;  1P3G A;  4YS3 C;  3WTP E;  5F99 A;  5B0Z B;  3AV2 B;  2NZD C;  1F1E A;  4WV4 B;  1P3M B;  4Z66 B;  3LZ0 D;  1F66 B;  3W98 A;  3REK B;  5KDM B;  5B33 B;  3NQU B;  3MVD A;  3KXB C;  3AZM A;  2FJ7 C;  1AOI B;  5CP6 B;  4H9O A;  5B40 A;  3UT9 C;  3AV1 B;  3LJA B;  5DNM A;  3UTB D;  4AWL B;  4KUD C;  4HGA B;  5B2J B;  3MNN C;  2HUE C;  4WNN B;  1M18 C;  5B24 A;  2IO5 B;  4J8X B;  1KX3 D;  2HIO A;  1P3F A;  1P3O C;  4CSR B;  3W96 B;  4Z2M G;  3AN2 D;  4H9Q B;  3VH6 T;  2PYO B;  3A6N D;  5AV6 A;  3AYW B;  1TZY A;  5B0Z D;  3AV2 D;  4KHA B;  4Z66 D;  1F66 D;  3KUY C;  3REK D;  5GSU B;  5B33 D;  4J8W C;  1P34 B;  3AZG A;  5B32 G;  1P3K B;  4XUJ A;  4ZBJ C;  4G91 B;  3REI C;  1AOI D;  3B0D C;  1P3I B;  1HQ3 B;  3UTB C;  4NE5 A;  1P3P D;  3LJA D;  1P3B A;  2LY8 A;  5G49 B;  5CPJ B;  4E45 A;  4DRA A;  1ZLA C;  5AV8 B;  5B32 C;  5B2J D;  2CV5 D;  3B6G A;  5JRG A;  2ARO B;  3AZE D;  3REJ B;  5B31 B;  3MGQ B;  4ZUX B;  4X23 C;  1ULY A;  5B0Y A;  3AZF B;  1U35 C;  5BO0 A;  1S32 C;  5AVB A;  4X23 A;  5BNV B;  3X1T A;  3W96 D;  2NQB C;  3REL D;  1S32 A;  1WWI A;  3X1U C;  5B0Z C;  3MGP B;  5AY8 A;  5BS7 A;  3AV2 C;  3AYW D;  4NE3 A;  1P3M C;  3AZK C;  5B1L D;  1JFI B;  3WA9 A;  3WTP A;  4Z5T D;  1KX4 C;  3O62 A;  5GSU D;  4KGC A;  3W97 B;  3WAA C;  5F99 B;  1AOI C;  5CP6 C;  3W99 A;  5JA4 A;  4CAY B;  1P3K D;  3W98 B;  5BT1 C;  3AV1 C;  1P3I D;  1HQ3 D;  1M1A C;  3WAA A;  5DNN C;  3LEL A;  3KWQ A;  5CPJ D;  3AFA A;  5AV8 D;  5DNN A;  1HTA A;  5B40 B;  4EO5 C;  1N1J A;  3NQJ B;  3LZ1 A;  4J8U C;  2IO5 C;  5GXQ A;  2ARO D;  4J8X C;  5B31 D;  5FUG A;  4ZUX D;  3C1B A;  3MGR C;  4J8V A;  3AZJ C;  1R4V A;  3AZF D;  1M19 A;  4JJN C;  5B1M C;  2BYK A;  3AZN C;  5AV9 C;  2PYO C;  3AYW C;  5B2I A;  4WU9 A;  1P3F B;  3MGP D;  5AV9 A;  4R8P D;  3AZH C;  5CPK C;  1P34 C;  5GT0 C;  5AV6 B;  1P3G D;  5F99 D;  5AVC B;  2RVQ D;  5AV5 B;  5CPI A;  3W98 D;  5B31 G;  1KX5 C;  3AZG B;  3AZM D;  4XUJ B;  3AZI B;  4WU8 C;  3C1C A;  4H9S C;  3X1V A;  5GT3 C;  5B40 D;  3MGS A;  3AZL B;  4G92 C;  1ID3 A;  1P3B B;  5DNM D;  3REJ C;  3WKJ C;  3MGQ C;  3A6N B;  4H9S A;  1Q9C A;  5GT3 A;  1EQZ C;  3B6F A;  5JRG B;  2F8N G;  4YS3 A;  2NZD A;  1P3A C;  5B24 D;  4M6B A;  4YM6 C;  3MGP C;  4LD9 C;  2HIO D;  4QLC B;  1P3F D;  3KXB A;  1P3P B;  3X1T B;  2FJ7 A;  3REH C;  3W97 C;  3UTA C;  3UT9 A;  2CV5 B;  5AY8 B;  5AV6 D;  5BNX A;  4KUD A;  1TZY D;  5AVC D;  5AV5 D;  3AZE B;  3WA9 B;  4UUZ B;  1KU5 A;  3MNN A;  1TAF A;  1M18 A;  3AZG D;  3W99 B;  5JA4 B;  4XUJ D;  3AZI D;  5E5A C;  3AZL D;  3REL B;  3TU4 C;  1P3B D;  3KWQ B;  4H9R A;  1P3O A;  1P3L B;  3LZ0 C;  5B1L B;  5C3I B;  1N1J B;  3B6G D;  3LZ1 B;  4Z5T B;  5JRG D;  4H9P A;  5FUG B;  3C1B B;  4Z2M H;  3KUY A;  1M19 B;  4J8W A;  4QLC D;  3X1T D;  4XZQ B;  3REI A;  1H3O B;  3UTB A;  5AVC C;  5AY8 D;  5AV5 C;  1B67 A;  2YFV A;  3WA9 D;  1ZLA A;  3WTP D;  5B32 A;  3O62 D;  1KX3 C;  4KGC D;  3AZI C;  3W99 D;  3AZL C;  3AN2 C;  3LEL D;  3A6N C;  3X1S B;  1U35 A;  3KWQ D;  2NQB A;  3AFA D;  4R8P B;  3X1V B;  4Z66 C;  1P3L D;  3MGS B;  1F66 C;  3REK C;  1ID3 B;  3X1U A;  5B33 C;  5B0Z A;  3LZ1 D;  3AV2 A;  5GXQ D;  1P3G B;  1P3M A;  3AZK A;  3C1B D;  3B6F B;  4J8V D;  4QLC C;  1P3P C;  1KX4 A;  1M19 D;  3LJA C;  2NZD B;  3MVD B;  4AWL C;  1AOI A;  5CP6 A;  4HGA C;  3AZM B;  4XZQ D;  5B2J C;  2CV5 C;  3AV1 A;  3B0C W;  1M1A A;  4H9O B;  4WZS B;  4WU9 D;  3KXB B;  3AZE C;  5DNM B;  2FJ7 B;  5B2J A;  4WNN A;  3B0B A;  4DRB A;  4J8U A;  5CPI D;  4J8X A;  3W96 C;  3MGR A;  5B24 B;  3V9R A;  3MNN B;  3REL C;  1TAF B;  2HUE B;  3AZJ A;  4CSR A;  4E44 A;  3X1S D;  2HIO B;  1P3L C;  5B1L C;  4JJN A;  5B1M A;  3KSY A;  3AZN A;  2PYO A;  3X1V D;  4Z5T C;  3MGS D;  3AYW A;  5GSU C;  1ID3 D;  1BH9 A;  1P3O B;  1P3K C;  1TZY B;  4G91 C;  3AZH A;  3B6F D;  5CPK A;  1P3I C;  1HQ3 C;  1P34 A;  5GT0 A;  4H9P B;  4YS3 D;  2NZD D;  4XZQ C;  5CPJ C;  3MVD D;  2F8N K;  5AV8 C;  3KUY B;  2L5A A;  1KX5 A;  5G49 A;  3KXB D;  2ARO C;  5B31 C;  2FJ7 D;  4WU8 A;  4ZUX C;  3REI B;  3B0D B;  3UT9 D;  3AZF C;  3WKJ A;  3REJ A;  3R45 A;  3MGQ A;  3B6G B;  4KUD D;  2YFV B;  3VH5 W;  5B32 B;  1EQZ A;  5B0Y B;  3MNN D;  5BNV A;  4R8P C;  5BO0 B;  1P3A A;  5AVB B;  4X23 B;  4YM6 A;  3MGP A;  4LD9 A;  2F8N H;  1P3G C;  1S32 B;  1P3O D;  5F99 C;  1JFI A;  2RVQ C;  2NQB B;  2F8N A;  3REH A;  3W98 C;  3X1U B;  3WTP B;  3W97 A;  3UTA A;  3MVD C;  3O62 B;  4CAY A;  3AZK B;  3AZM C;  4KGC B;  1WWS A;  5B40 C;  3KUY D;  1KX4 B;  5DNM C;  4J8W D;  3WAA B;  2BYM A;  3LEL B;  3REI D;  5E5A A;  1M1A B;  3AFA B;  3NQJ A;  5DNN B;  1A7W A;  3TU4 A;  5B24 C;  5GXQ B;  1ZLA D;  5B32 D;  3LZ0 A;  4EO5 B;  5B0Y D;  4J8V B;  2HIO C;  4J8U B;  1P3F C;  5AVB D;  4X23 D;  3MGR B;  3V9R B;  2BYK B;  3AZJ B;  5AV6 C;  3VH6 W;  1U35 D;  1S32 D;  5B2I B;  4JJN B;  1TZY C;  4WU9 B;  5B1M B;  2NQB D;  3AZN B;  5AV9 B;  2YFW A;  3X1U D;  1BH9 B;  5AVC A;  3AZG C;  5AV5 A;  1P3M D;  3AZK D;  4XUJ C;  3AZH B;  5CPI B;  5CPK B;  1KX4 D;  5GT0 B;  1KX3 A;  1P3B C;  3WAA D;  3AZI A;  1B6W A;  5CP6 D;  3AZL A;  5BT1 D;  3AV1 D;  4H9N A;  3C1C B;  3AN2 A;  1M1A D;  1KX5 B;  3B6G C;  5DNN D;  3A6N A;  1BH8 A;  5JRG C;  4WU8 B;  5B0Y C;  5GT3 B;  4Z66 A;  1F66 A;  4G92 B;  3REK A;  3WKJ B;  5KDM A;  3R45 B;  5B33 A;  3NQU A;  5AVB C;  4J8U D;  4J8X D;  3X1T C;  4YS3 B;  1EQZ B;  3MGR D;  3VH5 A;  4QLC A;  1P3P A;  3AZJ D;  5AY8 C;  5BS7 C;  3LJA A;  1P3A B;  5B2I D;  4JJN D;  5B1M D;  3WA9 C;  3WTP C;  5AV9 D;  3AZN D;  2PYO D;  3B0C T;  4YM6 B;  2CV5 A;  4LD9 B;  3O62 C;  4KGC C; 
#chains in the Genus database with same CATH topology
 3UT9 B;  3AZE A;  3W99 C;  2F8N B;  5BNX B;  3REH B;  4UUZ A;  3AZH D;  4KUD B;  5CPK D;  1P34 D;  3UTA B;  5GT0 D;  3LEL C;  3KWQ C;  1M18 B;  4NFT A;  3W96 A;  3AFA C;  3REL A;  5C3I C;  3C1C D;  1KX5 D;  2BYM B;  4H9Q A;  3LZ1 C;  5GXQ C;  4H9R B;  1P3L A;  5B1L A;  4WU8 D;  3C1B C;  5E5A B;  4J8V C;  4KHA A;  5GT3 D;  4Z5T A;  2FFF B;  3TU4 B;  5GSU A;  1M19 C;  3REJ D;  3WKJ D;  3MGQ D;  3LZ0 B;  1P3K A;  1EQZ D;  1P3I A;  1BFM A;  1HQ3 A;  5B2I C;  4WU9 C;  5CHL B;  4J8W B;  4XZQ A;  5CPJ A;  1P3A D;  1H3O A;  5AV8 A;  4ZBJ B;  4YM6 D;  4LD9 D;  3UTB B;  2ARO A;  5CPI C;  3VH6 A;  2CWE A;  5B31 A;  4ZUX A;  3REH D;  2F8N D;  2YFW B;  2Y2Q A;  1ZLA B;  3W97 D;  3UTA D;  3AZF A;  3X1S C;  4NE6 A;  1M18 D;  3VH5 T;  3C1C C;  3X1V C;  3MGS C;  3X1S A;  1ID3 C;  1KX3 B;  2JSS A;  1U35 B;  4R8P A;  3B6F C;  4H9N B;  5E5A D;  3AN2 B;  2Y2K A;  3TU4 D;  1BH8 B;  1P3G A;  4YS3 C;  3WTP E;  5F99 A;  5B0Z B;  3AV2 B;  2NZD C;  1F1E A;  4WV4 B;  1P3M B;  4Z66 B;  3LZ0 D;  1F66 B;  3W98 A;  3REK B;  5KDM B;  5B33 B;  2BG1 A;  3NQU B;  3MVD A;  3KXB C;  3AZM A;  2FJ7 C;  1AOI B;  1Z2C B;  5CP6 B;  4H9O A;  5B40 A;  3UT9 C;  3AV1 B;  3LJA B;  5DNM A;  3UTB D;  4AWL B;  4KUD C;  4HGA B;  4UPK A;  5B2J B;  3MNN C;  2HUE C;  1W2E A;  4WNN B;  1M18 C;  5B24 A;  2IO5 B;  4J8X B;  1KX3 D;  2HIO A;  1P3F A;  1P3O C;  4CSR B;  3W96 B;  4Z2M G;  3AN2 D;  2XD1 A;  4H9Q B;  3VH6 T;  2PYO B;  2J8P A;  3A6N D;  5AV6 A;  3AYW B;  1TZY A;  5B0Z D;  3AV2 D;  4KHA B;  4Z66 D;  1F66 D;  3KUY C;  3REK D;  5GSU B;  5B33 D;  4J8W C;  1P34 B;  3AZG A;  5B32 G;  3F6T A;  1P3K B;  4XUJ A;  4ZBJ C;  4G91 B;  3REI C;  1AOI D;  3B0D C;  1P3I B;  1HQ3 B;  3UTB C;  4NE5 A;  1P3P D;  3LJA D;  1P3B A;  2LY8 A;  5G49 B;  5CPJ B;  3KFU G;  4E45 A;  4DRA A;  1ZLA C;  5AV8 B;  5B32 C;  5B2J D;  2CV5 D;  3B6G A;  5JRG A;  2ARO B;  3AZE D;  3REJ B;  5B31 B;  2RIQ A;  3A1I A;  4ZUX B;  3MGQ B;  4X23 C;  1ULY A;  5B0Y A;  3AZF B;  3H0R C;  2ZM5 A;  1U35 C;  5BO0 A;  1S32 C;  5AVB A;  4X23 A;  5BNV B;  3X1T A;  3W96 D;  2NQB C;  3REL D;  1S32 A;  1WWI A;  3X1U C;  5B0Z C;  3MGP B;  5AY8 A;  5BS7 A;  3AV2 C;  3AYW D;  4NE3 A;  1P3M C;  3AZK C;  5B1L D;  1JFI B;  3WA9 A;  3WTP A;  4Z5T D;  1KX4 C;  3O62 A;  5GSU D;  4KGC A;  3W97 B;  3WAA C;  5F99 B;  1AOI C;  5CP6 C;  3W99 A;  5JA4 A;  4CAY B;  1P3K D;  3W98 B;  5BT1 C;  3AV1 C;  1P3I D;  1HQ3 D;  1M1A C;  3WAA A;  5DNN C;  3LEL A;  3KWQ A;  5CPJ D;  3AFA A;  2Y2I A;  5AV8 D;  5DNN A;  1HTA A;  5B40 B;  4EO5 C;  1N1J A;  3NQJ B;  3LZ1 A;  4J8U C;  2IO5 C;  5GXQ A;  2ARO D;  4J8X C;  5B31 D;  2Y2L A;  5FUG A;  4ZUX D;  3MGR C;  3C1B A;  4J8V A;  3FDD A;  3AZJ C;  1R4V A;  2Y2J A;  3AZF D;  1M19 A;  2ZY2 A;  4JJN C;  5B1M C;  2BYK A;  3AZN C;  5AV9 C;  2PYO C;  3AYW C;  5B2I A;  4WU9 A;  1P3F B;  4DQY B;  3MGP D;  5AV9 A;  4R8P D;  3AZH C;  5CPK C;  1P34 C;  5GT0 C;  5AV6 B;  1P3G D;  5F99 D;  5AVC B;  2RVQ D;  5AV5 B;  5CPI A;  3W98 D;  2W8S A;  5B31 G;  1KX5 C;  3AZG B;  3AZM D;  4XUJ B;  3AZI B;  4WU8 C;  3C1C A;  4H9S C;  3X1V A;  5GT3 C;  5B40 D;  3MGS A;  3AZL B;  4G92 C;  1ID3 A;  1P3B B;  5DNM D;  3EPJ A;  3REJ C;  3WKJ C;  3MGQ C;  3A6N B;  4H9S A;  1Q9C A;  5GT3 A;  1EQZ C;  3B6F A;  3EPL A;  5JRG B;  2F8N G;  4YS3 A;  2NZD A;  1P3A C;  5B24 D;  4M6B A;  4YM6 C;  3MGP C;  4LD9 C;  2HIO D;  4QLC B;  1P3F D;  3KXB A;  1P3P B;  3X1T B;  2FJ7 A;  3REH C;  3W97 C;  3UTA C;  3UT9 A;  2CV5 B;  5AY8 B;  5AV6 D;  2DF4 C;  5BNX A;  4KUD A;  1TZY D;  5AVC D;  5AV5 D;  3AZE B;  3WA9 B;  4UUZ B;  1KU5 A;  3MNN A;  1TAF A;  1M18 A;  3AZG D;  3W99 B;  5JA4 B;  4XUJ D;  3AZI D;  5E5A C;  2Y2H A;  3AZL D;  3REL B;  3TU4 C;  1P3B D;  2Y2M A;  4H9R A;  3KWQ B;  1P3O A;  1P3L B;  3LZ0 C;  5B1L B;  5C3I B;  1N1J B;  3B6G D;  2XD5 A;  3LZ1 B;  4Z5T B;  5JRG D;  4H9P A;  5FUG B;  3C1B B;  4Z2M H;  3KUY A;  1M19 B;  4J8W A;  4QLC D;  3X1T D;  4XZQ B;  3REI A;  1H3O B;  3UTB A;  5AVC C;  5AY8 D;  5AV5 C;  1PZR A;  1B67 A;  2YFV A;  3WA9 D;  1ZLA A;  3WTP D;  5B32 A;  3O62 D;  2DQN C;  1KX3 C;  4KGC D;  2ZY4 A;  3AZI C;  3W99 D;  3AZL C;  3AN2 C;  3LEL D;  3A6N C;  3X1S B;  1U35 A;  3KWQ D;  2NQB A;  3AFA D;  4R8P B;  3X1V B;  4Z66 C;  1P3L D;  3MGS B;  1F66 C;  3REK C;  1ID3 B;  3X1U A;  5B33 C;  5B0Z A;  3LZ1 D;  3AV2 A;  5GXQ D;  1P3G B;  1P3M A;  3AZK A;  3C1B D;  3B6F B;  4J8V D;  4QLC C;  1P3P C;  1KX4 A;  1M19 D;  3LJA C;  2NZD B;  2ZY3 A;  3MVD B;  4AWL C;  1AOI A;  5CP6 A;  2F2A C;  4HGA C;  3AZM B;  4XZQ D;  5B2J C;  2CV5 C;  3AV1 A;  3B0C W;  1M1A A;  4H9O B;  4WZS B;  4WU9 D;  3KXB B;  3AZE C;  5DNM B;  3P5J B;  2FJ7 B;  5B2J A;  4WNN A;  3B0B A;  4DRB A;  4J8U A;  5CPI D;  4J8X A;  3W96 C;  3MGR A;  5B24 B;  3V9R A;  3MNN B;  3REL C;  1TAF B;  2HUE B;  3AZJ A;  4CSR A;  4E44 A;  3X1S D;  2HIO B;  1P3L C;  5B1L C;  4JJN A;  5B1M A;  3KSY A;  3AZN A;  2PYO A;  3X1V D;  4Z5T C;  3MGS D;  2ZY5 A;  2Y2G A;  5GSU C;  3AYW A;  1ID3 D;  1BH9 A;  1P3O B;  3H0M C;  1P3K C;  1TZY B;  4G91 C;  3AZH A;  3B6F D;  5CPK A;  1P3I C;  1HQ3 C;  1P34 A;  5GT0 A;  4H9P B;  4YS3 D;  2NZD D;  4XZQ C;  5CPJ C;  3MVD D;  2F8N K;  5AV8 C;  3KUY B;  2L5A A;  1KX5 A;  5G49 A;  3KXB D;  2ARO C;  4WJ3 C;  5B31 C;  2FJ7 D;  4WU8 A;  4ZUX C;  3REI B;  3B0D B;  3UT9 D;  3AZF C;  3WKJ A;  3REJ A;  3R45 A;  3MGQ A;  3B6G B;  4KUD D;  2YFV B;  3VH5 W;  5B32 B;  1EQZ A;  5B0Y B;  3MNN D;  2G5I C;  5BNV A;  4R8P C;  3A1K A;  5BO0 B;  5AVB B;  4X23 B;  1P3A A;  4YM6 A;  3MGP A;  4LD9 A;  2F8N H;  1P3G C;  1S32 B;  1P3O D;  5F99 C;  1JFI A;  2RVQ C;  2NQB B;  2F8N A;  3EG5 B;  3REH A;  3W98 C;  3X1U B;  3WTP B;  3W97 A;  3UTA A;  3MVD C;  3O62 B;  4CAY A;  3AZK B;  3AZM C;  4KGC B;  1WWS A;  5B40 C;  3KUY D;  1KX4 B;  5DNM C;  4J8W D;  3WAA B;  2BYM A;  3LEL B;  2G5H C;  3REI D;  5E5A A;  1M1A B;  3AFA B;  3NQJ A;  5DNN B;  1A7W A;  3TU4 A;  1T3U A;  5B24 C;  5GXQ B;  1ZLA D;  5B32 D;  3LZ0 A;  4EO5 B;  5B0Y D;  4J8V B;  2HIO C;  3IP4 C;  4J8U B;  1P3F C;  5AVB D;  4X23 D;  3MGR B;  3V9R B;  2BYK B;  3AZJ B;  5AV6 C;  3VH6 W;  1U35 D;  1S32 D;  5B2I B;  4JJN B;  1TZY C;  4WU9 B;  5B1M B;  2NQB D;  3AZN B;  5AV9 B;  2YFW A;  3AL0 C;  3X1U D;  1BH9 B;  5AVC A;  3AZG C;  5AV5 A;  1P3M D;  3AZK D;  4XUJ C;  3AZH B;  5CPI B;  5CPK B;  1KX4 D;  5GT0 B;  1KX3 A;  1P3B C;  3WAA D;  3AZI A;  1B6W A;  5CP6 D;  3AZL A;  5BT1 D;  3AV1 D;  4H9N A;  3C1C B;  3AN2 A;  1M1A D;  1KX5 B;  3B6G C;  5DNN D;  3A6N A;  1BH8 A;  5JRG C;  4WU8 B;  5B0Y C;  2JCH A;  2VQR A;  5GT3 B;  4Z66 A;  3EPK A;  1F66 A;  4G92 B;  3REK A;  2Y2O A;  5KDM A;  3WKJ B;  3R45 B;  5B33 A;  3NQU A;  3H0L C;  5AVB C;  4J8U D;  2Y2P A;  4J8X D;  3X1T C;  3EPH A;  4YS3 B;  1EQZ B;  3MGR D;  2UWX A;  3VH5 A;  4QLC A;  1P3P A;  3AZJ D;  5AY8 C;  5BS7 C;  3LJA A;  1P3A B;  5B2I D;  4JJN D;  5B1M D;  2Y2N A;  2JE5 A;  3WA9 C;  3WTP C;  5AV9 D;  3AZN D;  2PYO D;  3B0C T;  4YM6 B;  2CV5 A;  4LD9 B;  3O62 C;  4KGC C; 
#chains in the Genus database with same CATH homology
 3UT9 B;  3AZE A;  3W99 C;  2F8N B;  5BNX B;  3REH B;  4UUZ A;  3AZH D;  4KUD B;  5CPK D;  1P34 D;  3UTA B;  5GT0 D;  3LEL C;  3KWQ C;  1M18 B;  4NFT A;  3W96 A;  3AFA C;  3REL A;  5C3I C;  3C1C D;  1KX5 D;  2BYM B;  4H9Q A;  3LZ1 C;  5GXQ C;  4H9R B;  1P3L A;  5B1L A;  4WU8 D;  3C1B C;  5E5A B;  4J8V C;  4KHA A;  5GT3 D;  4Z5T A;  2FFF B;  3TU4 B;  5GSU A;  1M19 C;  3REJ D;  3WKJ D;  3MGQ D;  3LZ0 B;  1P3K A;  1EQZ D;  1P3I A;  1BFM A;  1HQ3 A;  5B2I C;  4WU9 C;  5CHL B;  4J8W B;  4XZQ A;  5CPJ A;  1P3A D;  1H3O A;  5AV8 A;  4ZBJ B;  4YM6 D;  4LD9 D;  3UTB B;  2ARO A;  5CPI C;  3VH6 A;  2CWE A;  5B31 A;  4ZUX A;  3REH D;  2F8N D;  2YFW B;  2Y2Q A;  1ZLA B;  3W97 D;  3UTA D;  3AZF A;  3X1S C;  4NE6 A;  1M18 D;  3VH5 T;  3C1C C;  3X1V C;  3MGS C;  3X1S A;  1ID3 C;  1KX3 B;  2JSS A;  1U35 B;  4R8P A;  3B6F C;  4H9N B;  5E5A D;  3AN2 B;  2Y2K A;  3TU4 D;  1BH8 B;  1P3G A;  4YS3 C;  3WTP E;  5F99 A;  5B0Z B;  3AV2 B;  2NZD C;  1F1E A;  4WV4 B;  1P3M B;  4Z66 B;  3LZ0 D;  1F66 B;  3W98 A;  3REK B;  5KDM B;  5B33 B;  2BG1 A;  3NQU B;  3MVD A;  3KXB C;  3AZM A;  2FJ7 C;  1AOI B;  1Z2C B;  5CP6 B;  4H9O A;  5B40 A;  3UT9 C;  3AV1 B;  3LJA B;  5DNM A;  3UTB D;  4AWL B;  4KUD C;  4HGA B;  4UPK A;  5B2J B;  3MNN C;  2HUE C;  1W2E A;  4WNN B;  1M18 C;  5B24 A;  2IO5 B;  4J8X B;  1KX3 D;  2HIO A;  1P3F A;  1P3O C;  4CSR B;  3W96 B;  4Z2M G;  3AN2 D;  2XD1 A;  4H9Q B;  3VH6 T;  2PYO B;  2J8P A;  3A6N D;  5AV6 A;  3AYW B;  1TZY A;  5B0Z D;  3AV2 D;  4KHA B;  4Z66 D;  1F66 D;  3KUY C;  3REK D;  5GSU B;  5B33 D;  4J8W C;  1P34 B;  3AZG A;  5B32 G;  3F6T A;  1P3K B;  4XUJ A;  4ZBJ C;  4G91 B;  3REI C;  1AOI D;  3B0D C;  1P3I B;  1HQ3 B;  3UTB C;  4NE5 A;  1P3P D;  3LJA D;  1P3B A;  2LY8 A;  5G49 B;  5CPJ B;  3KFU G;  4E45 A;  4DRA A;  1ZLA C;  5AV8 B;  5B32 C;  5B2J D;  2CV5 D;  3B6G A;  5JRG A;  2ARO B;  3AZE D;  3REJ B;  5B31 B;  2RIQ A;  3A1I A;  4ZUX B;  3MGQ B;  4X23 C;  1ULY A;  5B0Y A;  3AZF B;  3H0R C;  2ZM5 A;  1U35 C;  5BO0 A;  1S32 C;  5AVB A;  4X23 A;  5BNV B;  3X1T A;  3W96 D;  2NQB C;  3REL D;  1S32 A;  1WWI A;  3X1U C;  5B0Z C;  3MGP B;  5AY8 A;  5BS7 A;  3AV2 C;  3AYW D;  4NE3 A;  1P3M C;  3AZK C;  5B1L D;  1JFI B;  3WA9 A;  3WTP A;  4Z5T D;  1KX4 C;  3O62 A;  5GSU D;  4KGC A;  3W97 B;  3WAA C;  5F99 B;  1AOI C;  5CP6 C;  3W99 A;  5JA4 A;  4CAY B;  1P3K D;  3W98 B;  5BT1 C;  3AV1 C;  1P3I D;  1HQ3 D;  1M1A C;  3WAA A;  5DNN C;  3LEL A;  3KWQ A;  5CPJ D;  3AFA A;  2Y2I A;  5AV8 D;  5DNN A;  1HTA A;  5B40 B;  4EO5 C;  1N1J A;  3NQJ B;  3LZ1 A;  4J8U C;  2IO5 C;  5GXQ A;  2ARO D;  4J8X C;  5B31 D;  2Y2L A;  5FUG A;  4ZUX D;  3MGR C;  3C1B A;  4J8V A;  3FDD A;  3AZJ C;  1R4V A;  2Y2J A;  3AZF D;  1M19 A;  2ZY2 A;  4JJN C;  5B1M C;  2BYK A;  3AZN C;  5AV9 C;  2PYO C;  3AYW C;  5B2I A;  4WU9 A;  1P3F B;  4DQY B;  3MGP D;  5AV9 A;  4R8P D;  3AZH C;  5CPK C;  1P34 C;  5GT0 C;  5AV6 B;  1P3G D;  5F99 D;  5AVC B;  2RVQ D;  5AV5 B;  5CPI A;  3W98 D;  2W8S A;  5B31 G;  1KX5 C;  3AZG B;  3AZM D;  4XUJ B;  3AZI B;  4WU8 C;  3C1C A;  4H9S C;  3X1V A;  5GT3 C;  5B40 D;  3MGS A;  3AZL B;  4G92 C;  1ID3 A;  1P3B B;  5DNM D;  3EPJ A;  3REJ C;  3WKJ C;  3MGQ C;  3A6N B;  4H9S A;  1Q9C A;  5GT3 A;  1EQZ C;  3B6F A;  3EPL A;  5JRG B;  2F8N G;  4YS3 A;  2NZD A;  1P3A C;  5B24 D;  4M6B A;  4YM6 C;  3MGP C;  4LD9 C;  2HIO D;  4QLC B;  1P3F D;  3KXB A;  1P3P B;  3X1T B;  2FJ7 A;  3REH C;  3W97 C;  3UTA C;  3UT9 A;  2CV5 B;  5AY8 B;  5AV6 D;  2DF4 C;  5BNX A;  4KUD A;  1TZY D;  5AVC D;  5AV5 D;  3AZE B;  3WA9 B;  4UUZ B;  1KU5 A;  3MNN A;  1TAF A;  1M18 A;  3AZG D;  3W99 B;  5JA4 B;  4XUJ D;  3AZI D;  5E5A C;  2Y2H A;  3AZL D;  3REL B;  3TU4 C;  1P3B D;  2Y2M A;  4H9R A;  3KWQ B;  1P3O A;  1P3L B;  3LZ0 C;  5B1L B;  5C3I B;  1N1J B;  3B6G D;  2XD5 A;  3LZ1 B;  4Z5T B;  5JRG D;  4H9P A;  5FUG B;  3C1B B;  4Z2M H;  3KUY A;  1M19 B;  4J8W A;  4QLC D;  3X1T D;  4XZQ B;  3REI A;  1H3O B;  3UTB A;  5AVC C;  5AY8 D;  5AV5 C;  1PZR A;  1B67 A;  2YFV A;  3WA9 D;  1ZLA A;  3WTP D;  5B32 A;  3O62 D;  2DQN C;  1KX3 C;  4KGC D;  2ZY4 A;  3AZI C;  3W99 D;  3AZL C;  3AN2 C;  3LEL D;  3A6N C;  3X1S B;  1U35 A;  3KWQ D;  2NQB A;  3AFA D;  4R8P B;  3X1V B;  4Z66 C;  1P3L D;  3MGS B;  1F66 C;  3REK C;  1ID3 B;  3X1U A;  5B33 C;  5B0Z A;  3LZ1 D;  3AV2 A;  5GXQ D;  1P3G B;  1P3M A;  3AZK A;  3C1B D;  3B6F B;  4J8V D;  4QLC C;  1P3P C;  1KX4 A;  1M19 D;  3LJA C;  2NZD B;  2ZY3 A;  3MVD B;  4AWL C;  1AOI A;  5CP6 A;  2F2A C;  4HGA C;  3AZM B;  4XZQ D;  5B2J C;  2CV5 C;  3AV1 A;  3B0C W;  1M1A A;  4H9O B;  4WZS B;  4WU9 D;  3KXB B;  3AZE C;  5DNM B;  3P5J B;  2FJ7 B;  5B2J A;  4WNN A;  3B0B A;  4DRB A;  4J8U A;  5CPI D;  4J8X A;  3W96 C;  3MGR A;  5B24 B;  3V9R A;  3MNN B;  3REL C;  1TAF B;  2HUE B;  3AZJ A;  4CSR A;  4E44 A;  3X1S D;  2HIO B;  1P3L C;  5B1L C;  4JJN A;  5B1M A;  3KSY A;  3AZN A;  2PYO A;  3X1V D;  4Z5T C;  3MGS D;  2ZY5 A;  2Y2G A;  5GSU C;  3AYW A;  1ID3 D;  1BH9 A;  1P3O B;  3H0M C;  1P3K C;  1TZY B;  4G91 C;  3AZH A;  3B6F D;  5CPK A;  1P3I C;  1HQ3 C;  1P34 A;  5GT0 A;  4H9P B;  4YS3 D;  2NZD D;  4XZQ C;  5CPJ C;  3MVD D;  2F8N K;  5AV8 C;  3KUY B;  2L5A A;  1KX5 A;  5G49 A;  3KXB D;  2ARO C;  4WJ3 C;  5B31 C;  2FJ7 D;  4WU8 A;  4ZUX C;  3REI B;  3B0D B;  3UT9 D;  3AZF C;  3WKJ A;  3REJ A;  3R45 A;  3MGQ A;  3B6G B;  4KUD D;  2YFV B;  3VH5 W;  5B32 B;  1EQZ A;  5B0Y B;  3MNN D;  2G5I C;  5BNV A;  4R8P C;  3A1K A;  5BO0 B;  5AVB B;  4X23 B;  1P3A A;  4YM6 A;  3MGP A;  4LD9 A;  2F8N H;  1P3G C;  1S32 B;  1P3O D;  5F99 C;  1JFI A;  2RVQ C;  2NQB B;  2F8N A;  3EG5 B;  3REH A;  3W98 C;  3X1U B;  3WTP B;  3W97 A;  3UTA A;  3MVD C;  3O62 B;  4CAY A;  3AZK B;  3AZM C;  4KGC B;  1WWS A;  5B40 C;  3KUY D;  1KX4 B;  5DNM C;  4J8W D;  3WAA B;  2BYM A;  3LEL B;  2G5H C;  3REI D;  5E5A A;  1M1A B;  3AFA B;  3NQJ A;  5DNN B;  1A7W A;  3TU4 A;  1T3U A;  5B24 C;  5GXQ B;  1ZLA D;  5B32 D;  3LZ0 A;  4EO5 B;  5B0Y D;  4J8V B;  2HIO C;  3IP4 C;  4J8U B;  1P3F C;  5AVB D;  4X23 D;  3MGR B;  3V9R B;  2BYK B;  3AZJ B;  5AV6 C;  3VH6 W;  1U35 D;  1S32 D;  5B2I B;  4JJN B;  1TZY C;  4WU9 B;  5B1M B;  2NQB D;  3AZN B;  5AV9 B;  2YFW A;  3AL0 C;  3X1U D;  1BH9 B;  5AVC A;  3AZG C;  5AV5 A;  1P3M D;  3AZK D;  4XUJ C;  3AZH B;  5CPI B;  5CPK B;  1KX4 D;  5GT0 B;  1KX3 A;  1P3B C;  3WAA D;  3AZI A;  1B6W A;  5CP6 D;  3AZL A;  5BT1 D;  3AV1 D;  4H9N A;  3C1C B;  3AN2 A;  1M1A D;  1KX5 B;  3B6G C;  5DNN D;  3A6N A;  1BH8 A;  5JRG C;  4WU8 B;  5B0Y C;  2JCH A;  2VQR A;  5GT3 B;  4Z66 A;  3EPK A;  1F66 A;  4G92 B;  3REK A;  2Y2O A;  5KDM A;  3WKJ B;  3R45 B;  5B33 A;  3NQU A;  3H0L C;  5AVB C;  4J8U D;  2Y2P A;  4J8X D;  3X1T C;  3EPH A;  4YS3 B;  1EQZ B;  3MGR D;  2UWX A;  3VH5 A;  4QLC A;  1P3P A;  3AZJ D;  5AY8 C;  5BS7 C;  3LJA A;  1P3A B;  5B2I D;  4JJN D;  5B1M D;  2Y2N A;  2JE5 A;  3WA9 C;  3WTP C;  5AV9 D;  3AZN D;  2PYO D;  3B0C T;  4YM6 B;  2CV5 A;  4LD9 B;  3O62 C;  4KGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...