3B6GA

Nucleosome core particle treated with oxaliplatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gA00
3MGRA 3AZFA 5GT3C 4X23C 3AZMD 4Z5TA 5CHLB 3AZMC 1P3AB 3WTPA 4DRBA 4XZQB 4WV4B 2PYOA 2F8NG 5E5AD 3X1UD 1EQZD 5E5AC 3B0CT 3AZED 1P3FA 3X1UC 1EQZC 5C3IB 1P3MC 1P3GB 3AZEC 5CP6B 1P3KA 3AZKB 2F8NA 5B0ZD 1M1AA 3X1VC 5BS7C 5AV6D 5B0ZC 3W97B 2RVQD 5AV6C 1P3GA 3B6FD 2RVQC 3AZKA 3B6FC 3KSYA 1AOIB 5GT3A 4X23A 3B0DB 3X1UB 1P3MB 1ID3B 1S32B 3AZMA 3AZJB 5B24B 2BYMA 3AZIB 3X1VB 1P3LD 1A7WA 3X1UA 1P3MA 1ULYA 1P3PD 3AZEA 3AN2B 3AV1D 5GSUC 1P3LC 3AFAD 1P3PC 3W96D 5G49A 3W99D 4QLCC 3AFAC 3W96C 3WAAD 3WTPE 4JJND 3WAAC 3O62D 3AZHD 3X1SD 4JJNC 3O62C 2HUEC 3AZHC 3X1VA 3MVDB 3REID 5BS7A 5B0ZA 3C1CD 3REIC 3W98B 5AV6A 4ZUXD 3C1CC 5F99D 5B32D 1M19D 1U35D 3B6FA 5F99C 5B32C 4CSRB 4Z2MH 3AZGD 1M19C 1Q9CA 5AV9B 1ZLAC 5JRGD 2LY8A 4UUZB 5JRGC 5GSUB 1B6WA 4QLCB 1F1EA 1H3OB 2NZDB 3AZHB 4CSRA 5CPKD 4H9PB 5B40B 3NQUB 4WNNB 5GSUA 1P3LA 4CAYB 1P3PA 3KWQB 3AFAA 4QLCA 5F99B 3W96A 5B32G 3WAAA 5AVCB 1ZLAB 4G92B 1H3OA 2NZDA 4JJNA 4Z66D 3O62A 3AZHA 2CWEA 4KGCB 3MGSD 4Z66C 3LELB 3REIA 4WU8D 3C1CA 3AZND 3X1TD 4CAYA 4WU8C 1M18B 3AZNC 3X1TC 5F99A 5B32A 1M19A 5B1MB 1ZLAA 1BH9B 5B2ID 5B2IC 4KUDD 3REKB 4KUDC 5B2JD 4H9OA 2PYOD 5B2JC 4J8VB 3VH5W 2JSSA 3KUYC 4WZSB 5JA4B 1P3AD 4M6BA 4YS3B 1P3AC 1JFIA 4XZQD 2YFVB 4XZQC 5BT1D 1HQ3B 1F66D 4NE5A 2FJ7C 5BT1C 4Z66A 1F66C 5JA4A 5CP6D 4WU8A 4DRAA 5B2JB 3AZKD 5CP6C 3AZNA 3X1TA 4YS3A 3VH6W 3KUYB 5B2IA 3W97D 4KUDA 2BYKB 3AV2B 1BFMA 3W97C 5B2JA 5BNXB 1AOID 2FJ7B 5DNMB 1F66B 3KUYA 1AOIC 1HTAA 5BNVB 1P3MD 3B0DC 1ID3D 1S32D 3REHD 1ID3C 1S32C 3AZJD 1P3AA 3REHC 1KX5B 3AZJC 5BNXA 4XZQA 5B24D 3LZ0C 3AZID 5CPIB 5B24C 3AZIC 3X1VD 2FJ7A 1F66A 5BNVA 3AN2D 2F8NH 3AN2C 5CP6A 5B31B 3VH5T 3AYWD 3WKJB 3NQJB 3AYWC 3MVDD 2CV5B 3R45B 3MVDC 3W98D 5DNNB 3REHB 3W97A 3W98C 3LZ0B 5AV5B 4KHAB 5AV9D 1BH8B 1TZYC 1AOIA 5AV9C 5GSUD 3R45A 1ID3A 1S32A 5DNNA 4QLCD 3REHA 2AROC 5AVBB 3AZJA 3LZ0A 2NZDD 3B0BA 1TAFB 3AYWB 5B24A 4R8PD 4KHAA 3AZIA 2NZDC 3UTAB 3VH6T 1BH8A 4R8PC 3A6ND 5B40D 3A6NC 5BO0B 5B40C 3AN2A 3KWQD 3KWQC 5AVCD 1ZLAD 1TZYB 2F8NK 1KX4B 4KGCD 5AVCC 2HIOB 4G92C 3AYWA 3MGQB 4KGCC 3LELD 3MVDA 1KU5A 3LELC 2AROB 3W98A 5AY8B 1M18D 4NE6A 3TU4C 1M18C 5B1MD 1TZYA 4R8PB 5B1MC 5AV9A 1P3IB 4UUZA 3A6NB 3REKD 3B6GB 3WA9B 3REKC 2AROA 2NQBB 4J8VD 5B33C 3AZLC 4J8VC 5AV8B 4R8PA 3UT9B 1P3IA 3A6NA 4H9PA 3LZ1B 5B40A 3NQUA 4WNNA 1KX3B 3MGPC 3TU4B 4YS3D 3KWQA 4YS3C 1HQ3D 5AVCA 4KGCA 1HQ3C 1P3OC 3RELD 3LELA 1P34B 3RELC 3MNNB 5B33B 3AZLB 5B0YD 3TU4A 1M18A 5B0YC 5GT0B 3KUYD 5B1MA 1BH9A 3LJAB 3MGPB 3AV2D 3REKA 5KDMB 3MNNA 3AV2C 5B33A 3AZLA 2IO5B 4J8VA 2FJ7D 5DNMD 1P3OB 5B1LC 5DNMC 3RELB 4H9QB 3MGPA 4J8WB 1KX5D 4LD9B 5B0YB 1KX5C 5CPID 4HGAB 2YFVA 3KXBB 1B67A 5CPIC 1HQ3A 1P3OA 3REJD 3REJC 3RELA 4J8UB 5B31D 5B0YA 4G91B 3V9RB 5B31C 3MGRB 3AZFB 3WKJD 5B1LB 3WKJC 2CV5D 4Z5TB 5GXQC 4XUJC 2CV5C 5DNND 3WTPB 2BYKA 5DNNC 4J8XB 3AV2A 3LZ0D 3C1BD 4J8UA 5AV5D 3C1BC 3V9RA 5AV5C 4WU9C 5B1LA 5DNMA 1P3FB 3REJB 4AWLB 1P3KB 5AVBD 4J8XA 2F8NB 1KX5A 5AVBC 5B31G 5CPIA 3UTAD 1M1AB 5GXQB 4XUJB 3UTAC 3REJA 1R4VA 4NFTA 3C1BB 1TZYD 5B31A 4WU9B 1KX4D 5GT3B 4X23B 2HIOD 3WKJA 3NQJA 3MGQD 1KX4C 2HIOC 4H9SC 5GXQA 3MGQC 4XUJA 3AZMB 2CV5A 2AROD 5AY8D 5AY8C 2BYMB 3C1BA 5AV5A 4WU9A 5E5AB 1P3ID 1EQZB 4ZBJC 1P3BD 3AZEB 1P3IC 3B6GD 1P3BC 3WA9D 3B6GC 2NQBD 5G49B 3WA9C 1WWSA 5AVBA 2NQBC 5AV8D 1TAFA 5AV8C 5E5AA 3UT9D 5B0ZB 3UTAA 4Z2MG 1EQZA 3UT9C 4EO5C 5AV6B 3LZ1D 1KX3D 3TU4D 4H9RB 5BO0A 3LZ1C 3AV1C 1KX3C 3B6FB 4H9NB 3W99C 1KX4A 4ZBJB 2HIOA 4H9SA 3VH5A 3MGQA 3X1SC 1WWIA 1P3BB 1P34D 3MNND 5B33D 1P34C 3AZLD 4H9RA 3MNNC 5AY8A 4H9NA 4ZUXC 5GT0D 1U35C 3AZGC 5GT0C 3LJAD 4EO5B 1P3LB 1P3BA 3MGPD 3LJAC 1P3PB 3AV1B 3B6GA 3AFAB 3WA9A 3W96B 4YM6D 2NQBA 3W99B 3WAAB 4JJNB 4YM6C 2IO5C 3O62B 2HUEB 5FUGB 3X1SB 1P3OD 5AV8A 3REIB 3UT9A 5CPKC 3VH6A 3C1CB 4J8WD 3LZ1A 3AV1A 1KX3A 4ZUXB 4J8WC 4LD9D 1M19B 5B32B 1U35B 4LD9C 3W99A 3AZGB 3KXBD 4HGAC 5FUGA 3B0CW 3X1SA 5JRGB 3KXBC 5CPJD 3MGSC 1N1JB 4H9OB 1P34A 3UTBD 5CPJC 4J8UD 3UTBC 4ZUXA 4J8UC 4YM6B 1U35A 3MGRD 3AZFD 4G91C 5B1LD 3AZGA 5GT0A 3MGRC 3AZFC 4Z5TD 5CPKB 5JRGA 3LJAA 4Z5TC 3WTPD 2L5AA 1N1JA 3WTPC 4J8XD 1JFIB 5KDMA 4J8XC 2PYOC 4YM6A 4E45A 4Z66B 1P3FD 4NE3A 2YFWB 3MGSB 5CPKA 1P3FC 4WU8B 5CPJB 4AWLC 1P3KD 3UTBB 4H9QA 4J8WA 3AZNB 3X1TB 1P3KC 2F8ND 4LD9A 4E44A 1M1AD 5B2IB 5GXQD 3KXBA 4XUJD 1M1AC 4KUDB 2YFWA 3MGSA 1P3GD 5CPJA 5C3IC 1P3GC 3UTBA 2PYOB 3AZKC 4WU9D 5GT3D 4X23D
chains in the Genus database with same CATH superfamily
3MGRA 3AZFA 5GT3C 4X23C 3AZMD 4Z5TA 5CHLB 3AZMC 1P3AB 3WTPA 4DRBA 4XZQB 4WV4B 2PYOA 2F8NG 5E5AD 2ZY2A 3X1UD 1EQZD 5E5AC 3B0CT 3AZED 1P3FA 3X1UC 1EQZC 5C3IB 1P3MC 1P3GB 3AZEC 5CP6B 1P3KA 3AZKB 2F8NA 3FDDA 3A1IA 5B0ZD 1M1AA 3X1VC 3IP4C 2DF4C 5BS7C 5AV6D 5B0ZC 3W97B 2RVQD 5AV6C 1P3GA 3B6FD 2RVQC 3AZKA 3B6FC 3F6TA 3KSYA 1AOIB 5GT3A 4X23A 3B0DB 3X1UB 1P3MB 1ID3B 1S32B 3AZMA 3AZJB 3AL0C 5B24B 2BYMA 3AZIB 3X1VB 1P3LD 1A7WA 3X1UA 1P3MA 1ULYA 1P3PD 3AZEA 3AN2B 3AV1D 5GSUC 1P3LC 3AFAD 1P3PC 3W96D 2Y2IA 5G49A 3W99D 4QLCC 3AFAC 3W96C 3WAAD 3WTPE 4JJND 2ZY3A 3WAAC 3O62D 3AZHD 3X1SD 4JJNC 3O62C 2HUEC 3AZHC 3X1VA 3H0LC 3MVDB 3REID 5BS7A 5B0ZA 3C1CD 3REIC 3W98B 5AV6A 4ZUXD 3C1CC 5F99D 5B32D 1M19D 1U35D 3B6FA 5F99C 5B32C 4CSRB 4Z2MH 3AZGD 1M19C 1Q9CA 5AV9B 1ZLAC 5JRGD 2LY8A 4UUZB 1Z2CB 5JRGC 5GSUB 1B6WA 3H0MC 4QLCB 1F1EA 1H3OB 2NZDB 3AZHB 4CSRA 3EPKA 5CPKD 4H9PB 5B40B 3NQUB 4WNNB 5GSUA 1P3LA 4CAYB 1P3PA 3KWQB 3AFAA 4QLCA 5F99B 3W96A 5B32G 3WAAA 5AVCB 1ZLAB 4G92B 1H3OA 2NZDA 4JJNA 4Z66D 3O62A 3AZHA 2CWEA 4KGCB 3MGSD 4Z66C 3LELB 3REIA 4WU8D 3C1CA 3AZND 3X1TD 2Y2NA 4CAYA 4WU8C 1M18B 3AZNC 3X1TC 3A1KA 5F99A 5B32A 1M19A 5B1MB 1ZLAA 1BH9B 5B2ID 5B2IC 4KUDD 3REKB 4KUDC 5B2JD 4H9OA 2PYOD 5B2JC 4J8VB 3VH5W 2JSSA 3KUYC 4WZSB 5JA4B 1P3AD 4M6BA 4WJ3C 4YS3B 1P3AC 1JFIA 4XZQD 2YFVB 4XZQC 2ZM5A 5BT1D 1HQ3B 1F66D 4NE5A 2FJ7C 5BT1C 4Z66A 1F66C 4DQYB 5JA4A 5CP6D 4WU8A 4DRAA 5B2JB 3AZKD 5CP6C 3EPJA 3AZNA 3X1TA 4YS3A 2UWXA 2F2AC 3VH6W 3KUYB 2XD1A 5B2IA 3W97D 4KUDA 2BYKB 3AV2B 1BFMA 3W97C 5B2JA 5BNXB 1AOID 2FJ7B 2FFFB 5DNMB 1F66B 3KUYA 1AOIC 1HTAA 5BNVB 1P3MD 3B0DC 1ID3D 1S32D 3REHD 1ID3C 1S32C 3AZJD 1P3AA 3REHC 1KX5B 3AZJC 5BNXA 4XZQA 5B24D 3LZ0C 3AZID 5CPIB 5B24C 3AZIC 3X1VD 2FJ7A 1F66A 5BNVA 3AN2D 2F8NH 3AN2C 5CP6A 5B31B 3VH5T 3AYWD 3WKJB 3NQJB 3AYWC 3MVDD 2CV5B 3R45B 3MVDC 3W98D 5DNNB 3REHB 3W97A 3W98C 3LZ0B 5AV5B 2Y2OA 4KHAB 5AV9D 1BH8B 1TZYC 1AOIA 5AV9C 5GSUD 3R45A 1ID3A 1S32A 5DNNA 4QLCD 3REHA 2AROC 5AVBB 3AZJA 3LZ0A 2NZDD 3B0BA 1TAFB 3AYWB 5B24A 4R8PD 4KHAA 3AZIA 3EPHA 3UTAB 3VH6T 1BH8A 2NZDC 4R8PC 3A6ND 5B40D 3A6NC 5BO0B 5B40C 3AN2A 3KWQD 3KWQC 5AVCD 1ZLAD 1TZYB 2F8NK 1KX4B 4KGCD 5AVCC 2HIOB 4G92C 3AYWA 3MGQB 4KGCC 3LELD 3MVDA 1KU5A 3LELC 2AROB 3W98A 5AY8B 1M18D 4NE6A 3TU4C 1M18C 5B1MD 1TZYA 4R8PB 5B1MC 5AV9A 1P3IB 4UUZA 3A6NB 3REKD 3B6GB 3WA9B 3REKC 2AROA 2G5HC 2NQBB 4J8VD 5B33C 3AZLC 4J8VC 5AV8B 4R8PA 3UT9B 1P3IA 3A6NA 4H9PA 3LZ1B 1PZRA 5B40A 3NQUA 4WNNA 1KX3B 3MGPC 3TU4B 4WU9D 4YS3D 4UPKA 3KWQA 4YS3C 2JE5A 1HQ3D 5AVCA 4KGCA 1HQ3C 1P3OC 3RELD 3LELA 1P34B 3RELC 3MNNB 5B33B 3AZLB 5B0YD 3TU4A 1M18A 5B0YC 5GT0B 3KUYD 5B1MA 1BH9A 3LJAB 2Y2QA 3MGPB 3AV2D 3REKA 5KDMB 1W2EA 3MNNA 3AV2C 5B33A 3AZLA 2IO5B 4J8VA 2FJ7D 5DNMD 1P3OB 5B1LC 5DNMC 3RELB 4H9QB 3MGPA 4J8WB 1KX5D 4LD9B 5B0YB 2Y2MA 1KX5C 5CPID 4HGAB 2YFVA 3KXBB 1B67A 5CPIC 1HQ3A 1P3OA 2Y2LA 3REJD 3REJC 3RELA 4J8UB 2J8PA 5B31D 5B0YA 4G91B 3V9RB 5B31C 3MGRB 3AZFB 3WKJD 5B1LB 3WKJC 2CV5D 4Z5TB 5GXQC 4XUJC 2CV5C 5DNND 3WTPB 1T3UA 2BYKA 5DNNC 4J8XB 3LZ0D 3C1BD 4J8UA 3AV2A 5AV5D 3EPLA 3C1BC 3V9RA 5AV5C 4WU9C 5B1LA 5DNMA 1P3FB 3REJB 4AWLB 1P3KB 5AVBD 4J8XA 2F8NB 1KX5A 5AVBC 5B31G 5CPIA 3UTAD 1M1AB 5GXQB 4XUJB 3UTAC 2Y2PA 3REJA 2XD5A 1R4VA 4NFTA 2BG1A 3C1BB 1TZYD 5B31A 4WU9B 1KX4D 5GT3B 4X23B 2HIOD 3WKJA 3NQJA 3MGQD 1KX4C 2Y2JA 2HIOC 4H9SC 5GXQA 3MGQC 4XUJA 3AZMB 2CV5A 2AROD 5AY8D 5AY8C 2BYMB 3C1BA 5AV5A 4WU9A 5E5AB 1P3ID 1EQZB 4ZBJC 1P3BD 3AZEB 1P3IC 3B6GD 1P3BC 3WA9D 3B6GC 2NQBD 5G49B 3WA9C 3H0RC 1WWSA 5AVBA 2NQBC 5AV8D 1TAFA 5AV8C 5E5AA 3UT9D 5B0ZB 3UTAA 4Z2MG 1EQZA 3UT9C 4EO5C 5AV6B 3LZ1D 1KX3D 3TU4D 4H9RB 5BO0A 3LZ1C 3AV1C 1KX3C 3B6FB 4H9NB 3W99C 1KX4A 4ZBJB 2HIOA 2ZY4A 4H9SA 3VH5A 3MGQA 3X1SC 1WWIA 1P3BB 1P34D 3MNND 5B33D 1P34C 3AZLD 4H9RA 3MNNC 2W8SA 5AY8A 4H9NA 4ZUXC 5GT0D 1U35C 3AZGC 5GT0C 3LJAD 4EO5B 1P3LB 1P3BA 3MGPD 3LJAC 1P3PB 3AV1B 3B6GA 3AFAB 3WA9A 3W96B 4YM6D 2NQBA 3W99B 3WAAB 2JCHA 4YM6C 2IO5C 3O62B 2HUEB 5FUGB 3X1SB 4JJNB 1P3OD 3EG5B 2ZY5A 5AV8A 3REIB 3UT9A 5CPKC 3VH6A 3C1CB 4J8WD 3LZ1A 3KFUG 3AV1A 1KX3A 4ZUXB 4J8WC 4LD9D 1M19B 5B32B 1U35B 4LD9C 3W99A 3AZGB 2Y2GA 3KXBD 4HGAC 5FUGA 3B0CW 3X1SA 5JRGB 3KXBC 2G5IC 5CPJD 3MGSC 1N1JB 4H9OB 1P34A 3UTBD 5CPJC 4J8UD 3UTBC 4ZUXA 4J8UC 4YM6B 1U35A 3MGRD 3AZFD 4G91C 5B1LD 3AZGA 5GT0A 3MGRC 3AZFC 4Z5TD 5CPKB 5JRGA 3LJAA 4Z5TC 3WTPD 2L5AA 1N1JA 3WTPC 4J8XD 1JFIB 2Y2HA 5KDMA 4J8XC 2PYOC 4YM6A 4E45A 4Z66B 1P3FD 4NE3A 2YFWB 3MGSB 2RIQA 5CPKA 1P3FC 4WU8B 5CPJB 4AWLC 1P3KD 3UTBB 4H9QA 4J8WA 3AZNB 3X1TB 3P5JB 1P3KC 2F8ND 4LD9A 4E44A 2DQNC 1M1AD 5B2IB 5GXQD 3KXBA 4XUJD 1M1AC 4KUDB 2YFWA 3MGSA 1P3GD 5CPJA 5C3IC 1P3GC 2VQRA 3UTBA 2PYOB 3AZKC 2Y2KA 5GT3D 4X23D
chains in the Genus database with same CATH topology
3MGRA 3AZFA 5GT3C 4X23C 3AZMD 4Z5TA 5CHLB 3AZMC 1P3AB 3WTPA 4DRBA 4XZQB 4WV4B 2PYOA 2F8NG 5E5AD 2ZY2A 3X1UD 1EQZD 5E5AC 3B0CT 3AZED 1P3FA 3X1UC 1EQZC 5C3IB 1P3MC 1P3GB 3AZEC 5CP6B 1P3KA 3AZKB 2F8NA 3FDDA 3A1IA 5B0ZD 1M1AA 3X1VC 3IP4C 2DF4C 5BS7C 5AV6D 5B0ZC 3W97B 2RVQD 5AV6C 1P3GA 3B6FD 2RVQC 3AZKA 3B6FC 3F6TA 3KSYA 1AOIB 5GT3A 4X23A 3B0DB 3X1UB 1P3MB 1ID3B 1S32B 3AZMA 3AZJB 3AL0C 5B24B 2BYMA 3AZIB 3X1VB 1P3LD 1A7WA 3X1UA 1P3MA 1ULYA 1P3PD 3AZEA 3AN2B 3AV1D 5GSUC 1P3LC 3AFAD 1P3PC 3W96D 2Y2IA 5G49A 3W99D 4QLCC 3AFAC 3W96C 3WAAD 3WTPE 4JJND 2ZY3A 3WAAC 3O62D 3AZHD 3X1SD 4JJNC 3O62C 2HUEC 3AZHC 3X1VA 3H0LC 3MVDB 3REID 5BS7A 5B0ZA 3C1CD 3REIC 3W98B 5AV6A 4ZUXD 3C1CC 5F99D 5B32D 1M19D 1U35D 3B6FA 5F99C 5B32C 4CSRB 4Z2MH 3AZGD 1M19C 1Q9CA 5AV9B 1ZLAC 5JRGD 2LY8A 4UUZB 1Z2CB 5JRGC 5GSUB 1B6WA 3H0MC 4QLCB 1F1EA 1H3OB 2NZDB 3AZHB 4CSRA 3EPKA 5CPKD 4H9PB 5B40B 3NQUB 4WNNB 5GSUA 1P3LA 4CAYB 1P3PA 3KWQB 3AFAA 4QLCA 5F99B 3W96A 5B32G 3WAAA 5AVCB 1ZLAB 4G92B 1H3OA 2NZDA 4JJNA 4Z66D 3O62A 3AZHA 2CWEA 4KGCB 3MGSD 4Z66C 3LELB 3REIA 4WU8D 3C1CA 3AZND 3X1TD 2Y2NA 4CAYA 4WU8C 1M18B 3AZNC 3X1TC 3A1KA 5F99A 5B32A 1M19A 5B1MB 1ZLAA 1BH9B 5B2ID 5B2IC 4KUDD 3REKB 4KUDC 5B2JD 4H9OA 2PYOD 5B2JC 4J8VB 3VH5W 2JSSA 3KUYC 4WZSB 5JA4B 1P3AD 4M6BA 4WJ3C 4YS3B 1P3AC 1JFIA 4XZQD 2YFVB 4XZQC 2ZM5A 5BT1D 1HQ3B 1F66D 4NE5A 2FJ7C 5BT1C 4Z66A 1F66C 4DQYB 5JA4A 5CP6D 4WU8A 4DRAA 5B2JB 3AZKD 5CP6C 3EPJA 3AZNA 3X1TA 4YS3A 2UWXA 2F2AC 3VH6W 3KUYB 2XD1A 5B2IA 3W97D 4KUDA 2BYKB 3AV2B 1BFMA 3W97C 5B2JA 5BNXB 1AOID 2FJ7B 2FFFB 5DNMB 1F66B 3KUYA 1AOIC 1HTAA 5BNVB 1P3MD 3B0DC 1ID3D 1S32D 3REHD 1ID3C 1S32C 3AZJD 1P3AA 3REHC 1KX5B 3AZJC 5BNXA 4XZQA 5B24D 3LZ0C 3AZID 5CPIB 5B24C 3AZIC 3X1VD 2FJ7A 1F66A 5BNVA 3AN2D 2F8NH 3AN2C 5CP6A 5B31B 3VH5T 3AYWD 3WKJB 3NQJB 3AYWC 3MVDD 2CV5B 3R45B 3MVDC 3W98D 5DNNB 3REHB 3W97A 3W98C 3LZ0B 5AV5B 2Y2OA 4KHAB 5AV9D 1BH8B 1TZYC 1AOIA 5AV9C 5GSUD 3R45A 1ID3A 1S32A 5DNNA 4QLCD 3REHA 2AROC 5AVBB 3AZJA 3LZ0A 2NZDD 3B0BA 1TAFB 3AYWB 5B24A 4R8PD 4KHAA 3AZIA 3EPHA 3UTAB 3VH6T 1BH8A 2NZDC 4R8PC 3A6ND 5B40D 3A6NC 5BO0B 5B40C 3AN2A 3KWQD 3KWQC 5AVCD 1ZLAD 1TZYB 2F8NK 1KX4B 4KGCD 5AVCC 2HIOB 4G92C 3AYWA 3MGQB 4KGCC 3LELD 3MVDA 1KU5A 3LELC 2AROB 3W98A 5AY8B 1M18D 4NE6A 3TU4C 1M18C 5B1MD 1TZYA 4R8PB 5B1MC 5AV9A 1P3IB 4UUZA 3A6NB 3REKD 3B6GB 3WA9B 3REKC 2AROA 2G5HC 2NQBB 4J8VD 5B33C 3AZLC 4J8VC 5AV8B 4R8PA 3UT9B 1P3IA 3A6NA 4H9PA 3LZ1B 1PZRA 5B40A 3NQUA 4WNNA 1KX3B 3MGPC 3TU4B 4WU9D 4YS3D 4UPKA 3KWQA 4YS3C 2JE5A 1HQ3D 5AVCA 4KGCA 1HQ3C 1P3OC 3RELD 3LELA 1P34B 3RELC 3MNNB 5B33B 3AZLB 5B0YD 3TU4A 1M18A 5B0YC 5GT0B 3KUYD 5B1MA 1BH9A 3LJAB 2Y2QA 3MGPB 3AV2D 3REKA 5KDMB 1W2EA 3MNNA 3AV2C 5B33A 3AZLA 2IO5B 4J8VA 2FJ7D 5DNMD 1P3OB 5B1LC 5DNMC 3RELB 4H9QB 3MGPA 4J8WB 1KX5D 4LD9B 5B0YB 2Y2MA 1KX5C 5CPID 4HGAB 2YFVA 3KXBB 1B67A 5CPIC 1HQ3A 1P3OA 2Y2LA 3REJD 3REJC 3RELA 4J8UB 2J8PA 5B31D 5B0YA 4G91B 3V9RB 5B31C 3MGRB 3AZFB 3WKJD 5B1LB 3WKJC 2CV5D 4Z5TB 5GXQC 4XUJC 2CV5C 5DNND 3WTPB 1T3UA 2BYKA 5DNNC 4J8XB 3LZ0D 3C1BD 4J8UA 3AV2A 5AV5D 3EPLA 3C1BC 3V9RA 5AV5C 4WU9C 5B1LA 5DNMA 1P3FB 3REJB 4AWLB 1P3KB 5AVBD 4J8XA 2F8NB 1KX5A 5AVBC 5B31G 5CPIA 3UTAD 1M1AB 5GXQB 4XUJB 3UTAC 2Y2PA 3REJA 2XD5A 1R4VA 4NFTA 2BG1A 3C1BB 1TZYD 5B31A 4WU9B 1KX4D 5GT3B 4X23B 2HIOD 3WKJA 3NQJA 3MGQD 1KX4C 2Y2JA 2HIOC 4H9SC 5GXQA 3MGQC 4XUJA 3AZMB 2CV5A 2AROD 5AY8D 5AY8C 2BYMB 3C1BA 5AV5A 4WU9A 5E5AB 1P3ID 1EQZB 4ZBJC 1P3BD 3AZEB 1P3IC 3B6GD 1P3BC 3WA9D 3B6GC 2NQBD 5G49B 3WA9C 3H0RC 1WWSA 5AVBA 2NQBC 5AV8D 1TAFA 5AV8C 5E5AA 3UT9D 5B0ZB 3UTAA 4Z2MG 1EQZA 3UT9C 4EO5C 5AV6B 3LZ1D 1KX3D 3TU4D 4H9RB 5BO0A 3LZ1C 3AV1C 1KX3C 3B6FB 4H9NB 3W99C 1KX4A 4ZBJB 2HIOA 2ZY4A 4H9SA 3VH5A 3MGQA 3X1SC 1WWIA 1P3BB 1P34D 3MNND 5B33D 1P34C 3AZLD 4H9RA 3MNNC 2W8SA 5AY8A 4H9NA 4ZUXC 5GT0D 1U35C 3AZGC 5GT0C 3LJAD 4EO5B 1P3LB 1P3BA 3MGPD 3LJAC 1P3PB 3AV1B 3B6GA 3AFAB 3WA9A 3W96B 4YM6D 2NQBA 3W99B 3WAAB 2JCHA 4YM6C 2IO5C 3O62B 2HUEB 5FUGB 3X1SB 4JJNB 1P3OD 3EG5B 2ZY5A 5AV8A 3REIB 3UT9A 5CPKC 3VH6A 3C1CB 4J8WD 3LZ1A 3KFUG 3AV1A 1KX3A 4ZUXB 4J8WC 4LD9D 1M19B 5B32B 1U35B 4LD9C 3W99A 3AZGB 2Y2GA 3KXBD 4HGAC 5FUGA 3B0CW 3X1SA 5JRGB 3KXBC 2G5IC 5CPJD 3MGSC 1N1JB 4H9OB 1P34A 3UTBD 5CPJC 4J8UD 3UTBC 4ZUXA 4J8UC 4YM6B 1U35A 3MGRD 3AZFD 4G91C 5B1LD 3AZGA 5GT0A 3MGRC 3AZFC 4Z5TD 5CPKB 5JRGA 3LJAA 4Z5TC 3WTPD 2L5AA 1N1JA 3WTPC 4J8XD 1JFIB 2Y2HA 5KDMA 4J8XC 2PYOC 4YM6A 4E45A 4Z66B 1P3FD 4NE3A 2YFWB 3MGSB 2RIQA 5CPKA 1P3FC 4WU8B 5CPJB 4AWLC 1P3KD 3UTBB 4H9QA 4J8WA 3AZNB 3X1TB 3P5JB 1P3KC 2F8ND 4LD9A 4E44A 2DQNC 1M1AD 5B2IB 5GXQD 3KXBA 4XUJD 1M1AC 4KUDB 2YFWA 3MGSA 1P3GD 5CPJA 5C3IC 1P3GC 2VQRA 3UTBA 2PYOB 3AZKC 2Y2KA 5GT3D 4X23D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR A;  3AZF A;  5GT3 C;  4X23 C;  3AZM D;  4Z5T A;  5CHL B;  3AZM C;  1P3A B;  3WTP A;  4DRB A;  4XZQ B;  4WV4 B;  2PYO A;  2F8N G;  5E5A D;  3X1U D;  1EQZ D;  5E5A C;  3B0C T;  3AZE D;  1P3F A;  3X1U C;  1EQZ C;  5C3I B;  1P3M C;  1P3G B;  3AZE C;  5CP6 B;  1P3K A;  3AZK B;  2F8N A;  5B0Z D;  1M1A A;  3X1V C;  5BS7 C;  5AV6 D;  5B0Z C;  3W97 B;  2RVQ D;  5AV6 C;  1P3G A;  3B6F D;  2RVQ C;  3AZK A;  3B6F C;  3KSY A;  1AOI B;  5GT3 A;  4X23 A;  3B0D B;  3X1U B;  1P3M B;  1ID3 B;  1S32 B;  3AZM A;  3AZJ B;  5B24 B;  2BYM A;  3AZI B;  3X1V B;  1P3L D;  1A7W A;  3X1U A;  1P3M A;  1ULY A;  1P3P D;  3AZE A;  3AN2 B;  3AV1 D;  5GSU C;  1P3L C;  3AFA D;  1P3P C;  3W96 D;  5G49 A;  3W99 D;  4QLC C;  3AFA C;  3W96 C;  3WAA D;  3WTP E;  4JJN D;  3WAA C;  3O62 D;  3AZH D;  3X1S D;  4JJN C;  3O62 C;  2HUE C;  3AZH C;  3X1V A;  3MVD B;  3REI D;  5BS7 A;  5B0Z A;  3C1C D;  3REI C;  3W98 B;  5AV6 A;  4ZUX D;  3C1C C;  5F99 D;  5B32 D;  1M19 D;  1U35 D;  3B6F A;  5F99 C;  5B32 C;  4CSR B;  4Z2M H;  3AZG D;  1M19 C;  1Q9C A;  5AV9 B;  1ZLA C;  5JRG D;  2LY8 A;  4UUZ B;  5JRG C;  5GSU B;  1B6W A;  4QLC B;  1F1E A;  1H3O B;  2NZD B;  3AZH B;  4CSR A;  5CPK D;  4H9P B;  5B40 B;  3NQU B;  4WNN B;  5GSU A;  1P3L A;  4CAY B;  1P3P A;  3KWQ B;  3AFA A;  4QLC A;  5F99 B;  3W96 A;  5B32 G;  3WAA A;  5AVC B;  1ZLA B;  4G92 B;  1H3O A;  2NZD A;  4JJN A;  4Z66 D;  3O62 A;  3AZH A;  2CWE A;  4KGC B;  3MGS D;  4Z66 C;  3LEL B;  3REI A;  4WU8 D;  3C1C A;  3AZN D;  3X1T D;  4CAY A;  4WU8 C;  1M18 B;  3AZN C;  3X1T C;  5F99 A;  5B32 A;  1M19 A;  5B1M B;  1ZLA A;  1BH9 B;  5B2I D;  5B2I C;  4KUD D;  3REK B;  4KUD C;  5B2J D;  4H9O A;  2PYO D;  5B2J C;  4J8V B;  3VH5 W;  2JSS A;  3KUY C;  4WZS B;  5JA4 B;  1P3A D;  4M6B A;  4YS3 B;  1P3A C;  1JFI A;  4XZQ D;  2YFV B;  4XZQ C;  5BT1 D;  1HQ3 B;  1F66 D;  4NE5 A;  2FJ7 C;  5BT1 C;  4Z66 A;  1F66 C;  5JA4 A;  5CP6 D;  4WU8 A;  4DRA A;  5B2J B;  3AZK D;  5CP6 C;  3AZN A;  3X1T A;  4YS3 A;  3VH6 W;  3KUY B;  5B2I A;  3W97 D;  4KUD A;  2BYK B;  3AV2 B;  1BFM A;  3W97 C;  5B2J A;  5BNX B;  1AOI D;  2FJ7 B;  5DNM B;  1F66 B;  3KUY A;  1AOI C;  1HTA A;  5BNV B;  1P3M D;  3B0D C;  1ID3 D;  1S32 D;  3REH D;  1ID3 C;  1S32 C;  3AZJ D;  1P3A A;  3REH C;  1KX5 B;  3AZJ C;  5BNX A;  4XZQ A;  5B24 D;  3LZ0 C;  3AZI D;  5CPI B;  5B24 C;  3AZI C;  3X1V D;  2FJ7 A;  1F66 A;  5BNV A;  3AN2 D;  2F8N H;  3AN2 C;  5CP6 A;  5B31 B;  3VH5 T;  3AYW D;  3WKJ B;  3NQJ B;  3AYW C;  3MVD D;  2CV5 B;  3R45 B;  3MVD C;  3W98 D;  5DNN B;  3REH B;  3W97 A;  3W98 C;  3LZ0 B;  5AV5 B;  4KHA B;  5AV9 D;  1BH8 B;  1TZY C;  1AOI A;  5AV9 C;  5GSU D;  3R45 A;  1ID3 A;  1S32 A;  5DNN A;  4QLC D;  3REH A;  2ARO C;  5AVB B;  3AZJ A;  3LZ0 A;  2NZD D;  3B0B A;  1TAF B;  3AYW B;  5B24 A;  4R8P D;  4KHA A;  3AZI A;  2NZD C;  3UTA B;  3VH6 T;  1BH8 A;  4R8P C;  3A6N D;  5B40 D;  3A6N C;  5BO0 B;  5B40 C;  3AN2 A;  3KWQ D;  3KWQ C;  5AVC D;  1ZLA D;  1TZY B;  2F8N K;  1KX4 B;  4KGC D;  5AVC C;  2HIO B;  4G92 C;  3AYW A;  3MGQ B;  4KGC C;  3LEL D;  3MVD A;  1KU5 A;  3LEL C;  2ARO B;  3W98 A;  5AY8 B;  1M18 D;  4NE6 A;  3TU4 C;  1M18 C;  5B1M D;  1TZY A;  4R8P B;  5B1M C;  5AV9 A;  1P3I B;  4UUZ A;  3A6N B;  3REK D;  3B6G B;  3WA9 B;  3REK C;  2ARO A;  2NQB B;  4J8V D;  5B33 C;  3AZL C;  4J8V C;  5AV8 B;  4R8P A;  3UT9 B;  1P3I A;  3A6N A;  4H9P A;  3LZ1 B;  5B40 A;  3NQU A;  4WNN A;  1KX3 B;  3MGP C;  3TU4 B;  4YS3 D;  3KWQ A;  4YS3 C;  1HQ3 D;  5AVC A;  4KGC A;  1HQ3 C;  1P3O C;  3REL D;  3LEL A;  1P34 B;  3REL C;  3MNN B;  5B33 B;  3AZL B;  5B0Y D;  3TU4 A;  1M18 A;  5B0Y C;  5GT0 B;  3KUY D;  5B1M A;  1BH9 A;  3LJA B;  3MGP B;  3AV2 D;  3REK A;  5KDM B;  3MNN A;  3AV2 C;  5B33 A;  3AZL A;  2IO5 B;  4J8V A;  2FJ7 D;  5DNM D;  1P3O B;  5B1L C;  5DNM C;  3REL B;  4H9Q B;  3MGP A;  4J8W B;  1KX5 D;  4LD9 B;  5B0Y B;  1KX5 C;  5CPI D;  4HGA B;  2YFV A;  3KXB B;  1B67 A;  5CPI C;  1HQ3 A;  1P3O A;  3REJ D;  3REJ C;  3REL A;  4J8U B;  5B31 D;  5B0Y A;  4G91 B;  3V9R B;  5B31 C;  3MGR B;  3AZF B;  3WKJ D;  5B1L B;  3WKJ C;  2CV5 D;  4Z5T B;  5GXQ C;  4XUJ C;  2CV5 C;  5DNN D;  3WTP B;  2BYK A;  5DNN C;  4J8X B;  3AV2 A;  3LZ0 D;  3C1B D;  4J8U A;  5AV5 D;  3C1B C;  3V9R A;  5AV5 C;  4WU9 C;  5B1L A;  5DNM A;  1P3F B;  3REJ B;  4AWL B;  1P3K B;  5AVB D;  4J8X A;  2F8N B;  1KX5 A;  5AVB C;  5B31 G;  5CPI A;  3UTA D;  1M1A B;  5GXQ B;  4XUJ B;  3UTA C;  3REJ A;  1R4V A;  4NFT A;  3C1B B;  1TZY D;  5B31 A;  4WU9 B;  1KX4 D;  5GT3 B;  4X23 B;  2HIO D;  3WKJ A;  3NQJ A;  3MGQ D;  1KX4 C;  2HIO C;  4H9S C;  5GXQ A;  3MGQ C;  4XUJ A;  3AZM B;  2CV5 A;  2ARO D;  5AY8 D;  5AY8 C;  2BYM B;  3C1B A;  5AV5 A;  4WU9 A;  5E5A B;  1P3I D;  1EQZ B;  4ZBJ C;  1P3B D;  3AZE B;  1P3I C;  3B6G D;  1P3B C;  3WA9 D;  3B6G C;  2NQB D;  5G49 B;  3WA9 C;  1WWS A;  5AVB A;  2NQB C;  5AV8 D;  1TAF A;  5AV8 C;  5E5A A;  3UT9 D;  5B0Z B;  3UTA A;  4Z2M G;  1EQZ A;  3UT9 C;  4EO5 C;  5AV6 B;  3LZ1 D;  1KX3 D;  3TU4 D;  4H9R B;  5BO0 A;  3LZ1 C;  3AV1 C;  1KX3 C;  3B6F B;  4H9N B;  3W99 C;  1KX4 A;  4ZBJ B;  2HIO A;  4H9S A;  3VH5 A;  3MGQ A;  3X1S C;  1WWI A;  1P3B B;  1P34 D;  3MNN D;  5B33 D;  1P34 C;  3AZL D;  4H9R A;  3MNN C;  5AY8 A;  4H9N A;  4ZUX C;  5GT0 D;  1U35 C;  3AZG C;  5GT0 C;  3LJA D;  4EO5 B;  1P3L B;  1P3B A;  3MGP D;  3LJA C;  1P3P B;  3AV1 B;  3B6G A;  3AFA B;  3WA9 A;  3W96 B;  4YM6 D;  2NQB A;  3W99 B;  3WAA B;  4JJN B;  4YM6 C;  2IO5 C;  3O62 B;  2HUE B;  5FUG B;  3X1S B;  1P3O D;  5AV8 A;  3REI B;  3UT9 A;  5CPK C;  3VH6 A;  3C1C B;  4J8W D;  3LZ1 A;  3AV1 A;  1KX3 A;  4ZUX B;  4J8W C;  4LD9 D;  1M19 B;  5B32 B;  1U35 B;  4LD9 C;  3W99 A;  3AZG B;  3KXB D;  4HGA C;  5FUG A;  3B0C W;  3X1S A;  5JRG B;  3KXB C;  5CPJ D;  3MGS C;  1N1J B;  4H9O B;  1P34 A;  3UTB D;  5CPJ C;  4J8U D;  3UTB C;  4ZUX A;  4J8U C;  4YM6 B;  1U35 A;  3MGR D;  3AZF D;  4G91 C;  5B1L D;  3AZG A;  5GT0 A;  3MGR C;  3AZF C;  4Z5T D;  5CPK B;  5JRG A;  3LJA A;  4Z5T C;  3WTP D;  2L5A A;  1N1J A;  3WTP C;  4J8X D;  1JFI B;  5KDM A;  4J8X C;  2PYO C;  4YM6 A;  4E45 A;  4Z66 B;  1P3F D;  4NE3 A;  2YFW B;  3MGS B;  5CPK A;  1P3F C;  4WU8 B;  5CPJ B;  4AWL C;  1P3K D;  3UTB B;  4H9Q A;  4J8W A;  3AZN B;  3X1T B;  1P3K C;  2F8N D;  4LD9 A;  4E44 A;  1M1A D;  5B2I B;  5GXQ D;  3KXB A;  4XUJ D;  1M1A C;  4KUD B;  2YFW A;  3MGS A;  1P3G D;  5CPJ A;  5C3I C;  1P3G C;  3UTB A;  2PYO B;  3AZK C;  4WU9 D;  5GT3 D;  4X23 D; 
#chains in the Genus database with same CATH topology
 3MGR A;  3AZF A;  5GT3 C;  4X23 C;  3AZM D;  4Z5T A;  5CHL B;  3AZM C;  1P3A B;  3WTP A;  4DRB A;  4XZQ B;  4WV4 B;  2PYO A;  2F8N G;  5E5A D;  2ZY2 A;  3X1U D;  1EQZ D;  5E5A C;  3B0C T;  3AZE D;  1P3F A;  3X1U C;  1EQZ C;  5C3I B;  1P3M C;  1P3G B;  3AZE C;  5CP6 B;  1P3K A;  3AZK B;  2F8N A;  3FDD A;  3A1I A;  5B0Z D;  1M1A A;  3X1V C;  3IP4 C;  2DF4 C;  5BS7 C;  5AV6 D;  5B0Z C;  3W97 B;  2RVQ D;  5AV6 C;  1P3G A;  3B6F D;  2RVQ C;  3AZK A;  3B6F C;  3F6T A;  3KSY A;  1AOI B;  5GT3 A;  4X23 A;  3B0D B;  3X1U B;  1P3M B;  1ID3 B;  1S32 B;  3AZM A;  3AZJ B;  3AL0 C;  5B24 B;  2BYM A;  3AZI B;  3X1V B;  1P3L D;  1A7W A;  3X1U A;  1P3M A;  1ULY A;  1P3P D;  3AZE A;  3AN2 B;  3AV1 D;  5GSU C;  1P3L C;  3AFA D;  1P3P C;  3W96 D;  2Y2I A;  5G49 A;  3W99 D;  4QLC C;  3AFA C;  3W96 C;  3WAA D;  3WTP E;  4JJN D;  2ZY3 A;  3WAA C;  3O62 D;  3AZH D;  3X1S D;  4JJN C;  3O62 C;  2HUE C;  3AZH C;  3X1V A;  3H0L C;  3MVD B;  3REI D;  5BS7 A;  5B0Z A;  3C1C D;  3REI C;  3W98 B;  5AV6 A;  4ZUX D;  3C1C C;  5F99 D;  5B32 D;  1M19 D;  1U35 D;  3B6F A;  5F99 C;  5B32 C;  4CSR B;  4Z2M H;  3AZG D;  1M19 C;  1Q9C A;  5AV9 B;  1ZLA C;  5JRG D;  2LY8 A;  4UUZ B;  1Z2C B;  5JRG C;  5GSU B;  1B6W A;  3H0M C;  4QLC B;  1F1E A;  1H3O B;  2NZD B;  3AZH B;  4CSR A;  3EPK A;  5CPK D;  4H9P B;  5B40 B;  3NQU B;  4WNN B;  5GSU A;  1P3L A;  4CAY B;  1P3P A;  3KWQ B;  3AFA A;  4QLC A;  5F99 B;  3W96 A;  5B32 G;  3WAA A;  5AVC B;  1ZLA B;  4G92 B;  1H3O A;  2NZD A;  4JJN A;  4Z66 D;  3O62 A;  3AZH A;  2CWE A;  4KGC B;  3MGS D;  4Z66 C;  3LEL B;  3REI A;  4WU8 D;  3C1C A;  3AZN D;  3X1T D;  2Y2N A;  4CAY A;  4WU8 C;  1M18 B;  3AZN C;  3X1T C;  3A1K A;  5F99 A;  5B32 A;  1M19 A;  5B1M B;  1ZLA A;  1BH9 B;  5B2I D;  5B2I C;  4KUD D;  3REK B;  4KUD C;  5B2J D;  4H9O A;  2PYO D;  5B2J C;  4J8V B;  3VH5 W;  2JSS A;  3KUY C;  4WZS B;  5JA4 B;  1P3A D;  4M6B A;  4WJ3 C;  4YS3 B;  1P3A C;  1JFI A;  4XZQ D;  2YFV B;  4XZQ C;  2ZM5 A;  5BT1 D;  1HQ3 B;  1F66 D;  4NE5 A;  2FJ7 C;  5BT1 C;  4Z66 A;  1F66 C;  4DQY B;  5JA4 A;  5CP6 D;  4WU8 A;  4DRA A;  5B2J B;  3AZK D;  5CP6 C;  3EPJ A;  3AZN A;  3X1T A;  4YS3 A;  2UWX A;  2F2A C;  3VH6 W;  3KUY B;  2XD1 A;  5B2I A;  3W97 D;  4KUD A;  2BYK B;  3AV2 B;  1BFM A;  3W97 C;  5B2J A;  5BNX B;  1AOI D;  2FJ7 B;  2FFF B;  5DNM B;  1F66 B;  3KUY A;  1AOI C;  1HTA A;  5BNV B;  1P3M D;  3B0D C;  1ID3 D;  1S32 D;  3REH D;  1ID3 C;  1S32 C;  3AZJ D;  1P3A A;  3REH C;  1KX5 B;  3AZJ C;  5BNX A;  4XZQ A;  5B24 D;  3LZ0 C;  3AZI D;  5CPI B;  5B24 C;  3AZI C;  3X1V D;  2FJ7 A;  1F66 A;  5BNV A;  3AN2 D;  2F8N H;  3AN2 C;  5CP6 A;  5B31 B;  3VH5 T;  3AYW D;  3WKJ B;  3NQJ B;  3AYW C;  3MVD D;  2CV5 B;  3R45 B;  3MVD C;  3W98 D;  5DNN B;  3REH B;  3W97 A;  3W98 C;  3LZ0 B;  5AV5 B;  2Y2O A;  4KHA B;  5AV9 D;  1BH8 B;  1TZY C;  1AOI A;  5AV9 C;  5GSU D;  3R45 A;  1ID3 A;  1S32 A;  5DNN A;  4QLC D;  3REH A;  2ARO C;  5AVB B;  3AZJ A;  3LZ0 A;  2NZD D;  3B0B A;  1TAF B;  3AYW B;  5B24 A;  4R8P D;  4KHA A;  3AZI A;  3EPH A;  3UTA B;  3VH6 T;  1BH8 A;  2NZD C;  4R8P C;  3A6N D;  5B40 D;  3A6N C;  5BO0 B;  5B40 C;  3AN2 A;  3KWQ D;  3KWQ C;  5AVC D;  1ZLA D;  1TZY B;  2F8N K;  1KX4 B;  4KGC D;  5AVC C;  2HIO B;  4G92 C;  3AYW A;  3MGQ B;  4KGC C;  3LEL D;  3MVD A;  1KU5 A;  3LEL C;  2ARO B;  3W98 A;  5AY8 B;  1M18 D;  4NE6 A;  3TU4 C;  1M18 C;  5B1M D;  1TZY A;  4R8P B;  5B1M C;  5AV9 A;  1P3I B;  4UUZ A;  3A6N B;  3REK D;  3B6G B;  3WA9 B;  3REK C;  2ARO A;  2G5H C;  2NQB B;  4J8V D;  5B33 C;  3AZL C;  4J8V C;  5AV8 B;  4R8P A;  3UT9 B;  1P3I A;  3A6N A;  4H9P A;  3LZ1 B;  1PZR A;  5B40 A;  3NQU A;  4WNN A;  1KX3 B;  3MGP C;  3TU4 B;  4WU9 D;  4YS3 D;  4UPK A;  3KWQ A;  4YS3 C;  2JE5 A;  1HQ3 D;  5AVC A;  4KGC A;  1HQ3 C;  1P3O C;  3REL D;  3LEL A;  1P34 B;  3REL C;  3MNN B;  5B33 B;  3AZL B;  5B0Y D;  3TU4 A;  1M18 A;  5B0Y C;  5GT0 B;  3KUY D;  5B1M A;  1BH9 A;  3LJA B;  2Y2Q A;  3MGP B;  3AV2 D;  3REK A;  5KDM B;  1W2E A;  3MNN A;  3AV2 C;  5B33 A;  3AZL A;  2IO5 B;  4J8V A;  2FJ7 D;  5DNM D;  1P3O B;  5B1L C;  5DNM C;  3REL B;  4H9Q B;  3MGP A;  4J8W B;  1KX5 D;  4LD9 B;  5B0Y B;  2Y2M A;  1KX5 C;  5CPI D;  4HGA B;  2YFV A;  3KXB B;  1B67 A;  5CPI C;  1HQ3 A;  1P3O A;  2Y2L A;  3REJ D;  3REJ C;  3REL A;  4J8U B;  2J8P A;  5B31 D;  5B0Y A;  4G91 B;  3V9R B;  5B31 C;  3MGR B;  3AZF B;  3WKJ D;  5B1L B;  3WKJ C;  2CV5 D;  4Z5T B;  5GXQ C;  4XUJ C;  2CV5 C;  5DNN D;  3WTP B;  1T3U A;  2BYK A;  5DNN C;  4J8X B;  3LZ0 D;  3C1B D;  4J8U A;  3AV2 A;  5AV5 D;  3EPL A;  3C1B C;  3V9R A;  5AV5 C;  4WU9 C;  5B1L A;  5DNM A;  1P3F B;  3REJ B;  4AWL B;  1P3K B;  5AVB D;  4J8X A;  2F8N B;  1KX5 A;  5AVB C;  5B31 G;  5CPI A;  3UTA D;  1M1A B;  5GXQ B;  4XUJ B;  3UTA C;  2Y2P A;  3REJ A;  2XD5 A;  1R4V A;  4NFT A;  2BG1 A;  3C1B B;  1TZY D;  5B31 A;  4WU9 B;  1KX4 D;  5GT3 B;  4X23 B;  2HIO D;  3WKJ A;  3NQJ A;  3MGQ D;  1KX4 C;  2Y2J A;  2HIO C;  4H9S C;  5GXQ A;  3MGQ C;  4XUJ A;  3AZM B;  2CV5 A;  2ARO D;  5AY8 D;  5AY8 C;  2BYM B;  3C1B A;  5AV5 A;  4WU9 A;  5E5A B;  1P3I D;  1EQZ B;  4ZBJ C;  1P3B D;  3AZE B;  1P3I C;  3B6G D;  1P3B C;  3WA9 D;  3B6G C;  2NQB D;  5G49 B;  3WA9 C;  3H0R C;  1WWS A;  5AVB A;  2NQB C;  5AV8 D;  1TAF A;  5AV8 C;  5E5A A;  3UT9 D;  5B0Z B;  3UTA A;  4Z2M G;  1EQZ A;  3UT9 C;  4EO5 C;  5AV6 B;  3LZ1 D;  1KX3 D;  3TU4 D;  4H9R B;  5BO0 A;  3LZ1 C;  3AV1 C;  1KX3 C;  3B6F B;  4H9N B;  3W99 C;  1KX4 A;  4ZBJ B;  2HIO A;  2ZY4 A;  4H9S A;  3VH5 A;  3MGQ A;  3X1S C;  1WWI A;  1P3B B;  1P34 D;  3MNN D;  5B33 D;  1P34 C;  3AZL D;  4H9R A;  3MNN C;  2W8S A;  5AY8 A;  4H9N A;  4ZUX C;  5GT0 D;  1U35 C;  3AZG C;  5GT0 C;  3LJA D;  4EO5 B;  1P3L B;  1P3B A;  3MGP D;  3LJA C;  1P3P B;  3AV1 B;  3B6G A;  3AFA B;  3WA9 A;  3W96 B;  4YM6 D;  2NQB A;  3W99 B;  3WAA B;  2JCH A;  4YM6 C;  2IO5 C;  3O62 B;  2HUE B;  5FUG B;  3X1S B;  4JJN B;  1P3O D;  3EG5 B;  2ZY5 A;  5AV8 A;  3REI B;  3UT9 A;  5CPK C;  3VH6 A;  3C1C B;  4J8W D;  3LZ1 A;  3KFU G;  3AV1 A;  1KX3 A;  4ZUX B;  4J8W C;  4LD9 D;  1M19 B;  5B32 B;  1U35 B;  4LD9 C;  3W99 A;  3AZG B;  2Y2G A;  3KXB D;  4HGA C;  5FUG A;  3B0C W;  3X1S A;  5JRG B;  3KXB C;  2G5I C;  5CPJ D;  3MGS C;  1N1J B;  4H9O B;  1P34 A;  3UTB D;  5CPJ C;  4J8U D;  3UTB C;  4ZUX A;  4J8U C;  4YM6 B;  1U35 A;  3MGR D;  3AZF D;  4G91 C;  5B1L D;  3AZG A;  5GT0 A;  3MGR C;  3AZF C;  4Z5T D;  5CPK B;  5JRG A;  3LJA A;  4Z5T C;  3WTP D;  2L5A A;  1N1J A;  3WTP C;  4J8X D;  1JFI B;  2Y2H A;  5KDM A;  4J8X C;  2PYO C;  4YM6 A;  4E45 A;  4Z66 B;  1P3F D;  4NE3 A;  2YFW B;  3MGS B;  2RIQ A;  5CPK A;  1P3F C;  4WU8 B;  5CPJ B;  4AWL C;  1P3K D;  3UTB B;  4H9Q A;  4J8W A;  3AZN B;  3X1T B;  3P5J B;  1P3K C;  2F8N D;  4LD9 A;  4E44 A;  2DQN C;  1M1A D;  5B2I B;  5GXQ D;  3KXB A;  4XUJ D;  1M1A C;  4KUD B;  2YFW A;  3MGS A;  1P3G D;  5CPJ A;  5C3I C;  1P3G C;  2VQR A;  3UTB A;  2PYO B;  3AZK C;  2Y2K A;  5GT3 D;  4X23 D; 
#chains in the Genus database with same CATH homology
 3MGR A;  3AZF A;  5GT3 C;  4X23 C;  3AZM D;  4Z5T A;  5CHL B;  3AZM C;  1P3A B;  3WTP A;  4DRB A;  4XZQ B;  4WV4 B;  2PYO A;  2F8N G;  5E5A D;  2ZY2 A;  3X1U D;  1EQZ D;  5E5A C;  3B0C T;  3AZE D;  1P3F A;  3X1U C;  1EQZ C;  5C3I B;  1P3M C;  1P3G B;  3AZE C;  5CP6 B;  1P3K A;  3AZK B;  2F8N A;  3FDD A;  3A1I A;  5B0Z D;  1M1A A;  3X1V C;  3IP4 C;  2DF4 C;  5BS7 C;  5AV6 D;  5B0Z C;  3W97 B;  2RVQ D;  5AV6 C;  1P3G A;  3B6F D;  2RVQ C;  3AZK A;  3B6F C;  3F6T A;  3KSY A;  1AOI B;  5GT3 A;  4X23 A;  3B0D B;  3X1U B;  1P3M B;  1ID3 B;  1S32 B;  3AZM A;  3AZJ B;  3AL0 C;  5B24 B;  2BYM A;  3AZI B;  3X1V B;  1P3L D;  1A7W A;  3X1U A;  1P3M A;  1ULY A;  1P3P D;  3AZE A;  3AN2 B;  3AV1 D;  5GSU C;  1P3L C;  3AFA D;  1P3P C;  3W96 D;  2Y2I A;  5G49 A;  3W99 D;  4QLC C;  3AFA C;  3W96 C;  3WAA D;  3WTP E;  4JJN D;  2ZY3 A;  3WAA C;  3O62 D;  3AZH D;  3X1S D;  4JJN C;  3O62 C;  2HUE C;  3AZH C;  3X1V A;  3H0L C;  3MVD B;  3REI D;  5BS7 A;  5B0Z A;  3C1C D;  3REI C;  3W98 B;  5AV6 A;  4ZUX D;  3C1C C;  5F99 D;  5B32 D;  1M19 D;  1U35 D;  3B6F A;  5F99 C;  5B32 C;  4CSR B;  4Z2M H;  3AZG D;  1M19 C;  1Q9C A;  5AV9 B;  1ZLA C;  5JRG D;  2LY8 A;  4UUZ B;  1Z2C B;  5JRG C;  5GSU B;  1B6W A;  3H0M C;  4QLC B;  1F1E A;  1H3O B;  2NZD B;  3AZH B;  4CSR A;  3EPK A;  5CPK D;  4H9P B;  5B40 B;  3NQU B;  4WNN B;  5GSU A;  1P3L A;  4CAY B;  1P3P A;  3KWQ B;  3AFA A;  4QLC A;  5F99 B;  3W96 A;  5B32 G;  3WAA A;  5AVC B;  1ZLA B;  4G92 B;  1H3O A;  2NZD A;  4JJN A;  4Z66 D;  3O62 A;  3AZH A;  2CWE A;  4KGC B;  3MGS D;  4Z66 C;  3LEL B;  3REI A;  4WU8 D;  3C1C A;  3AZN D;  3X1T D;  2Y2N A;  4CAY A;  4WU8 C;  1M18 B;  3AZN C;  3X1T C;  3A1K A;  5F99 A;  5B32 A;  1M19 A;  5B1M B;  1ZLA A;  1BH9 B;  5B2I D;  5B2I C;  4KUD D;  3REK B;  4KUD C;  5B2J D;  4H9O A;  2PYO D;  5B2J C;  4J8V B;  3VH5 W;  2JSS A;  3KUY C;  4WZS B;  5JA4 B;  1P3A D;  4M6B A;  4WJ3 C;  4YS3 B;  1P3A C;  1JFI A;  4XZQ D;  2YFV B;  4XZQ C;  2ZM5 A;  5BT1 D;  1HQ3 B;  1F66 D;  4NE5 A;  2FJ7 C;  5BT1 C;  4Z66 A;  1F66 C;  4DQY B;  5JA4 A;  5CP6 D;  4WU8 A;  4DRA A;  5B2J B;  3AZK D;  5CP6 C;  3EPJ A;  3AZN A;  3X1T A;  4YS3 A;  2UWX A;  2F2A C;  3VH6 W;  3KUY B;  2XD1 A;  5B2I A;  3W97 D;  4KUD A;  2BYK B;  3AV2 B;  1BFM A;  3W97 C;  5B2J A;  5BNX B;  1AOI D;  2FJ7 B;  2FFF B;  5DNM B;  1F66 B;  3KUY A;  1AOI C;  1HTA A;  5BNV B;  1P3M D;  3B0D C;  1ID3 D;  1S32 D;  3REH D;  1ID3 C;  1S32 C;  3AZJ D;  1P3A A;  3REH C;  1KX5 B;  3AZJ C;  5BNX A;  4XZQ A;  5B24 D;  3LZ0 C;  3AZI D;  5CPI B;  5B24 C;  3AZI C;  3X1V D;  2FJ7 A;  1F66 A;  5BNV A;  3AN2 D;  2F8N H;  3AN2 C;  5CP6 A;  5B31 B;  3VH5 T;  3AYW D;  3WKJ B;  3NQJ B;  3AYW C;  3MVD D;  2CV5 B;  3R45 B;  3MVD C;  3W98 D;  5DNN B;  3REH B;  3W97 A;  3W98 C;  3LZ0 B;  5AV5 B;  2Y2O A;  4KHA B;  5AV9 D;  1BH8 B;  1TZY C;  1AOI A;  5AV9 C;  5GSU D;  3R45 A;  1ID3 A;  1S32 A;  5DNN A;  4QLC D;  3REH A;  2ARO C;  5AVB B;  3AZJ A;  3LZ0 A;  2NZD D;  3B0B A;  1TAF B;  3AYW B;  5B24 A;  4R8P D;  4KHA A;  3AZI A;  3EPH A;  3UTA B;  3VH6 T;  1BH8 A;  2NZD C;  4R8P C;  3A6N D;  5B40 D;  3A6N C;  5BO0 B;  5B40 C;  3AN2 A;  3KWQ D;  3KWQ C;  5AVC D;  1ZLA D;  1TZY B;  2F8N K;  1KX4 B;  4KGC D;  5AVC C;  2HIO B;  4G92 C;  3AYW A;  3MGQ B;  4KGC C;  3LEL D;  3MVD A;  1KU5 A;  3LEL C;  2ARO B;  3W98 A;  5AY8 B;  1M18 D;  4NE6 A;  3TU4 C;  1M18 C;  5B1M D;  1TZY A;  4R8P B;  5B1M C;  5AV9 A;  1P3I B;  4UUZ A;  3A6N B;  3REK D;  3B6G B;  3WA9 B;  3REK C;  2ARO A;  2G5H C;  2NQB B;  4J8V D;  5B33 C;  3AZL C;  4J8V C;  5AV8 B;  4R8P A;  3UT9 B;  1P3I A;  3A6N A;  4H9P A;  3LZ1 B;  1PZR A;  5B40 A;  3NQU A;  4WNN A;  1KX3 B;  3MGP C;  3TU4 B;  4WU9 D;  4YS3 D;  4UPK A;  3KWQ A;  4YS3 C;  2JE5 A;  1HQ3 D;  5AVC A;  4KGC A;  1HQ3 C;  1P3O C;  3REL D;  3LEL A;  1P34 B;  3REL C;  3MNN B;  5B33 B;  3AZL B;  5B0Y D;  3TU4 A;  1M18 A;  5B0Y C;  5GT0 B;  3KUY D;  5B1M A;  1BH9 A;  3LJA B;  2Y2Q A;  3MGP B;  3AV2 D;  3REK A;  5KDM B;  1W2E A;  3MNN A;  3AV2 C;  5B33 A;  3AZL A;  2IO5 B;  4J8V A;  2FJ7 D;  5DNM D;  1P3O B;  5B1L C;  5DNM C;  3REL B;  4H9Q B;  3MGP A;  4J8W B;  1KX5 D;  4LD9 B;  5B0Y B;  2Y2M A;  1KX5 C;  5CPI D;  4HGA B;  2YFV A;  3KXB B;  1B67 A;  5CPI C;  1HQ3 A;  1P3O A;  2Y2L A;  3REJ D;  3REJ C;  3REL A;  4J8U B;  2J8P A;  5B31 D;  5B0Y A;  4G91 B;  3V9R B;  5B31 C;  3MGR B;  3AZF B;  3WKJ D;  5B1L B;  3WKJ C;  2CV5 D;  4Z5T B;  5GXQ C;  4XUJ C;  2CV5 C;  5DNN D;  3WTP B;  1T3U A;  2BYK A;  5DNN C;  4J8X B;  3LZ0 D;  3C1B D;  4J8U A;  3AV2 A;  5AV5 D;  3EPL A;  3C1B C;  3V9R A;  5AV5 C;  4WU9 C;  5B1L A;  5DNM A;  1P3F B;  3REJ B;  4AWL B;  1P3K B;  5AVB D;  4J8X A;  2F8N B;  1KX5 A;  5AVB C;  5B31 G;  5CPI A;  3UTA D;  1M1A B;  5GXQ B;  4XUJ B;  3UTA C;  2Y2P A;  3REJ A;  2XD5 A;  1R4V A;  4NFT A;  2BG1 A;  3C1B B;  1TZY D;  5B31 A;  4WU9 B;  1KX4 D;  5GT3 B;  4X23 B;  2HIO D;  3WKJ A;  3NQJ A;  3MGQ D;  1KX4 C;  2Y2J A;  2HIO C;  4H9S C;  5GXQ A;  3MGQ C;  4XUJ A;  3AZM B;  2CV5 A;  2ARO D;  5AY8 D;  5AY8 C;  2BYM B;  3C1B A;  5AV5 A;  4WU9 A;  5E5A B;  1P3I D;  1EQZ B;  4ZBJ C;  1P3B D;  3AZE B;  1P3I C;  3B6G D;  1P3B C;  3WA9 D;  3B6G C;  2NQB D;  5G49 B;  3WA9 C;  3H0R C;  1WWS A;  5AVB A;  2NQB C;  5AV8 D;  1TAF A;  5AV8 C;  5E5A A;  3UT9 D;  5B0Z B;  3UTA A;  4Z2M G;  1EQZ A;  3UT9 C;  4EO5 C;  5AV6 B;  3LZ1 D;  1KX3 D;  3TU4 D;  4H9R B;  5BO0 A;  3LZ1 C;  3AV1 C;  1KX3 C;  3B6F B;  4H9N B;  3W99 C;  1KX4 A;  4ZBJ B;  2HIO A;  2ZY4 A;  4H9S A;  3VH5 A;  3MGQ A;  3X1S C;  1WWI A;  1P3B B;  1P34 D;  3MNN D;  5B33 D;  1P34 C;  3AZL D;  4H9R A;  3MNN C;  2W8S A;  5AY8 A;  4H9N A;  4ZUX C;  5GT0 D;  1U35 C;  3AZG C;  5GT0 C;  3LJA D;  4EO5 B;  1P3L B;  1P3B A;  3MGP D;  3LJA C;  1P3P B;  3AV1 B;  3B6G A;  3AFA B;  3WA9 A;  3W96 B;  4YM6 D;  2NQB A;  3W99 B;  3WAA B;  2JCH A;  4YM6 C;  2IO5 C;  3O62 B;  2HUE B;  5FUG B;  3X1S B;  4JJN B;  1P3O D;  3EG5 B;  2ZY5 A;  5AV8 A;  3REI B;  3UT9 A;  5CPK C;  3VH6 A;  3C1C B;  4J8W D;  3LZ1 A;  3KFU G;  3AV1 A;  1KX3 A;  4ZUX B;  4J8W C;  4LD9 D;  1M19 B;  5B32 B;  1U35 B;  4LD9 C;  3W99 A;  3AZG B;  2Y2G A;  3KXB D;  4HGA C;  5FUG A;  3B0C W;  3X1S A;  5JRG B;  3KXB C;  2G5I C;  5CPJ D;  3MGS C;  1N1J B;  4H9O B;  1P34 A;  3UTB D;  5CPJ C;  4J8U D;  3UTB C;  4ZUX A;  4J8U C;  4YM6 B;  1U35 A;  3MGR D;  3AZF D;  4G91 C;  5B1L D;  3AZG A;  5GT0 A;  3MGR C;  3AZF C;  4Z5T D;  5CPK B;  5JRG A;  3LJA A;  4Z5T C;  3WTP D;  2L5A A;  1N1J A;  3WTP C;  4J8X D;  1JFI B;  2Y2H A;  5KDM A;  4J8X C;  2PYO C;  4YM6 A;  4E45 A;  4Z66 B;  1P3F D;  4NE3 A;  2YFW B;  3MGS B;  2RIQ A;  5CPK A;  1P3F C;  4WU8 B;  5CPJ B;  4AWL C;  1P3K D;  3UTB B;  4H9Q A;  4J8W A;  3AZN B;  3X1T B;  3P5J B;  1P3K C;  2F8N D;  4LD9 A;  4E44 A;  2DQN C;  1M1A D;  5B2I B;  5GXQ D;  3KXB A;  4XUJ D;  1M1A C;  4KUD B;  2YFW A;  3MGS A;  1P3G D;  5CPJ A;  5C3I C;  1P3G C;  2VQR A;  3UTB A;  2PYO B;  3AZK C;  2Y2K A;  5GT3 D;  4X23 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...