3B6GC

Nucleosome core particle treated with oxaliplatin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gC00
4J8XA 1U35B 1KX5C 5GT0D 3RELA 5CPKA 3AYWC 5DNND 3AYWD 3WKJA 1ZLAB 5B40A 5B31G 2F8NK 4X23C 1M1AD 5BO0B 4J8VB 3MGQD 4Z2MH 3REJC 3VH5A 3LELD 4XUJD 3REIC 3REJD 3WA9B 3REIA 3W99C 3AZHA 2BYMA 3W99A 5GXQB 4UUZB 2HIOB 4Z5TC 4CAYB 3KUYD 5AY8A 3AZMD 3B0CW 1AOID 3X1VA 1ID3C 3KXBB 3NQUA 5AVCC 1P3FD 5BNVB 5AV6C 1P3LC 3KWQC 1P3LD 1P3MB 3AZJB 4H9OB 5DNMB 3AV1B 5B1MD 5B32D 5CHLB 3AFAA 3AZGB 3B6FC 5GSUD 3B6FD 5B2JD 3X1SC 5B32G 4ZUXB 3AZLB 1M18B 5AVBA 4YS3B 3MVDB 3X1TC 5B2IC 3AZND 1P3PB 4QLCD 3NQJB 4H9PA 1N1JB 5AV5D 5GT0B 3WAAA 5DNNB 3AYWB 1P3BC 1P3BD 3V9RB 3LJAC 1HQ3A 5GT3A 5CP6A 5CPJD 1M1AB 5AV8C 3MGQB 3UTAC 4J8UC 3UTAD 3X1UA 4J8UD 4H9QB 4XUJB 3LELB 3REJB 1KX4B 5B1LC 5B0YD 3REHD 1P3IA 1F66C 5JA4A 5BNXA 5B33D 2RVQC 3KUYB 3W97A 3W96C 3AZMB 3W96D 1AOIB 1TAFB 1EQZD 4G91C 1P34C 1F1EA 1P3FB 4H9RA 5JRGD 2FJ7C 3MGSC 5B0ZC 3MGSD 5B0ZD 1P3LB 5B24A 5KDMB 3O62A 2AROC 3AZKA 2AROD 2PYOA 5B1MB 5B32B 5AV9A 4KGCD 3AV2D 3WTPA 5GSUB 3TU4C 3B6FB 1JFIA 5B2JB 4R8PA 4KUDA 5E5AC 3VH6T 3R45B 5E5AA 3UTBC 3AZNB 4WU8C 1S32C 4QLCB 1S32A 3MGRB 5AV5B 5C3IB 4Z66D 4LD9C 4YM6D 3AN2A 4LD9A 4HGAB 1P3BB 5CPJB 3REKD 3W98C 3C1BA 3W98A 1H3OB 5BS7C 1P3OA 3WA9A 1M19D 2JSSA 3UTAB 4J8UB 5B0YB 2HIOA 4CAYA 4XZQC 3REHB 1P3KD 4H9SA 4WU9C 3B6GC 5B33B 3B6GD 3MNNA 1P3GC 3MGPC 5F99C 4J8WD 3AZID 1P3GD 3W96B 3MGPA 4J8XC 5F99A 1A7WA 3RELC 3AZED 1EQZB 3RELD 4AWLC 5CPKC 1KX5D 4G91B 5CPKD 3WKJC 1P3MA 3VH6W 5JRGB 5DNMA 5B40C 3AV1A 2IO5B 3MGSB 5B0ZB 2F8ND 2CV5A 2NZDA 2AROB 3AZGA 4X23D 4NE3A 1P3AA 4KGCB 1WWIA 4EO5B 4CSRA 3AV2B 3REID 3AZHC 3AZHD 1M18A 3W99D 1KX3A 1HTAA 5B31A 1P3PA 4E45A 5AY8C 3VH5T 4Z5TD 3X1VC 3X1VD 5DNNA 1ID3D 5AVCD 3V9RA 3AZFA 4Z66B 4YM6B 5AV6D 1M1AA 3KWQD 4G92B 2NQBA 3REKB 1BH8B 3LELA 3AFAC 1KX4A 3AFAD 1M19B 3X1SD 1P3KB 5AVBC 3AZMA 2YFVB 3B6GB 1AOIA 3X1TD 3UT9B 1TZYA 3KSYA 5B2ID 3B0DC 4J8WB 3AZIB 5CPIA 1P3GB 1P3FA 3AZEB 3RELB 1KX5B 3WAAC 3VH5W 4NE6A 5CPKB 1KU5A 4ZBJC 5B1MA 1HQ3C 5GT3C 5B32A 5GT3D 5CP6C 2F8NB 3LJAD 4X23B 3A6NA 4JJNC 5GSUA 5B2JA 5AV8D 3X1UC 3X1UD 4JJNA 3REIB 3AZHB 5B1LD 1P3IC 2BYMB 3W99B 1F66D 3R45A 3AZNA 3LZ0A 3W97C 4QLCA 4Z5TB 2RVQD 3MGRA 5AV5A 3X1VB 1ID3B 1P34D 5AVCB 2HUEC 5CPJA 2FJ7D 5B24C 5AV6B 3O62C 3C1CA 4WNNA 3AZKC 3KWQB 3AZKD 2PYOC 5AV9C 5AV9D 5B0YA 3AFAB 3WTPC 1BH9A 3REHA 4R8PC 3TU4D 5B33A 3X1SB 4KUDC 3LZ1A 5E5AD 3X1TB 1EQZA 1U35A 3UTBD 5B2IB 4WZSB 4WU8D 1ZLAC 1S32D 1ZLAA 4DRAA 4DRBA 3AN2C 3AN2D 4LD9D 2YFWB 5BO0A 4ZBJB 4J8VA 5GT3B 5G49B 3C1BC 3WTPE 3LJAB 3C1BD 4KGCA 3AV2A 3W98D 1B67A 3VH6A 1P3OC 3WA9C 1P3OD 4M6BA 5AV8B 3X1UB 5GXQA 4UUZA 1WWSA 2HIOC 5B1LB 4H9SC 1R4VA 4XZQD 1F66B 4WU9D 3MNNC 3MNND 3KXBC 3KXBA 3MGPD 5F99D 4Z66A 5FUGB 5BNVA 4J8XD 4YM6A 1P3MC 1P34B 3AZJC 3WKJD 5DNMC 3AV1C 3AZJA 4H9OA 3REKA 2HUEB 2FJ7B 5B40D 1BH8A 5BT1C 2CV5C 2NZDC 4WV4B 2CV5D 3AZGC 2NZDD 3AZKB 1M19A 4H9NB 1P3AC 5AV9B 1P3AD 2BYKB 2F8NG 1M18C 4ZUXA 1P3KA 3AZLA 1KX3C 3TU4B 4YS3A 3MVDA 1KX3D 4Z2MG 3UT9A 5B31C 1P3PC 1BFMA 5B31D 3AZIA 4J8WA 3NQJA 5AY8D 5E5AB 1N1JA 5GT0C 3AZEA 5GT0A 3UTBB 5DNNC 1KX5A 4WU8B 1S32B 3AYWA 4NE5A 3AZFC 3AZFD 2F8NA 4KHAB 2F8NH 1P3PD 1M1AC 3AN2B 4LD9B 4X23A 2NQBC 2NQBD 3MGQC 3C1BB 3MGQA 3LELC 4XUJC 3W98B 1KX4C 3REJA 4H9QA 4XUJA 1KX4D 1P3OB 3KUYC 4Z5TA 4XZQB 3KUYA 3AZMC 5AVBD 1AOIC 4WU9B 4E44A 3MNNB 1TAFA 1TZYC 1TZYD 1P3FC 5CPIC 1ID3A 5CPID 5AVCA 3MGPB 5F99B 4J8XB 4NFTA 5AV6A 4AWLB 1P3LA 3WAAD 3KWQA 3WKJB 5KDMA 1ULYA 5B1MC 5B32C 5B40B 1HQ3D 5CP6D 2CV5B 2NZDB 1Q9CA 3A6NC 3A6ND 5GSUC 5B2JC 1P3AB 3B6FA 4JJND 4CSRB 3X1SA 1KX3B 1P3ID 3AZNC 3X1TA 3LZ0C 3LZ0D 5B31B 4QLCC 5B2IA 3MGRC 3W97D 5AY8B 5AV5C 3MGRD 5C3IC 4HGAC 3NQUB 2YFWA 3AZFB 1P3BA 5CPJC 5G49A 3LJAA 3C1CC 3C1CD 5B24D 1H3OA 3O62D 2L5AA 2NQBB 2PYOD 5AV8A 3UTAA 4J8UA 5B0YC 5B1LA 3REHC 3WTPD 1F66A 5B33C 3LZ1C 4R8PD 3LZ1D 2CWEA 4KUDD 5AVBB 3W96A 1EQZC 1U35C 5FUGA 1U35D 1TZYB 5CPIB 1P34A 5JRGC 3B0DB 2IO5C 4H9PB 5JRGA 1ZLAD 2FJ7A 3MGSA 5B0ZA 3WAAB 2LY8A 2AROA 4J8VC 4H9NA 4J8VD 1HQ3B 5CP6B 4KGCC 4EO5C 3AV2C 2BYKA 3A6NB 3B0BA 3WA9D 4JJNB 3TU4A 5GXQC 5GXQD 2HIOD 1P3IB 5JA4B 5BNXB 3UTBA 3LZ0B 4WU8A 1B6WA 3KXBD 3W97B 4Z66C 4KHAA 4YM6C 1P3MD 4G92C 4H9RB 3REKC 3AZJD 5DNMD 3AV1D 3C1CB 4WNNB 5B24B 5BT1D 3O62B 5BS7A 1M19C 3AZGD 2PYOB 1BH9B 3B0CT 3WTPB 4ZUXC 1P3KC 4ZUXD 3AZLC 4XZQA 3AZLD 1M18D 4YS3C 3MVDC 1JFIB 4YS3D 3MVDD 2YFVA 4WU9A 4R8PB 3LZ1B 3B6GA 3UT9C 4KUDB 3UT9D 3AZIC 4J8WC 1P3GA 3AZEC
chains in the Genus database with same CATH superfamily
4J8XA 1U35B 1KX5C 5GT0D 3RELA 5CPKA 3AYWC 5DNND 3AYWD 3WKJA 1ZLAB 4WJ3C 5B40A 5B31G 2F8NK 4X23C 1M1AD 5BO0B 4J8VB 2Y2LA 3MGQD 2XD1A 2BG1A 4Z2MH 3REJC 3VH5A 3LELD 4XUJD 3REIC 3REJD 3WA9B 3REIA 3W99C 3AZHA 2BYMA 3W99A 5GXQB 4UUZB 2HIOB 4Z5TC 4CAYB 3KUYD 5AY8A 3AZMD 3B0CW 1AOID 3X1VA 1ID3C 3KXBB 3NQUA 5AVCC 1P3FD 3A1KA 5BNVB 5AV6C 1P3LC 3KWQC 1P3LD 1P3MB 3AZJB 4H9OB 5DNMB 3AV1B 5B1MD 5B32D 5CHLB 3AFAA 3AZGB 3B6FC 2ZY5A 5GSUD 3B6FD 3EPLA 5B2JD 3X1SC 5B32G 4ZUXB 3AZLB 1M18B 5AVBA 4YS3B 3MVDB 3X1TC 5B2IC 3AZND 1P3PB 4QLCD 3NQJB 4H9PA 1N1JB 5AV5D 5GT0B 2DF4C 3WAAA 5DNNB 3AYWB 1P3BC 1P3BD 3V9RB 3LJAC 1HQ3A 5GT3A 5CP6A 5CPJD 1M1AB 5AV8C 3MGQB 2Y2IA 4J8UC 3UTAC 3UTAD 3X1UA 4J8UD 4H9QB 4XUJB 3LELB 3REJB 1KX4B 5B1LC 5B0YD 3REHD 1P3IA 1F66C 5JA4A 5BNXA 5B33D 2RVQC 3KUYB 3W97A 3KFUG 3W96C 3AZMB 3W96D 1AOIB 1TAFB 1EQZD 4G91C 3IP4C 1P34C 1F1EA 1P3FB 4DQYB 4H9RA 5JRGD 2FJ7C 3MGSC 5B0ZC 3MGSD 5B0ZD 1P3LB 5B24A 5KDMB 3O62A 2AROC 3AZKA 2AROD 2PYOA 5B1MB 5B32B 5AV9A 2Y2MA 4KGCD 3AV2D 3WTPA 5GSUB 3TU4C 3B6FB 1JFIA 5B2JB 4R8PA 4KUDA 5E5AC 3VH6T 3R45B 5E5AA 3UTBC 3AZNB 4WU8C 1S32C 4QLCB 1S32A 3MGRB 5AV5B 5C3IB 4Z66D 4LD9C 4YM6D 3AN2A 4LD9A 4HGAB 1P3BB 5CPJB 3REKD 3W98C 3C1BA 2ZY4A 3W98A 1H3OB 5BS7C 1P3OA 3WA9A 1M19D 2JSSA 2UWXA 3UTAB 4J8UB 5B0YB 2HIOA 4CAYA 4UPKA 4XZQC 3REHB 1P3KD 4H9SA 4WU9C 3B6GC 5B33B 3B6GD 3MNNA 1P3GC 3MGPC 5F99C 4J8WD 3AZID 1P3GD 3W96B 3MGPA 4J8XC 5F99A 1A7WA 3RELC 3AZED 1EQZB 3RELD 4AWLC 5CPKC 1KX5D 4G91B 5CPKD 3WKJC 1P3MA 3VH6W 5JRGB 5DNMA 5B40C 3AV1A 2IO5B 3MGSB 5B0ZB 2F8ND 2CV5A 2NZDA 2AROB 3AZGA 4X23D 4NE3A 2Y2OA 1P3AA 4KGCB 1WWIA 4EO5B 4CSRA 3AV2B 3REID 3AZHC 3AZHD 1M18A 3W99D 1KX3A 1HTAA 5B31A 1P3PA 4E45A 5AY8C 3VH5T 4Z5TD 3X1VC 3X1VD 5DNNA 1ID3D 5AVCD 3V9RA 3AZFA 4Z66B 4YM6B 5AV6D 1M1AA 3KWQD 4G92B 2NQBA 3REKB 1BH8B 3LELA 3AFAC 1KX4A 3AFAD 1M19B 3EPHA 3EG5B 3X1SD 1P3KB 5AVBC 3AZMA 2YFVB 3B6GB 1AOIA 3X1TD 3UT9B 1TZYA 3H0MC 3KSYA 3B0DC 5B2ID 4J8WB 3AZIB 5CPIA 1P3GB 1P3FA 3AZEB 3RELB 1KX5B 3WAAC 3VH5W 4NE6A 5CPKB 1KU5A 2W8SA 4ZBJC 5B1MA 1HQ3C 5GT3C 5B32A 5GT3D 5CP6C 2F8NB 1T3UA 3LJAD 4X23B 3A6NA 4JJNC 5GSUA 5B2JA 5AV8D 3X1UC 3X1UD 4JJNA 3REIB 3AZHB 5B1LD 1P3IC 2BYMB 3W99B 1F66D 3R45A 3AZNA 3LZ0A 3W97C 4QLCA 4Z5TB 2RVQD 3MGRA 5AV5A 3X1VB 1ID3B 2Y2GA 2Y2QA 1P34D 5AVCB 2HUEC 5CPJA 2FJ7D 5B24C 5AV6B 3O62C 2Y2KA 3A1IA 4WNNA 3C1CA 3KWQB 3AZKC 3AZKD 2PYOC 1PZRA 5AV9C 5AV9D 5B0YA 3AFAB 3WTPC 1BH9A 3REHA 4R8PC 3TU4D 5B33A 3X1SB 4KUDC 3LZ1A 5E5AD 3X1TB 1EQZA 1U35A 3UTBD 5B2IB 4WZSB 4WU8D 1ZLAC 1S32D 1ZLAA 4DRAA 4DRBA 3AN2C 3AN2D 4LD9D 2YFWB 1Z2CB 5BO0A 4ZBJB 4J8VA 5GT3B 5G49B 3C1BC 3WTPE 3LJAB 3C1BD 4KGCA 3AV2A 3W98D 1B67A 3VH6A 1P3OC 3WA9C 1P3OD 4M6BA 5AV8B 3X1UB 5GXQA 4UUZA 1WWSA 2HIOC 2JCHA 2Y2JA 5B1LB 4H9SC 1R4VA 4XZQD 2G5HC 1F66B 4WU9D 3MNNC 3MNND 3KXBC 3KXBA 3FDDA 3MGPD 5F99D 4Z66A 5FUGB 5BNVA 4J8XD 4YM6A 1P3MC 1P34B 3AZJC 3WKJD 5DNMC 3AV1C 3AZJA 4H9OA 3REKA 2HUEB 2FJ7B 5B40D 1BH8A 5BT1C 2CV5C 2NZDC 4WV4B 2CV5D 3AZGC 2NZDD 3AZKB 1M19A 4H9NB 2JE5A 1P3AC 5AV9B 1P3AD 2ZY2A 2BYKB 2F8NG 1M18C 4ZUXA 1P3KA 3AZLA 1KX3C 3TU4B 4YS3A 3MVDA 1KX3D 4Z2MG 3UT9A 5B31C 1P3PC 1BFMA 5B31D 3AZIA 4J8WA 3NQJA 5AY8D 5E5AB 1N1JA 5GT0C 3AZEA 5GT0A 3UTBB 5DNNC 1KX5A 4WU8B 1S32B 3AYWA 4NE5A 3AZFC 3AZFD 2F8NA 4KHAB 2J8PA 2F8NH 1P3PD 1M1AC 3AN2B 4LD9B 4X23A 2NQBC 2NQBD 3MGQC 3C1BB 3MGQA 3LELC 4XUJC 3W98B 1KX4C 3REJA 4H9QA 4XUJA 1KX4D 1P3OB 2Y2HA 3KUYC 3H0RC 4Z5TA 4XZQB 3KUYA 3AZMC 5AVBD 1AOIC 4WU9B 4E44A 3MNNB 1TAFA 1TZYC 2FFFB 1TZYD 1P3FC 5CPIC 1ID3A 5CPID 5AVCA 3MGPB 5F99B 4J8XB 2Y2NA 4NFTA 5AV6A 4AWLB 1P3LA 1W2EA 3KWQA 3WAAD 2ZY3A 1ULYA 5KDMA 5B1MC 5B32C 3WKJB 5B40B 1HQ3D 5CP6D 2CV5B 2NZDB 1Q9CA 3A6NC 3A6ND 5GSUC 5B2JC 1P3AB 3B6FA 4JJND 4CSRB 3X1SA 2DQNC 1KX3B 1P3ID 3AZNC 3X1TA 3LZ0C 3LZ0D 3F6TA 5B31B 4QLCC 5B2IA 3MGRC 3W97D 5AY8B 5AV5C 3MGRD 5C3IC 2RIQA 4HGAC 3NQUB 2YFWA 3AZFB 1P3BA 5CPJC 5G49A 3LJAA 3C1CC 2Y2PA 3C1CD 5B24D 1H3OA 3O62D 2L5AA 2NQBB 3EPKA 2PYOD 3AL0C 5AV8A 3UTAA 4J8UA 5B0YC 5B1LA 3REHC 3WTPD 1F66A 2F2AC 5B33C 3LZ1C 4R8PD 3LZ1D 2CWEA 4KUDD 5AVBB 3W96A 1EQZC 1U35C 5FUGA 3EPJA 1U35D 1TZYB 5CPIB 1P34A 5JRGC 3B0DB 3P5JB 2IO5C 4H9PB 5JRGA 1ZLAD 2FJ7A 2XD5A 3MGSA 5B0ZA 3WAAB 2LY8A 2AROA 4J8VC 4H9NA 4J8VD 1HQ3B 5CP6B 4KGCC 4EO5C 3AV2C 2BYKA 3A6NB 3B0BA 3WA9D 4JJNB 3TU4A 5GXQC 5GXQD 2HIOD 1P3IB 5JA4B 5BNXB 3UTBA 3LZ0B 1B6WA 4WU8A 3KXBD 3W97B 2ZM5A 4Z66C 4KHAA 4YM6C 1P3MD 4G92C 4H9RB 3REKC 3AZJD 5DNMD 3AV1D 3C1CB 3H0LC 4WNNB 5B24B 5BT1D 3O62B 5BS7A 1M19C 3AZGD 2PYOB 1BH9B 3B0CT 3WTPB 4ZUXC 1P3KC 4ZUXD 3AZLC 4XZQA 3AZLD 1M18D 4YS3C 3MVDC 1JFIB 4YS3D 3MVDD 2YFVA 4WU9A 4R8PB 2VQRA 3LZ1B 3B6GA 2G5IC 3UT9C 4KUDB 3UT9D 3AZIC 4J8WC 1P3GA 3AZEC
chains in the Genus database with same CATH topology
4J8XA 1U35B 1KX5C 5GT0D 3RELA 5CPKA 3AYWC 5DNND 3AYWD 3WKJA 1ZLAB 4WJ3C 5B40A 5B31G 2F8NK 4X23C 1M1AD 5BO0B 4J8VB 2Y2LA 3MGQD 2XD1A 2BG1A 4Z2MH 3REJC 3VH5A 3LELD 4XUJD 3REIC 3REJD 3WA9B 3REIA 3W99C 3AZHA 2BYMA 3W99A 5GXQB 4UUZB 2HIOB 4Z5TC 4CAYB 3KUYD 5AY8A 3AZMD 3B0CW 1AOID 3X1VA 1ID3C 3KXBB 3NQUA 5AVCC 1P3FD 3A1KA 5BNVB 5AV6C 1P3LC 3KWQC 1P3LD 1P3MB 3AZJB 4H9OB 5DNMB 3AV1B 5B1MD 5B32D 5CHLB 3AFAA 3AZGB 3B6FC 2ZY5A 5GSUD 3B6FD 3EPLA 5B2JD 3X1SC 5B32G 4ZUXB 3AZLB 1M18B 5AVBA 4YS3B 3MVDB 3X1TC 5B2IC 3AZND 1P3PB 4QLCD 3NQJB 4H9PA 1N1JB 5AV5D 5GT0B 2DF4C 3WAAA 5DNNB 3AYWB 1P3BC 1P3BD 3V9RB 3LJAC 1HQ3A 5GT3A 5CP6A 5CPJD 1M1AB 5AV8C 3MGQB 2Y2IA 4J8UC 3UTAC 3UTAD 3X1UA 4J8UD 4H9QB 4XUJB 3LELB 3REJB 1KX4B 5B1LC 5B0YD 3REHD 1P3IA 1F66C 5JA4A 5BNXA 5B33D 2RVQC 3KUYB 3W97A 3KFUG 3W96C 3AZMB 3W96D 1AOIB 1TAFB 1EQZD 4G91C 3IP4C 1P34C 1F1EA 1P3FB 4DQYB 4H9RA 5JRGD 2FJ7C 3MGSC 5B0ZC 3MGSD 5B0ZD 1P3LB 5B24A 5KDMB 3O62A 2AROC 3AZKA 2AROD 2PYOA 5B1MB 5B32B 5AV9A 2Y2MA 4KGCD 3AV2D 3WTPA 5GSUB 3TU4C 3B6FB 1JFIA 5B2JB 4R8PA 4KUDA 5E5AC 3VH6T 3R45B 5E5AA 3UTBC 3AZNB 4WU8C 1S32C 4QLCB 1S32A 3MGRB 5AV5B 5C3IB 4Z66D 4LD9C 4YM6D 3AN2A 4LD9A 4HGAB 1P3BB 5CPJB 3REKD 3W98C 3C1BA 2ZY4A 3W98A 1H3OB 5BS7C 1P3OA 3WA9A 1M19D 2JSSA 2UWXA 3UTAB 4J8UB 5B0YB 2HIOA 4CAYA 4UPKA 4XZQC 3REHB 1P3KD 4H9SA 4WU9C 3B6GC 5B33B 3B6GD 3MNNA 1P3GC 3MGPC 5F99C 4J8WD 3AZID 1P3GD 3W96B 3MGPA 4J8XC 5F99A 1A7WA 3RELC 3AZED 1EQZB 3RELD 4AWLC 5CPKC 1KX5D 4G91B 5CPKD 3WKJC 1P3MA 3VH6W 5JRGB 5DNMA 5B40C 3AV1A 2IO5B 3MGSB 5B0ZB 2F8ND 2CV5A 2NZDA 2AROB 3AZGA 4X23D 4NE3A 2Y2OA 1P3AA 4KGCB 1WWIA 4EO5B 4CSRA 3AV2B 3REID 3AZHC 3AZHD 1M18A 3W99D 1KX3A 1HTAA 5B31A 1P3PA 4E45A 5AY8C 3VH5T 4Z5TD 3X1VC 3X1VD 5DNNA 1ID3D 5AVCD 3V9RA 3AZFA 4Z66B 4YM6B 5AV6D 1M1AA 3KWQD 4G92B 2NQBA 3REKB 1BH8B 3LELA 3AFAC 1KX4A 3AFAD 1M19B 3EPHA 3EG5B 3X1SD 1P3KB 5AVBC 3AZMA 2YFVB 3B6GB 1AOIA 3X1TD 3UT9B 1TZYA 3H0MC 3KSYA 3B0DC 5B2ID 4J8WB 3AZIB 5CPIA 1P3GB 1P3FA 3AZEB 3RELB 1KX5B 3WAAC 3VH5W 4NE6A 5CPKB 1KU5A 2W8SA 4ZBJC 5B1MA 1HQ3C 5GT3C 5B32A 5GT3D 5CP6C 2F8NB 1T3UA 3LJAD 4X23B 3A6NA 4JJNC 5GSUA 5B2JA 5AV8D 3X1UC 3X1UD 4JJNA 3REIB 3AZHB 5B1LD 1P3IC 2BYMB 3W99B 1F66D 3R45A 3AZNA 3LZ0A 3W97C 4QLCA 4Z5TB 2RVQD 3MGRA 5AV5A 3X1VB 1ID3B 2Y2GA 2Y2QA 1P34D 5AVCB 2HUEC 5CPJA 2FJ7D 5B24C 5AV6B 3O62C 2Y2KA 3A1IA 4WNNA 3C1CA 3KWQB 3AZKC 3AZKD 2PYOC 1PZRA 5AV9C 5AV9D 5B0YA 3AFAB 3WTPC 1BH9A 3REHA 4R8PC 3TU4D 5B33A 3X1SB 4KUDC 3LZ1A 5E5AD 3X1TB 1EQZA 1U35A 3UTBD 5B2IB 4WZSB 4WU8D 1ZLAC 1S32D 1ZLAA 4DRAA 4DRBA 3AN2C 3AN2D 4LD9D 2YFWB 1Z2CB 5BO0A 4ZBJB 4J8VA 5GT3B 5G49B 3C1BC 3WTPE 3LJAB 3C1BD 4KGCA 3AV2A 3W98D 1B67A 3VH6A 1P3OC 3WA9C 1P3OD 4M6BA 5AV8B 3X1UB 5GXQA 4UUZA 1WWSA 2HIOC 2JCHA 2Y2JA 5B1LB 4H9SC 1R4VA 4XZQD 2G5HC 1F66B 4WU9D 3MNNC 3MNND 3KXBC 3KXBA 3FDDA 3MGPD 5F99D 4Z66A 5FUGB 5BNVA 4J8XD 4YM6A 1P3MC 1P34B 3AZJC 3WKJD 5DNMC 3AV1C 3AZJA 4H9OA 3REKA 2HUEB 2FJ7B 5B40D 1BH8A 5BT1C 2CV5C 2NZDC 4WV4B 2CV5D 3AZGC 2NZDD 3AZKB 1M19A 4H9NB 2JE5A 1P3AC 5AV9B 1P3AD 2ZY2A 2BYKB 2F8NG 1M18C 4ZUXA 1P3KA 3AZLA 1KX3C 3TU4B 4YS3A 3MVDA 1KX3D 4Z2MG 3UT9A 5B31C 1P3PC 1BFMA 5B31D 3AZIA 4J8WA 3NQJA 5AY8D 5E5AB 1N1JA 5GT0C 3AZEA 5GT0A 3UTBB 5DNNC 1KX5A 4WU8B 1S32B 3AYWA 4NE5A 3AZFC 3AZFD 2F8NA 4KHAB 2J8PA 2F8NH 1P3PD 1M1AC 3AN2B 4LD9B 4X23A 2NQBC 2NQBD 3MGQC 3C1BB 3MGQA 3LELC 4XUJC 3W98B 1KX4C 3REJA 4H9QA 4XUJA 1KX4D 1P3OB 2Y2HA 3KUYC 3H0RC 4Z5TA 4XZQB 3KUYA 3AZMC 5AVBD 1AOIC 4WU9B 4E44A 3MNNB 1TAFA 1TZYC 2FFFB 1TZYD 1P3FC 5CPIC 1ID3A 5CPID 5AVCA 3MGPB 5F99B 4J8XB 2Y2NA 4NFTA 5AV6A 4AWLB 1P3LA 1W2EA 3KWQA 3WAAD 2ZY3A 1ULYA 5KDMA 5B1MC 5B32C 3WKJB 5B40B 1HQ3D 5CP6D 2CV5B 2NZDB 1Q9CA 3A6NC 3A6ND 5GSUC 5B2JC 1P3AB 3B6FA 4JJND 4CSRB 3X1SA 2DQNC 1KX3B 1P3ID 3AZNC 3X1TA 3LZ0C 3LZ0D 3F6TA 5B31B 4QLCC 5B2IA 3MGRC 3W97D 5AY8B 5AV5C 3MGRD 5C3IC 2RIQA 4HGAC 3NQUB 2YFWA 3AZFB 1P3BA 5CPJC 5G49A 3LJAA 3C1CC 2Y2PA 3C1CD 5B24D 1H3OA 3O62D 2L5AA 2NQBB 3EPKA 2PYOD 3AL0C 5AV8A 3UTAA 4J8UA 5B0YC 5B1LA 3REHC 3WTPD 1F66A 2F2AC 5B33C 3LZ1C 4R8PD 3LZ1D 2CWEA 4KUDD 5AVBB 3W96A 1EQZC 1U35C 5FUGA 3EPJA 1U35D 1TZYB 5CPIB 1P34A 5JRGC 3B0DB 3P5JB 2IO5C 4H9PB 5JRGA 1ZLAD 2FJ7A 2XD5A 3MGSA 5B0ZA 3WAAB 2LY8A 2AROA 4J8VC 4H9NA 4J8VD 1HQ3B 5CP6B 4KGCC 4EO5C 3AV2C 2BYKA 3A6NB 3B0BA 3WA9D 4JJNB 3TU4A 5GXQC 5GXQD 2HIOD 1P3IB 5JA4B 5BNXB 3UTBA 3LZ0B 1B6WA 4WU8A 3KXBD 3W97B 2ZM5A 4Z66C 4KHAA 4YM6C 1P3MD 4G92C 4H9RB 3REKC 3AZJD 5DNMD 3AV1D 3C1CB 3H0LC 4WNNB 5B24B 5BT1D 3O62B 5BS7A 1M19C 3AZGD 2PYOB 1BH9B 3B0CT 3WTPB 4ZUXC 1P3KC 4ZUXD 3AZLC 4XZQA 3AZLD 1M18D 4YS3C 3MVDC 1JFIB 4YS3D 3MVDD 2YFVA 4WU9A 4R8PB 2VQRA 3LZ1B 3B6GA 2G5IC 3UT9C 4KUDB 3UT9D 3AZIC 4J8WC 1P3GA 3AZEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X A;  1U35 B;  1KX5 C;  5GT0 D;  3REL A;  5CPK A;  3AYW C;  5DNN D;  3AYW D;  3WKJ A;  1ZLA B;  5B40 A;  5B31 G;  2F8N K;  4X23 C;  1M1A D;  5BO0 B;  4J8V B;  3MGQ D;  4Z2M H;  3REJ C;  3VH5 A;  3LEL D;  4XUJ D;  3REI C;  3REJ D;  3WA9 B;  3REI A;  3W99 C;  3AZH A;  2BYM A;  3W99 A;  5GXQ B;  4UUZ B;  2HIO B;  4Z5T C;  4CAY B;  3KUY D;  5AY8 A;  3AZM D;  3B0C W;  1AOI D;  3X1V A;  1ID3 C;  3KXB B;  3NQU A;  5AVC C;  1P3F D;  5BNV B;  5AV6 C;  1P3L C;  3KWQ C;  1P3L D;  1P3M B;  3AZJ B;  4H9O B;  5DNM B;  3AV1 B;  5B1M D;  5B32 D;  5CHL B;  3AFA A;  3AZG B;  3B6F C;  5GSU D;  3B6F D;  5B2J D;  3X1S C;  5B32 G;  4ZUX B;  3AZL B;  1M18 B;  5AVB A;  4YS3 B;  3MVD B;  3X1T C;  5B2I C;  3AZN D;  1P3P B;  4QLC D;  3NQJ B;  4H9P A;  1N1J B;  5AV5 D;  5GT0 B;  3WAA A;  5DNN B;  3AYW B;  1P3B C;  1P3B D;  3V9R B;  3LJA C;  1HQ3 A;  5GT3 A;  5CP6 A;  5CPJ D;  1M1A B;  5AV8 C;  3MGQ B;  3UTA C;  4J8U C;  3UTA D;  3X1U A;  4J8U D;  4H9Q B;  4XUJ B;  3LEL B;  3REJ B;  1KX4 B;  5B1L C;  5B0Y D;  3REH D;  1P3I A;  1F66 C;  5JA4 A;  5BNX A;  5B33 D;  2RVQ C;  3KUY B;  3W97 A;  3W96 C;  3AZM B;  3W96 D;  1AOI B;  1TAF B;  1EQZ D;  4G91 C;  1P34 C;  1F1E A;  1P3F B;  4H9R A;  5JRG D;  2FJ7 C;  3MGS C;  5B0Z C;  3MGS D;  5B0Z D;  1P3L B;  5B24 A;  5KDM B;  3O62 A;  2ARO C;  3AZK A;  2ARO D;  2PYO A;  5B1M B;  5B32 B;  5AV9 A;  4KGC D;  3AV2 D;  3WTP A;  5GSU B;  3TU4 C;  3B6F B;  1JFI A;  5B2J B;  4R8P A;  4KUD A;  5E5A C;  3VH6 T;  3R45 B;  5E5A A;  3UTB C;  3AZN B;  4WU8 C;  1S32 C;  4QLC B;  1S32 A;  3MGR B;  5AV5 B;  5C3I B;  4Z66 D;  4LD9 C;  4YM6 D;  3AN2 A;  4LD9 A;  4HGA B;  1P3B B;  5CPJ B;  3REK D;  3W98 C;  3C1B A;  3W98 A;  1H3O B;  5BS7 C;  1P3O A;  3WA9 A;  1M19 D;  2JSS A;  3UTA B;  4J8U B;  5B0Y B;  2HIO A;  4CAY A;  4XZQ C;  3REH B;  1P3K D;  4H9S A;  4WU9 C;  3B6G C;  5B33 B;  3B6G D;  3MNN A;  1P3G C;  3MGP C;  5F99 C;  4J8W D;  3AZI D;  1P3G D;  3W96 B;  3MGP A;  4J8X C;  5F99 A;  1A7W A;  3REL C;  3AZE D;  1EQZ B;  3REL D;  4AWL C;  5CPK C;  1KX5 D;  4G91 B;  5CPK D;  3WKJ C;  1P3M A;  3VH6 W;  5JRG B;  5DNM A;  5B40 C;  3AV1 A;  2IO5 B;  3MGS B;  5B0Z B;  2F8N D;  2CV5 A;  2NZD A;  2ARO B;  3AZG A;  4X23 D;  4NE3 A;  1P3A A;  4KGC B;  1WWI A;  4EO5 B;  4CSR A;  3AV2 B;  3REI D;  3AZH C;  3AZH D;  1M18 A;  3W99 D;  1KX3 A;  1HTA A;  5B31 A;  1P3P A;  4E45 A;  5AY8 C;  3VH5 T;  4Z5T D;  3X1V C;  3X1V D;  5DNN A;  1ID3 D;  5AVC D;  3V9R A;  3AZF A;  4Z66 B;  4YM6 B;  5AV6 D;  1M1A A;  3KWQ D;  4G92 B;  2NQB A;  3REK B;  1BH8 B;  3LEL A;  3AFA C;  1KX4 A;  3AFA D;  1M19 B;  3X1S D;  1P3K B;  5AVB C;  3AZM A;  2YFV B;  3B6G B;  1AOI A;  3X1T D;  3UT9 B;  1TZY A;  3KSY A;  5B2I D;  3B0D C;  4J8W B;  3AZI B;  5CPI A;  1P3G B;  1P3F A;  3AZE B;  3REL B;  1KX5 B;  3WAA C;  3VH5 W;  4NE6 A;  5CPK B;  1KU5 A;  4ZBJ C;  5B1M A;  1HQ3 C;  5GT3 C;  5B32 A;  5GT3 D;  5CP6 C;  2F8N B;  3LJA D;  4X23 B;  3A6N A;  4JJN C;  5GSU A;  5B2J A;  5AV8 D;  3X1U C;  3X1U D;  4JJN A;  3REI B;  3AZH B;  5B1L D;  1P3I C;  2BYM B;  3W99 B;  1F66 D;  3R45 A;  3AZN A;  3LZ0 A;  3W97 C;  4QLC A;  4Z5T B;  2RVQ D;  3MGR A;  5AV5 A;  3X1V B;  1ID3 B;  1P34 D;  5AVC B;  2HUE C;  5CPJ A;  2FJ7 D;  5B24 C;  5AV6 B;  3O62 C;  3C1C A;  4WNN A;  3AZK C;  3KWQ B;  3AZK D;  2PYO C;  5AV9 C;  5AV9 D;  5B0Y A;  3AFA B;  3WTP C;  1BH9 A;  3REH A;  4R8P C;  3TU4 D;  5B33 A;  3X1S B;  4KUD C;  3LZ1 A;  5E5A D;  3X1T B;  1EQZ A;  1U35 A;  3UTB D;  5B2I B;  4WZS B;  4WU8 D;  1ZLA C;  1S32 D;  1ZLA A;  4DRA A;  4DRB A;  3AN2 C;  3AN2 D;  4LD9 D;  2YFW B;  5BO0 A;  4ZBJ B;  4J8V A;  5GT3 B;  5G49 B;  3C1B C;  3WTP E;  3LJA B;  3C1B D;  4KGC A;  3AV2 A;  3W98 D;  1B67 A;  3VH6 A;  1P3O C;  3WA9 C;  1P3O D;  4M6B A;  5AV8 B;  3X1U B;  5GXQ A;  4UUZ A;  1WWS A;  2HIO C;  5B1L B;  4H9S C;  1R4V A;  4XZQ D;  1F66 B;  4WU9 D;  3MNN C;  3MNN D;  3KXB C;  3KXB A;  3MGP D;  5F99 D;  4Z66 A;  5FUG B;  5BNV A;  4J8X D;  4YM6 A;  1P3M C;  1P34 B;  3AZJ C;  3WKJ D;  5DNM C;  3AV1 C;  3AZJ A;  4H9O A;  3REK A;  2HUE B;  2FJ7 B;  5B40 D;  1BH8 A;  5BT1 C;  2CV5 C;  2NZD C;  4WV4 B;  2CV5 D;  3AZG C;  2NZD D;  3AZK B;  1M19 A;  4H9N B;  1P3A C;  5AV9 B;  1P3A D;  2BYK B;  2F8N G;  1M18 C;  4ZUX A;  1P3K A;  3AZL A;  1KX3 C;  3TU4 B;  4YS3 A;  3MVD A;  1KX3 D;  4Z2M G;  3UT9 A;  5B31 C;  1P3P C;  1BFM A;  5B31 D;  3AZI A;  4J8W A;  3NQJ A;  5AY8 D;  5E5A B;  1N1J A;  5GT0 C;  3AZE A;  5GT0 A;  3UTB B;  5DNN C;  1KX5 A;  4WU8 B;  1S32 B;  3AYW A;  4NE5 A;  3AZF C;  3AZF D;  2F8N A;  4KHA B;  2F8N H;  1P3P D;  1M1A C;  3AN2 B;  4LD9 B;  4X23 A;  2NQB C;  2NQB D;  3MGQ C;  3C1B B;  3MGQ A;  3LEL C;  4XUJ C;  3W98 B;  1KX4 C;  3REJ A;  4H9Q A;  4XUJ A;  1KX4 D;  1P3O B;  3KUY C;  4Z5T A;  4XZQ B;  3KUY A;  3AZM C;  5AVB D;  1AOI C;  4WU9 B;  4E44 A;  3MNN B;  1TAF A;  1TZY C;  1TZY D;  1P3F C;  5CPI C;  1ID3 A;  5CPI D;  5AVC A;  3MGP B;  5F99 B;  4J8X B;  4NFT A;  5AV6 A;  4AWL B;  1P3L A;  3WAA D;  3KWQ A;  3WKJ B;  5KDM A;  1ULY A;  5B1M C;  5B32 C;  5B40 B;  1HQ3 D;  5CP6 D;  2CV5 B;  2NZD B;  1Q9C A;  3A6N C;  3A6N D;  5GSU C;  5B2J C;  1P3A B;  3B6F A;  4JJN D;  4CSR B;  3X1S A;  1KX3 B;  1P3I D;  3AZN C;  3X1T A;  3LZ0 C;  3LZ0 D;  5B31 B;  4QLC C;  5B2I A;  3MGR C;  3W97 D;  5AY8 B;  5AV5 C;  3MGR D;  5C3I C;  4HGA C;  3NQU B;  2YFW A;  3AZF B;  1P3B A;  5CPJ C;  5G49 A;  3LJA A;  3C1C C;  3C1C D;  5B24 D;  1H3O A;  3O62 D;  2L5A A;  2NQB B;  2PYO D;  5AV8 A;  3UTA A;  4J8U A;  5B0Y C;  5B1L A;  3REH C;  3WTP D;  1F66 A;  5B33 C;  3LZ1 C;  4R8P D;  3LZ1 D;  2CWE A;  4KUD D;  5AVB B;  3W96 A;  1EQZ C;  1U35 C;  5FUG A;  1U35 D;  1TZY B;  5CPI B;  1P34 A;  5JRG C;  3B0D B;  2IO5 C;  4H9P B;  5JRG A;  1ZLA D;  2FJ7 A;  3MGS A;  5B0Z A;  3WAA B;  2LY8 A;  2ARO A;  4J8V C;  4H9N A;  4J8V D;  1HQ3 B;  5CP6 B;  4KGC C;  4EO5 C;  3AV2 C;  2BYK A;  3A6N B;  3B0B A;  3WA9 D;  4JJN B;  3TU4 A;  5GXQ C;  5GXQ D;  2HIO D;  1P3I B;  5JA4 B;  5BNX B;  3UTB A;  3LZ0 B;  4WU8 A;  1B6W A;  3KXB D;  3W97 B;  4Z66 C;  4KHA A;  4YM6 C;  1P3M D;  4G92 C;  4H9R B;  3REK C;  3AZJ D;  5DNM D;  3AV1 D;  3C1C B;  4WNN B;  5B24 B;  5BT1 D;  3O62 B;  5BS7 A;  1M19 C;  3AZG D;  2PYO B;  1BH9 B;  3B0C T;  3WTP B;  4ZUX C;  1P3K C;  4ZUX D;  3AZL C;  4XZQ A;  3AZL D;  1M18 D;  4YS3 C;  3MVD C;  1JFI B;  4YS3 D;  3MVD D;  2YFV A;  4WU9 A;  4R8P B;  3LZ1 B;  3B6G A;  3UT9 C;  4KUD B;  3UT9 D;  3AZI C;  4J8W C;  1P3G A;  3AZE C; 
#chains in the Genus database with same CATH topology
 4J8X A;  1U35 B;  1KX5 C;  5GT0 D;  3REL A;  5CPK A;  3AYW C;  5DNN D;  3AYW D;  3WKJ A;  1ZLA B;  4WJ3 C;  5B40 A;  5B31 G;  2F8N K;  4X23 C;  1M1A D;  5BO0 B;  4J8V B;  2Y2L A;  3MGQ D;  2XD1 A;  2BG1 A;  4Z2M H;  3REJ C;  3VH5 A;  3LEL D;  4XUJ D;  3REI C;  3REJ D;  3WA9 B;  3REI A;  3W99 C;  3AZH A;  2BYM A;  3W99 A;  5GXQ B;  4UUZ B;  2HIO B;  4Z5T C;  4CAY B;  3KUY D;  5AY8 A;  3AZM D;  3B0C W;  1AOI D;  3X1V A;  1ID3 C;  3KXB B;  3NQU A;  5AVC C;  1P3F D;  3A1K A;  5BNV B;  5AV6 C;  1P3L C;  3KWQ C;  1P3L D;  1P3M B;  3AZJ B;  4H9O B;  5DNM B;  3AV1 B;  5B1M D;  5B32 D;  5CHL B;  3AFA A;  3AZG B;  3B6F C;  2ZY5 A;  5GSU D;  3B6F D;  3EPL A;  5B2J D;  3X1S C;  5B32 G;  4ZUX B;  3AZL B;  1M18 B;  5AVB A;  4YS3 B;  3MVD B;  3X1T C;  5B2I C;  3AZN D;  1P3P B;  4QLC D;  3NQJ B;  4H9P A;  1N1J B;  5AV5 D;  5GT0 B;  2DF4 C;  3WAA A;  5DNN B;  3AYW B;  1P3B C;  1P3B D;  3V9R B;  3LJA C;  1HQ3 A;  5GT3 A;  5CP6 A;  5CPJ D;  1M1A B;  5AV8 C;  3MGQ B;  2Y2I A;  4J8U C;  3UTA C;  3UTA D;  3X1U A;  4J8U D;  4H9Q B;  4XUJ B;  3LEL B;  3REJ B;  1KX4 B;  5B1L C;  5B0Y D;  3REH D;  1P3I A;  1F66 C;  5JA4 A;  5BNX A;  5B33 D;  2RVQ C;  3KUY B;  3W97 A;  3KFU G;  3W96 C;  3AZM B;  3W96 D;  1AOI B;  1TAF B;  1EQZ D;  4G91 C;  3IP4 C;  1P34 C;  1F1E A;  1P3F B;  4DQY B;  4H9R A;  5JRG D;  2FJ7 C;  3MGS C;  5B0Z C;  3MGS D;  5B0Z D;  1P3L B;  5B24 A;  5KDM B;  3O62 A;  2ARO C;  3AZK A;  2ARO D;  2PYO A;  5B1M B;  5B32 B;  5AV9 A;  2Y2M A;  4KGC D;  3AV2 D;  3WTP A;  5GSU B;  3TU4 C;  3B6F B;  1JFI A;  5B2J B;  4R8P A;  4KUD A;  5E5A C;  3VH6 T;  3R45 B;  5E5A A;  3UTB C;  3AZN B;  4WU8 C;  1S32 C;  4QLC B;  1S32 A;  3MGR B;  5AV5 B;  5C3I B;  4Z66 D;  4LD9 C;  4YM6 D;  3AN2 A;  4LD9 A;  4HGA B;  1P3B B;  5CPJ B;  3REK D;  3W98 C;  3C1B A;  2ZY4 A;  3W98 A;  1H3O B;  5BS7 C;  1P3O A;  3WA9 A;  1M19 D;  2JSS A;  2UWX A;  3UTA B;  4J8U B;  5B0Y B;  2HIO A;  4CAY A;  4UPK A;  4XZQ C;  3REH B;  1P3K D;  4H9S A;  4WU9 C;  3B6G C;  5B33 B;  3B6G D;  3MNN A;  1P3G C;  3MGP C;  5F99 C;  4J8W D;  3AZI D;  1P3G D;  3W96 B;  3MGP A;  4J8X C;  5F99 A;  1A7W A;  3REL C;  3AZE D;  1EQZ B;  3REL D;  4AWL C;  5CPK C;  1KX5 D;  4G91 B;  5CPK D;  3WKJ C;  1P3M A;  3VH6 W;  5JRG B;  5DNM A;  5B40 C;  3AV1 A;  2IO5 B;  3MGS B;  5B0Z B;  2F8N D;  2CV5 A;  2NZD A;  2ARO B;  3AZG A;  4X23 D;  4NE3 A;  2Y2O A;  1P3A A;  4KGC B;  1WWI A;  4EO5 B;  4CSR A;  3AV2 B;  3REI D;  3AZH C;  3AZH D;  1M18 A;  3W99 D;  1KX3 A;  1HTA A;  5B31 A;  1P3P A;  4E45 A;  5AY8 C;  3VH5 T;  4Z5T D;  3X1V C;  3X1V D;  5DNN A;  1ID3 D;  5AVC D;  3V9R A;  3AZF A;  4Z66 B;  4YM6 B;  5AV6 D;  1M1A A;  3KWQ D;  4G92 B;  2NQB A;  3REK B;  1BH8 B;  3LEL A;  3AFA C;  1KX4 A;  3AFA D;  1M19 B;  3EPH A;  3EG5 B;  3X1S D;  1P3K B;  5AVB C;  3AZM A;  2YFV B;  3B6G B;  1AOI A;  3X1T D;  3UT9 B;  1TZY A;  3H0M C;  3KSY A;  3B0D C;  5B2I D;  4J8W B;  3AZI B;  5CPI A;  1P3G B;  1P3F A;  3AZE B;  3REL B;  1KX5 B;  3WAA C;  3VH5 W;  4NE6 A;  5CPK B;  1KU5 A;  2W8S A;  4ZBJ C;  5B1M A;  1HQ3 C;  5GT3 C;  5B32 A;  5GT3 D;  5CP6 C;  2F8N B;  1T3U A;  3LJA D;  4X23 B;  3A6N A;  4JJN C;  5GSU A;  5B2J A;  5AV8 D;  3X1U C;  3X1U D;  4JJN A;  3REI B;  3AZH B;  5B1L D;  1P3I C;  2BYM B;  3W99 B;  1F66 D;  3R45 A;  3AZN A;  3LZ0 A;  3W97 C;  4QLC A;  4Z5T B;  2RVQ D;  3MGR A;  5AV5 A;  3X1V B;  1ID3 B;  2Y2G A;  2Y2Q A;  1P34 D;  5AVC B;  2HUE C;  5CPJ A;  2FJ7 D;  5B24 C;  5AV6 B;  3O62 C;  2Y2K A;  3A1I A;  4WNN A;  3C1C A;  3KWQ B;  3AZK C;  3AZK D;  2PYO C;  1PZR A;  5AV9 C;  5AV9 D;  5B0Y A;  3AFA B;  3WTP C;  1BH9 A;  3REH A;  4R8P C;  3TU4 D;  5B33 A;  3X1S B;  4KUD C;  3LZ1 A;  5E5A D;  3X1T B;  1EQZ A;  1U35 A;  3UTB D;  5B2I B;  4WZS B;  4WU8 D;  1ZLA C;  1S32 D;  1ZLA A;  4DRA A;  4DRB A;  3AN2 C;  3AN2 D;  4LD9 D;  2YFW B;  1Z2C B;  5BO0 A;  4ZBJ B;  4J8V A;  5GT3 B;  5G49 B;  3C1B C;  3WTP E;  3LJA B;  3C1B D;  4KGC A;  3AV2 A;  3W98 D;  1B67 A;  3VH6 A;  1P3O C;  3WA9 C;  1P3O D;  4M6B A;  5AV8 B;  3X1U B;  5GXQ A;  4UUZ A;  1WWS A;  2HIO C;  2JCH A;  2Y2J A;  5B1L B;  4H9S C;  1R4V A;  4XZQ D;  2G5H C;  1F66 B;  4WU9 D;  3MNN C;  3MNN D;  3KXB C;  3KXB A;  3FDD A;  3MGP D;  5F99 D;  4Z66 A;  5FUG B;  5BNV A;  4J8X D;  4YM6 A;  1P3M C;  1P34 B;  3AZJ C;  3WKJ D;  5DNM C;  3AV1 C;  3AZJ A;  4H9O A;  3REK A;  2HUE B;  2FJ7 B;  5B40 D;  1BH8 A;  5BT1 C;  2CV5 C;  2NZD C;  4WV4 B;  2CV5 D;  3AZG C;  2NZD D;  3AZK B;  1M19 A;  4H9N B;  2JE5 A;  1P3A C;  5AV9 B;  1P3A D;  2ZY2 A;  2BYK B;  2F8N G;  1M18 C;  4ZUX A;  1P3K A;  3AZL A;  1KX3 C;  3TU4 B;  4YS3 A;  3MVD A;  1KX3 D;  4Z2M G;  3UT9 A;  5B31 C;  1P3P C;  1BFM A;  5B31 D;  3AZI A;  4J8W A;  3NQJ A;  5AY8 D;  5E5A B;  1N1J A;  5GT0 C;  3AZE A;  5GT0 A;  3UTB B;  5DNN C;  1KX5 A;  4WU8 B;  1S32 B;  3AYW A;  4NE5 A;  3AZF C;  3AZF D;  2F8N A;  4KHA B;  2J8P A;  2F8N H;  1P3P D;  1M1A C;  3AN2 B;  4LD9 B;  4X23 A;  2NQB C;  2NQB D;  3MGQ C;  3C1B B;  3MGQ A;  3LEL C;  4XUJ C;  3W98 B;  1KX4 C;  3REJ A;  4H9Q A;  4XUJ A;  1KX4 D;  1P3O B;  2Y2H A;  3KUY C;  3H0R C;  4Z5T A;  4XZQ B;  3KUY A;  3AZM C;  5AVB D;  1AOI C;  4WU9 B;  4E44 A;  3MNN B;  1TAF A;  1TZY C;  2FFF B;  1TZY D;  1P3F C;  5CPI C;  1ID3 A;  5CPI D;  5AVC A;  3MGP B;  5F99 B;  4J8X B;  2Y2N A;  4NFT A;  5AV6 A;  4AWL B;  1P3L A;  1W2E A;  3KWQ A;  3WAA D;  2ZY3 A;  1ULY A;  5KDM A;  5B1M C;  5B32 C;  3WKJ B;  5B40 B;  1HQ3 D;  5CP6 D;  2CV5 B;  2NZD B;  1Q9C A;  3A6N C;  3A6N D;  5GSU C;  5B2J C;  1P3A B;  3B6F A;  4JJN D;  4CSR B;  3X1S A;  2DQN C;  1KX3 B;  1P3I D;  3AZN C;  3X1T A;  3LZ0 C;  3LZ0 D;  3F6T A;  5B31 B;  4QLC C;  5B2I A;  3MGR C;  3W97 D;  5AY8 B;  5AV5 C;  3MGR D;  5C3I C;  2RIQ A;  4HGA C;  3NQU B;  2YFW A;  3AZF B;  1P3B A;  5CPJ C;  5G49 A;  3LJA A;  3C1C C;  2Y2P A;  3C1C D;  5B24 D;  1H3O A;  3O62 D;  2L5A A;  2NQB B;  3EPK A;  2PYO D;  3AL0 C;  5AV8 A;  3UTA A;  4J8U A;  5B0Y C;  5B1L A;  3REH C;  3WTP D;  1F66 A;  2F2A C;  5B33 C;  3LZ1 C;  4R8P D;  3LZ1 D;  2CWE A;  4KUD D;  5AVB B;  3W96 A;  1EQZ C;  1U35 C;  5FUG A;  3EPJ A;  1U35 D;  1TZY B;  5CPI B;  1P34 A;  5JRG C;  3B0D B;  3P5J B;  2IO5 C;  4H9P B;  5JRG A;  1ZLA D;  2FJ7 A;  2XD5 A;  3MGS A;  5B0Z A;  3WAA B;  2LY8 A;  2ARO A;  4J8V C;  4H9N A;  4J8V D;  1HQ3 B;  5CP6 B;  4KGC C;  4EO5 C;  3AV2 C;  2BYK A;  3A6N B;  3B0B A;  3WA9 D;  4JJN B;  3TU4 A;  5GXQ C;  5GXQ D;  2HIO D;  1P3I B;  5JA4 B;  5BNX B;  3UTB A;  3LZ0 B;  1B6W A;  4WU8 A;  3KXB D;  3W97 B;  2ZM5 A;  4Z66 C;  4KHA A;  4YM6 C;  1P3M D;  4G92 C;  4H9R B;  3REK C;  3AZJ D;  5DNM D;  3AV1 D;  3C1C B;  3H0L C;  4WNN B;  5B24 B;  5BT1 D;  3O62 B;  5BS7 A;  1M19 C;  3AZG D;  2PYO B;  1BH9 B;  3B0C T;  3WTP B;  4ZUX C;  1P3K C;  4ZUX D;  3AZL C;  4XZQ A;  3AZL D;  1M18 D;  4YS3 C;  3MVD C;  1JFI B;  4YS3 D;  3MVD D;  2YFV A;  4WU9 A;  4R8P B;  2VQR A;  3LZ1 B;  3B6G A;  2G5I C;  3UT9 C;  4KUD B;  3UT9 D;  3AZI C;  4J8W C;  1P3G A;  3AZE C; 
#chains in the Genus database with same CATH homology
 4J8X A;  1U35 B;  1KX5 C;  5GT0 D;  3REL A;  5CPK A;  3AYW C;  5DNN D;  3AYW D;  3WKJ A;  1ZLA B;  4WJ3 C;  5B40 A;  5B31 G;  2F8N K;  4X23 C;  1M1A D;  5BO0 B;  4J8V B;  2Y2L A;  3MGQ D;  2XD1 A;  2BG1 A;  4Z2M H;  3REJ C;  3VH5 A;  3LEL D;  4XUJ D;  3REI C;  3REJ D;  3WA9 B;  3REI A;  3W99 C;  3AZH A;  2BYM A;  3W99 A;  5GXQ B;  4UUZ B;  2HIO B;  4Z5T C;  4CAY B;  3KUY D;  5AY8 A;  3AZM D;  3B0C W;  1AOI D;  3X1V A;  1ID3 C;  3KXB B;  3NQU A;  5AVC C;  1P3F D;  3A1K A;  5BNV B;  5AV6 C;  1P3L C;  3KWQ C;  1P3L D;  1P3M B;  3AZJ B;  4H9O B;  5DNM B;  3AV1 B;  5B1M D;  5B32 D;  5CHL B;  3AFA A;  3AZG B;  3B6F C;  2ZY5 A;  5GSU D;  3B6F D;  3EPL A;  5B2J D;  3X1S C;  5B32 G;  4ZUX B;  3AZL B;  1M18 B;  5AVB A;  4YS3 B;  3MVD B;  3X1T C;  5B2I C;  3AZN D;  1P3P B;  4QLC D;  3NQJ B;  4H9P A;  1N1J B;  5AV5 D;  5GT0 B;  2DF4 C;  3WAA A;  5DNN B;  3AYW B;  1P3B C;  1P3B D;  3V9R B;  3LJA C;  1HQ3 A;  5GT3 A;  5CP6 A;  5CPJ D;  1M1A B;  5AV8 C;  3MGQ B;  2Y2I A;  4J8U C;  3UTA C;  3UTA D;  3X1U A;  4J8U D;  4H9Q B;  4XUJ B;  3LEL B;  3REJ B;  1KX4 B;  5B1L C;  5B0Y D;  3REH D;  1P3I A;  1F66 C;  5JA4 A;  5BNX A;  5B33 D;  2RVQ C;  3KUY B;  3W97 A;  3KFU G;  3W96 C;  3AZM B;  3W96 D;  1AOI B;  1TAF B;  1EQZ D;  4G91 C;  3IP4 C;  1P34 C;  1F1E A;  1P3F B;  4DQY B;  4H9R A;  5JRG D;  2FJ7 C;  3MGS C;  5B0Z C;  3MGS D;  5B0Z D;  1P3L B;  5B24 A;  5KDM B;  3O62 A;  2ARO C;  3AZK A;  2ARO D;  2PYO A;  5B1M B;  5B32 B;  5AV9 A;  2Y2M A;  4KGC D;  3AV2 D;  3WTP A;  5GSU B;  3TU4 C;  3B6F B;  1JFI A;  5B2J B;  4R8P A;  4KUD A;  5E5A C;  3VH6 T;  3R45 B;  5E5A A;  3UTB C;  3AZN B;  4WU8 C;  1S32 C;  4QLC B;  1S32 A;  3MGR B;  5AV5 B;  5C3I B;  4Z66 D;  4LD9 C;  4YM6 D;  3AN2 A;  4LD9 A;  4HGA B;  1P3B B;  5CPJ B;  3REK D;  3W98 C;  3C1B A;  2ZY4 A;  3W98 A;  1H3O B;  5BS7 C;  1P3O A;  3WA9 A;  1M19 D;  2JSS A;  2UWX A;  3UTA B;  4J8U B;  5B0Y B;  2HIO A;  4CAY A;  4UPK A;  4XZQ C;  3REH B;  1P3K D;  4H9S A;  4WU9 C;  3B6G C;  5B33 B;  3B6G D;  3MNN A;  1P3G C;  3MGP C;  5F99 C;  4J8W D;  3AZI D;  1P3G D;  3W96 B;  3MGP A;  4J8X C;  5F99 A;  1A7W A;  3REL C;  3AZE D;  1EQZ B;  3REL D;  4AWL C;  5CPK C;  1KX5 D;  4G91 B;  5CPK D;  3WKJ C;  1P3M A;  3VH6 W;  5JRG B;  5DNM A;  5B40 C;  3AV1 A;  2IO5 B;  3MGS B;  5B0Z B;  2F8N D;  2CV5 A;  2NZD A;  2ARO B;  3AZG A;  4X23 D;  4NE3 A;  2Y2O A;  1P3A A;  4KGC B;  1WWI A;  4EO5 B;  4CSR A;  3AV2 B;  3REI D;  3AZH C;  3AZH D;  1M18 A;  3W99 D;  1KX3 A;  1HTA A;  5B31 A;  1P3P A;  4E45 A;  5AY8 C;  3VH5 T;  4Z5T D;  3X1V C;  3X1V D;  5DNN A;  1ID3 D;  5AVC D;  3V9R A;  3AZF A;  4Z66 B;  4YM6 B;  5AV6 D;  1M1A A;  3KWQ D;  4G92 B;  2NQB A;  3REK B;  1BH8 B;  3LEL A;  3AFA C;  1KX4 A;  3AFA D;  1M19 B;  3EPH A;  3EG5 B;  3X1S D;  1P3K B;  5AVB C;  3AZM A;  2YFV B;  3B6G B;  1AOI A;  3X1T D;  3UT9 B;  1TZY A;  3H0M C;  3KSY A;  3B0D C;  5B2I D;  4J8W B;  3AZI B;  5CPI A;  1P3G B;  1P3F A;  3AZE B;  3REL B;  1KX5 B;  3WAA C;  3VH5 W;  4NE6 A;  5CPK B;  1KU5 A;  2W8S A;  4ZBJ C;  5B1M A;  1HQ3 C;  5GT3 C;  5B32 A;  5GT3 D;  5CP6 C;  2F8N B;  1T3U A;  3LJA D;  4X23 B;  3A6N A;  4JJN C;  5GSU A;  5B2J A;  5AV8 D;  3X1U C;  3X1U D;  4JJN A;  3REI B;  3AZH B;  5B1L D;  1P3I C;  2BYM B;  3W99 B;  1F66 D;  3R45 A;  3AZN A;  3LZ0 A;  3W97 C;  4QLC A;  4Z5T B;  2RVQ D;  3MGR A;  5AV5 A;  3X1V B;  1ID3 B;  2Y2G A;  2Y2Q A;  1P34 D;  5AVC B;  2HUE C;  5CPJ A;  2FJ7 D;  5B24 C;  5AV6 B;  3O62 C;  2Y2K A;  3A1I A;  4WNN A;  3C1C A;  3KWQ B;  3AZK C;  3AZK D;  2PYO C;  1PZR A;  5AV9 C;  5AV9 D;  5B0Y A;  3AFA B;  3WTP C;  1BH9 A;  3REH A;  4R8P C;  3TU4 D;  5B33 A;  3X1S B;  4KUD C;  3LZ1 A;  5E5A D;  3X1T B;  1EQZ A;  1U35 A;  3UTB D;  5B2I B;  4WZS B;  4WU8 D;  1ZLA C;  1S32 D;  1ZLA A;  4DRA A;  4DRB A;  3AN2 C;  3AN2 D;  4LD9 D;  2YFW B;  1Z2C B;  5BO0 A;  4ZBJ B;  4J8V A;  5GT3 B;  5G49 B;  3C1B C;  3WTP E;  3LJA B;  3C1B D;  4KGC A;  3AV2 A;  3W98 D;  1B67 A;  3VH6 A;  1P3O C;  3WA9 C;  1P3O D;  4M6B A;  5AV8 B;  3X1U B;  5GXQ A;  4UUZ A;  1WWS A;  2HIO C;  2JCH A;  2Y2J A;  5B1L B;  4H9S C;  1R4V A;  4XZQ D;  2G5H C;  1F66 B;  4WU9 D;  3MNN C;  3MNN D;  3KXB C;  3KXB A;  3FDD A;  3MGP D;  5F99 D;  4Z66 A;  5FUG B;  5BNV A;  4J8X D;  4YM6 A;  1P3M C;  1P34 B;  3AZJ C;  3WKJ D;  5DNM C;  3AV1 C;  3AZJ A;  4H9O A;  3REK A;  2HUE B;  2FJ7 B;  5B40 D;  1BH8 A;  5BT1 C;  2CV5 C;  2NZD C;  4WV4 B;  2CV5 D;  3AZG C;  2NZD D;  3AZK B;  1M19 A;  4H9N B;  2JE5 A;  1P3A C;  5AV9 B;  1P3A D;  2ZY2 A;  2BYK B;  2F8N G;  1M18 C;  4ZUX A;  1P3K A;  3AZL A;  1KX3 C;  3TU4 B;  4YS3 A;  3MVD A;  1KX3 D;  4Z2M G;  3UT9 A;  5B31 C;  1P3P C;  1BFM A;  5B31 D;  3AZI A;  4J8W A;  3NQJ A;  5AY8 D;  5E5A B;  1N1J A;  5GT0 C;  3AZE A;  5GT0 A;  3UTB B;  5DNN C;  1KX5 A;  4WU8 B;  1S32 B;  3AYW A;  4NE5 A;  3AZF C;  3AZF D;  2F8N A;  4KHA B;  2J8P A;  2F8N H;  1P3P D;  1M1A C;  3AN2 B;  4LD9 B;  4X23 A;  2NQB C;  2NQB D;  3MGQ C;  3C1B B;  3MGQ A;  3LEL C;  4XUJ C;  3W98 B;  1KX4 C;  3REJ A;  4H9Q A;  4XUJ A;  1KX4 D;  1P3O B;  2Y2H A;  3KUY C;  3H0R C;  4Z5T A;  4XZQ B;  3KUY A;  3AZM C;  5AVB D;  1AOI C;  4WU9 B;  4E44 A;  3MNN B;  1TAF A;  1TZY C;  2FFF B;  1TZY D;  1P3F C;  5CPI C;  1ID3 A;  5CPI D;  5AVC A;  3MGP B;  5F99 B;  4J8X B;  2Y2N A;  4NFT A;  5AV6 A;  4AWL B;  1P3L A;  1W2E A;  3KWQ A;  3WAA D;  2ZY3 A;  1ULY A;  5KDM A;  5B1M C;  5B32 C;  3WKJ B;  5B40 B;  1HQ3 D;  5CP6 D;  2CV5 B;  2NZD B;  1Q9C A;  3A6N C;  3A6N D;  5GSU C;  5B2J C;  1P3A B;  3B6F A;  4JJN D;  4CSR B;  3X1S A;  2DQN C;  1KX3 B;  1P3I D;  3AZN C;  3X1T A;  3LZ0 C;  3LZ0 D;  3F6T A;  5B31 B;  4QLC C;  5B2I A;  3MGR C;  3W97 D;  5AY8 B;  5AV5 C;  3MGR D;  5C3I C;  2RIQ A;  4HGA C;  3NQU B;  2YFW A;  3AZF B;  1P3B A;  5CPJ C;  5G49 A;  3LJA A;  3C1C C;  2Y2P A;  3C1C D;  5B24 D;  1H3O A;  3O62 D;  2L5A A;  2NQB B;  3EPK A;  2PYO D;  3AL0 C;  5AV8 A;  3UTA A;  4J8U A;  5B0Y C;  5B1L A;  3REH C;  3WTP D;  1F66 A;  2F2A C;  5B33 C;  3LZ1 C;  4R8P D;  3LZ1 D;  2CWE A;  4KUD D;  5AVB B;  3W96 A;  1EQZ C;  1U35 C;  5FUG A;  3EPJ A;  1U35 D;  1TZY B;  5CPI B;  1P34 A;  5JRG C;  3B0D B;  3P5J B;  2IO5 C;  4H9P B;  5JRG A;  1ZLA D;  2FJ7 A;  2XD5 A;  3MGS A;  5B0Z A;  3WAA B;  2LY8 A;  2ARO A;  4J8V C;  4H9N A;  4J8V D;  1HQ3 B;  5CP6 B;  4KGC C;  4EO5 C;  3AV2 C;  2BYK A;  3A6N B;  3B0B A;  3WA9 D;  4JJN B;  3TU4 A;  5GXQ C;  5GXQ D;  2HIO D;  1P3I B;  5JA4 B;  5BNX B;  3UTB A;  3LZ0 B;  1B6W A;  4WU8 A;  3KXB D;  3W97 B;  2ZM5 A;  4Z66 C;  4KHA A;  4YM6 C;  1P3M D;  4G92 C;  4H9R B;  3REK C;  3AZJ D;  5DNM D;  3AV1 D;  3C1C B;  3H0L C;  4WNN B;  5B24 B;  5BT1 D;  3O62 B;  5BS7 A;  1M19 C;  3AZG D;  2PYO B;  1BH9 B;  3B0C T;  3WTP B;  4ZUX C;  1P3K C;  4ZUX D;  3AZL C;  4XZQ A;  3AZL D;  1M18 D;  4YS3 C;  3MVD C;  1JFI B;  4YS3 D;  3MVD D;  2YFV A;  4WU9 A;  4R8P B;  2VQR A;  3LZ1 B;  3B6G A;  2G5I C;  3UT9 C;  4KUD B;  3UT9 D;  3AZI C;  4J8W C;  1P3G A;  3AZE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...