3B6GD

Nucleosome core particle treated with oxaliplatin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 101
sequence length 101
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gD00
5CHLB 1TZYC 1P34D 4H9OB 5B0ZD 5B2IA 5B0ZB 3V9RA 5B0YA 3AYWD 3AYWB 3KUYD 3KUYB 3W97C 3LELC 3X1SD 3X1SB 4XUJA 5BO0B 4WNNB 3MGRA 1WWSA 2PYOA 5AY8C 4NFTA 3AZJD 2CWEA 2HUEB 5B32C 5B32G 5GT3C 3LZ0A 3AFAD 3AFAB 1S32C 5BNVB 1KU5A 5GXQB 3VH6W 1P3KA 3AZKD 3AZKB 5BS7C 3REJA 4Z5TD 4Z5TB 5CPIA 3B0DB 1R4VA 5AVBC 5B1LC 3X1TA 4J8VD 4J8VB 1KX4D 1KX4B 4J8XD 5DNNC 4AWLC 1EQZC 5F99D 5F99B 4J8UD 4J8UB 3AZFC 2HIOC 4J8WA 3NQJB 1P34A 4CSRB 1P3GB 1P3GD 5B1MD 5B1MB 5CPKC 2CV5B 5B0ZA 2CV5D 3REIC 3WAAD 3AYWA 1ID3D 1ID3B 3LJAC 3AZEC 3X1SA 3A6NC 2NZDC 3AZMA 4WNNA 3B6FB 3B6FD 1HQ3D 1HQ3B 3VH5T 4ZUXC 3B0CW 4KUDD 4CAYA 3AZJA 4KUDB 5CP6D 5CP6B 3UT9D 3UTAD 3KUYC 3MGPD 3MGPB 3MVDC 4WU9D 4X23C 4WU9B 3W99D 3W99B 3VH6A 4EO5B 4Z2MG 2YFVB 2F8NH 3C1BC 3AZKA 4KHAB 3AFAC 4Z5TA 3W98C 3MGSA 3W96C 1P3LA 1TAFB 3RELD 3RELB 5GXQC 1P3BB 3LELD 3LELB 4J8VA 4LD9C 2AROD 2AROB 4J8XA 4H9NB 2F8NK 1P3MA 3WA9D 3WA9B 3B0DC 4QLCA 5F99A 5FUGB 4J8UA 1U35A 3NQJA 3C1CC 5B32D 5B32B 4Z2MH 3WTPA 3UTBC 2CV5A 3WAAA 1S32D 1S32B 5JRGA 1KX4C 5GSUA 3X1UA 4G91C 1ZLAA 3NQUB 3AZIB 5B1MC 3AZID 1M18A 3UT9A 3UTAA 4ZBJB 3MGPA 1ID3C 5AVCC 5AV8D 5AV8B 3B6FC 2YFVA 1HQ3C 1P3AB 5DNND 5DNNB 3MGQB 3MGQD 5JA4A 4AWLB 4YS3C 1P3PB 4KUDC 5CP6C 1B6WA 4KHAA 1TZYA 3AZFD 1B67A 2F8NB 4WU9C 2F8ND 1TAFA 3W99C 5DNMA 1P3OD 1P3OB 4EO5C 4UUZB 3WKJB 1M19C 3W97A 3LJAD 3LELA 3WKJD 3AZED 3AZEB 3A6ND 3A6NB 2NZDB 2NZDD 4WU8C 4H9NA 3O62C 4KGCC 1BFMA 4ZUXD 4ZUXB 5AY8A 4YM6B 3AZLC 3TU4D 3TU4B 3RELC 5B32A 3KWQC 5GT3A 1P3BC 1S32A 2BYKB 3MVDD 4X23D 4X23B 3MVDB 3AN2B 2AROC 1P3IC 4G92B 3WA9C 3C1BD 3C1BB 1H3OB 5BS7A 1AOID 1AOIB 3W98D 3W98B 3AV1C 5AVBA 3W96B 2YFWA 3W96D 5B1LA 4H9PA 5GXQD 2FJ7C 1BH8B 4LD9B 4LD9D 5BNXA 5DNNA 3AZIC 2IO5B 1EQZA 5GT0C 4DRAA 4ZBJC 2HIOA 3C1CD 4H9RA 3LZ1D 3LZ1B 3C1CB 3AZFA 2F8NA 3UTBD 3UTBB 5AV8C 5CPKA 3REIA 4R8PD 4R8PB 1P3AC 3AZNA 1BH9B 3LJAA 3MGQC 3AZEA 1P3PC 3A6NA 1ULYA 2NZDA 4G91B 5B33B 4H9OA 4ZUXA 2F8NG 4WZSB 3MNNC 1P3OC 5B40C 3KUYA 3WKJC 5AVCD 5AVCB 2BYKA 4X23A 4NE3A 5BO0A 3C1BA 4YM6C 4YS3D 4YS3B 5AV6C 1H3OA 3TU4C 1KX3C 2BYMB 3AFAA 3WTPE 4JJNB 3W98A 3W96A 3AN2C 5BNVA 4NE5A 5GXQA 4G92C 1M19D 1M19B 1P3FC 1BH8A 4LD9A 4WU8D 4WU8B 3O62D 3O62B 1AOIC 4KGCB 4KGCD 4NE6A 4HGAB 3AZLD 3AZLB 1F66B 1F66D 3C1CA 3KWQD 3KWQB 3REHB 3UTBA 1P3BD 5B2JC 1KX4A 1BH9A 1P3ID 1P3IB 2IO5C 3KXBD 3KXBB 5CPJC 3AZMC 3LZ1C 5E5AB 4H9QB 4CSRA 1P3GA 5B1MA 3AV1D 3AV1B 5B31D 5B31B 4R8PC 1JFIB 1ID3A 5AVCA 4Z66D 4Z66B 2FJ7B 2FJ7D 3B6FA 5B33C 1HQ3A 4YS3A 3AV2D 3AV2B 1M1AB 1KX5C 4KUDA 5CP6A 4XZQC 5GT0D 5GT0B 3B6GC 4WU9A 3VH6T 3W99A 3V9RB 1P3AD 1P3PD 3X1VC 4WU8A 4KGCA 3O62A 3B0BA 4JJNC 4QLCC 3AZLA 2LY8A 3REKC 3MNND 5B24C 3MNNB 3RELA 4E44A 4M6BA 3KWQA 5B40D 5B40B 1P3BA 3LZ0D 3LZ0B 3VH5W 5AV5C 2AROA 1P3IA 5AV9C 3WA9A 4WV4B 5FUGA 4YM6D 4HGAC 1F66C 2NQBC 5AV6D 5AV6B 1KX3D 1KX3B 3REHC 4H9QA 3REJB 2L5AA 3AV1A 1JFIA 3AN2D 1HTAA 1N1JB 3B0CT 2FJ7A 1P3FD 1P3FB 3KXBC 1WWIA 5E5AC 3NQUA 3AZIA 5GT0A 5B31C 5B31G 3R45B 4J8WD 4J8WB 1P34B 5AV8A 5B2JD 5B2JB 4Z66C 5DNMC 1P3AA 3AZHC 3AZGC 4H9SC 3MGQA 1M1AC 3AV2C 1P3PA 5CPJD 5CPJB 3AZMD 3AZMB 2JSSA 3MNNA 4CAYB 3AZJB 1P3OA 3VH5A 5B2IC 5B40A 5B0YC 4UUZA 3WKJA 4XUJC 5B33D 3MGRC 4YM6A 2PYOC 1KX5D 5AV6A 3TU4A 1KX3A 4XZQD 4XZQB 1KX5B 3KSYA 3LZ0C 3MGSD 3MGSB 3AN2A 3MVDA 3B6GB 3B6GD 5C3IB 1P3LB 1P3LD 1N1JA 1P3FA 1P3KC 3X1VD 3X1VB 4J8XB 3REJC 1AOIA 4JJND 1P3MD 1P3MB 5CPIC 4QLCD 4QLCB 3REKD 3R45A 5BT1C 5B24D 5B24B 3REKB 1U35D 1U35B 3WTPD 3WTPB 5B2JA 2RVQC 3X1TC 3WAAB 5JRGD 5JRGB 5AV5D 5AV5B 3AZNC 5GSUD 5GSUB 5AV9D 5AV9B 3X1UD 3X1UB 5CPJA 2NQBD 2NQBB 1ZLAD 1ZLAB 3REHD 3LZ1A 4J8WC 1P34C 5B0ZC 4R8PA 3UT9B 1M18B 3UTAB 1M18D 3AYWC 5G49B 3X1SC 5B33A 5KDMB 5E5AD 5JA4B 1KX5A 4XZQA 2HUEC 3AZJC 1Q9CA 1TZYD 1TZYB 1A7WA 3B6GA 5DNMD 5DNMB 3AZHD 3AZHB 3AZGD 3AZGB 1F1EA 3W97D 3W97B 1M1AD 3X1VA 3AZKC 2BYMA 4E45A 4JJNA 4Z5TC 3MGSC 5C3IC 3REKA 5AY8D 5AY8B 5B24A 1P3LC 5B2ID 5B2IB 5B0YD 5B0YB 5GT3D 5GT3B 1M19A 4J8VC 5AV5A 4J8XC 4XUJD 4XUJB 5AV9A 3MGRD 3MGRB 1P3MC 5F99C 1F66A 2NQBA 4J8UC 2PYOD 2PYOB 3REHA 1U35C 3WTPC 1P3GC 4DRBA 2CV5C 3WAAC 5AVBD 5JRGC 5AVBB 2YFWB 5G49A 5B1LD 5B1LB 4H9PB 5GSUC 3X1UC 3KXBA 1P3KD 1P3KB 5KDMA 1ZLAC 5E5AA 5BNXB 3REJD 1EQZD 5CPID 5CPIB 5B31A 1M18C 3UT9C 1EQZB 3UTAC 5BT1D 2HIOD 2HIOB 3MGPC 4H9RB 3AZFB 2RVQD 3X1TD 4Z66A 3X1TB 5CPKB 5CPKD 3REID 3REIB 3AZHA 3AZGA 4H9SA 3AZND 3AZNB 3LJAB 1M1AA 3AV2A
chains in the Genus database with same CATH superfamily
5CHLB 1TZYC 1P34D 4H9OB 5B0ZD 5B2IA 5B0ZB 3V9RA 5B0YA 3AYWD 3AYWB 3KUYD 3KUYB 3W97C 3LELC 3X1SD 3X1SB 4XUJA 5BO0B 4WNNB 3MGRA 1WWSA 2PYOA 5AY8C 4NFTA 3AZJD 2CWEA 2HUEB 5B32C 5B32G 5GT3C 3LZ0A 3AFAD 3AFAB 2ZY5A 1S32C 2ZM5A 5BNVB 2RIQA 1KU5A 5GXQB 2DF4C 3VH6W 1P3KA 2Y2NA 3AZKD 3AZKB 5BS7C 3REJA 4Z5TD 4Z5TB 5CPIA 3B0DB 2G5IC 1R4VA 5AVBC 5B1LC 3X1TA 4J8VD 4J8VB 1KX4D 1KX4B 4J8XD 5DNNC 4AWLC 1EQZC 5F99D 5F99B 2G5HC 4J8UB 4J8UD 3AZFC 2HIOC 4J8WA 3NQJB 1P34A 4CSRB 1P3GB 2W8SA 5B1MD 5B1MB 5CPKC 2CV5B 5B0ZA 2CV5D 3REIC 3WAAD 3AYWA 1ID3D 1ID3B 3LJAC 3AZEC 3X1SA 3A6NC 2NZDC 2Y2LA 3AZMA 4WNNA 3AV2A 3B6FB 3B6FD 1HQ3D 1HQ3B 3VH5T 4ZUXC 3B0CW 4KUDD 4CAYA 3AZJA 4KUDB 5CP6D 5CP6B 3UT9D 3UTAD 3KUYC 3MGPD 3MGPB 2XD5A 3MVDC 4WU9D 4X23C 4WU9B 3W99D 1P3GD 3W99B 3VH6A 4EO5B 4Z2MG 2YFVB 3EPLA 2F8NH 3C1BC 3AZKA 4KHAB 3AFAC 4Z5TA 3W98C 3MGSA 3W96C 1P3LA 1TAFB 3RELD 3RELB 3EPHA 5GXQC 1P3BB 3LELD 3LELB 4J8VA 4LD9C 2AROD 2AROB 4J8XA 4H9NB 2F8NK 1P3MA 3WA9D 3WA9B 3B0DC 4QLCA 5F99A 5FUGB 4J8UA 1U35A 3NQJA 3C1CC 5B32D 2ZY2A 5B32B 4Z2MH 3WTPA 3UTBC 2CV5A 3WAAA 1S32D 1S32B 5JRGA 1KX4C 5GSUA 2Y2IA 3X1UA 4G91C 2JCHA 1ZLAA 3A1IA 3NQUB 2Y2OA 5B1MC 3AZIB 3AZID 1M18A 3UT9A 3UTAA 4ZBJB 3MGPA 1ID3C 5AVCC 5AV8D 5AV8B 3B6FC 2YFVA 1HQ3C 4DQYB 1P3AB 5DNND 5DNNB 3MGQB 3MGQD 5JA4A 4AWLB 4YS3C 1P3PB 4KUDC 5CP6C 1B6WA 4KHAA 1TZYA 3AZFD 1B67A 2F8NB 4WU9C 2F8ND 1TAFA 3W99C 5DNMA 1P3OD 1P3OB 4EO5C 4UUZB 3WKJB 1M19C 3W97A 3LJAD 3LELA 3WKJD 3AZED 3AZEB 3A6ND 3A6NB 2NZDB 2NZDD 4WU8C 4H9NA 3O62C 4KGCC 1BFMA 4ZUXD 4ZUXB 5AY8A 4YM6B 3AZLC 3TU4D 3TU4B 3RELC 5B32A 3KWQC 2Y2MA 5GT3A 1P3BC 1S32A 2BYKB 3MVDD 4X23D 4X23B 3MVDB 3AN2B 2AROC 1P3IC 4G92B 3WA9C 3C1BD 3C1BB 1H3OB 5BS7A 1AOID 1AOIB 3W98D 3W98B 3AV1C 5AVBA 3W96B 2YFWA 3W96D 5B1LA 4H9PA 2Y2QA 2UWXA 5GXQD 2FJ7C 1BH8B 4LD9B 4LD9D 5BNXA 5DNNA 3AZIC 2IO5B 1EQZA 5GT0C 2Y2PA 4DRAA 4ZBJC 2HIOA 3C1CD 4H9RA 3LZ1D 3LZ1B 3C1CB 3AZFA 2F8NA 3UTBD 3UTBB 5AV8C 5CPKA 3REIA 4R8PD 4R8PB 1P3AC 3AZNA 1BH9B 3LJAA 3MGQC 3AZEA 1P3PC 3A6NA 1ULYA 2NZDA 4G91B 5B33B 4H9OA 4ZUXA 2F8NG 2ZY4A 4WZSB 3MNNC 1P3OC 5B40C 3KUYA 3WKJC 5AVCD 5AVCB 2BYKA 4X23A 4NE3A 1Z2CB 5BO0A 3EPKA 3C1BA 4YM6C 4YS3D 4YS3B 5AV6C 1H3OA 3TU4C 1KX3C 2BYMB 3AFAA 3WTPE 4JJNB 3W98A 3W96A 3AN2C 5BNVA 3H0LC 4NE5A 5GXQA 4G92C 1M19D 1M19B 1P3FC 1BH8A 4LD9A 4WU8D 4WU8B 3O62D 3O62B 1AOIC 4KGCB 4KGCD 4NE6A 4HGAB 3AZLD 3AZLB 1F66B 1F66D 3F6TA 3C1CA 3KWQD 3KWQB 3REHB 3UTBA 1P3BD 5B2JC 1KX4A 1BH9A 1P3ID 1P3IB 2IO5C 3KXBD 3KXBB 5CPJC 3AZMC 3LZ1C 5E5AB 4H9QB 4CSRA 1P3GA 5B1MA 3AV1D 3AV1B 5B31D 5B31B 2Y2JA 3EG5B 4R8PC 1JFIB 1ID3A 5AVCA 4Z66D 4Z66B 2FJ7B 2FJ7D 3B6FA 5B33C 1HQ3A 4YS3A 3AV2D 3AV2B 1M1AB 1KX5C 4KUDA 5CP6A 4XZQC 5GT0D 5GT0B 3B6GC 4WU9A 3VH6T 3W99A 3V9RB 1P3AD 1P3PD 2DQNC 3X1VC 4WU8A 4KGCA 3O62A 3B0BA 4JJNC 4QLCC 3AZLA 2LY8A 3REKC 3MNND 5B24C 3MNNB 3RELA 4E44A 4M6BA 3KWQA 5B40D 5B40B 1P3BA 3LZ0D 3LZ0B 2Y2KA 3VH5W 5AV5C 2AROA 1P3IA 5AV9C 3WA9A 4WV4B 5FUGA 4HGAC 4YM6D 1F66C 2NQBC 5AV6D 5AV6B 1KX3D 1KX3B 3REHC 4H9QA 3REJB 2L5AA 3AV1A 1JFIA 3AN2D 1HTAA 1N1JB 3B0CT 2FJ7A 1P3FD 1P3FB 3KXBC 1WWIA 5E5AC 3NQUA 3AZIA 2F2AC 5GT0A 5B31C 5B31G 3R45B 4J8WD 4J8WB 1P34B 5AV8A 5B2JD 5B2JB 4Z66C 5DNMC 1P3AA 3AZHC 3AZGC 4H9SC 3MGQA 1M1AC 3AV2C 1P3PA 2JE5A 5CPJD 5CPJB 3AZMD 3AZMB 2JSSA 3MNNA 4CAYB 3AZJB 1P3OA 3VH5A 5B2IC 5B40A 5B0YC 4UUZA 3WKJA 2BG1A 4XUJC 5B33D 3MGRC 4YM6A 2PYOC 1KX5D 5AV6A 3TU4A 1KX3A 3IP4C 4XZQB 4XZQD 1KX5B 3KSYA 3LZ0C 3MGSD 3MGSB 3AN2A 3MVDA 3B6GB 3B6GD 5C3IB 1P3LB 1P3LD 1N1JA 1P3FA 1P3KC 3A1KA 3X1VB 3X1VD 4J8XB 3REJC 1AOIA 4JJND 3H0MC 1P3MD 1P3MB 5CPIC 4QLCD 4QLCB 3REKD 3R45A 5BT1C 5B24D 5B24B 3REKB 1U35D 1U35B 3WTPD 3WTPB 5B2JA 2RVQC 3X1TC 3WAAB 5JRGD 5JRGB 1T3UA 3KFUG 5AV5D 5AV5B 3AZNC 5GSUD 5GSUB 5AV9D 5AV9B 3X1UD 3X1UB 2XD1A 5CPJA 2NQBD 2NQBB 1ZLAD 1ZLAB 3REHD 3LZ1A 4J8WC 1P34C 3H0RC 3FDDA 5B0ZC 4R8PA 3UT9B 1M18B 3UTAB 1M18D 3AYWC 5G49B 3X1SC 3AL0C 5B33A 4UPKA 5KDMB 5E5AD 2VQRA 5JA4B 1KX5A 4XZQA 2HUEC 3AZJC 1Q9CA 1TZYD 1TZYB 3EPJA 1A7WA 3B6GA 1PZRA 2Y2HA 5DNMD 5DNMB 3AZHD 3AZHB 3AZGD 3AZGB 1F1EA 3W97D 3W97B 1M1AD 3X1VA 3AZKC 2BYMA 4E45A 4JJNA 4Z5TC 3MGSC 5C3IC 1W2EA 5AY8D 3P5JB 5AY8B 5B24A 3REKA 1P3LC 5B2ID 5B2IB 5B0YD 5B0YB 5GT3D 5GT3B 1M19A 4J8VC 5AV5A 4J8XC 4XUJD 4XUJB 5AV9A 3MGRD 3MGRB 1P3MC 2J8PA 5F99C 1F66A 2NQBA 4J8UC 2PYOD 2PYOB 3REHA 1U35C 2ZY3A 3WTPC 4WJ3C 1P3GC 4DRBA 2CV5C 3WAAC 5AVBD 5JRGC 5AVBB 2YFWB 5G49A 5B1LD 5B1LB 4H9PB 5GSUC 3X1UC 3KXBA 1P3KD 1P3KB 5KDMA 1ZLAC 5E5AA 5BNXB 3REJD 1EQZD 5CPID 2Y2GA 5B31A 5CPIB 3UT9C 1M18C 3UTAC 1EQZB 5BT1D 2HIOD 2HIOB 3MGPC 4H9RB 3AZFB 2RVQD 3X1TD 4Z66A 3X1TB 5CPKB 5CPKD 3REID 3REIB 3AZHA 3AZGA 4H9SA 3AZND 3AZNB 3LJAB 1M1AA 2FFFB
chains in the Genus database with same CATH topology
5CHLB 1TZYC 1P34D 4H9OB 5B0ZD 5B2IA 5B0ZB 3V9RA 5B0YA 3AYWD 3AYWB 3KUYD 3KUYB 3W97C 3LELC 3X1SD 3X1SB 4XUJA 5BO0B 4WNNB 3MGRA 1WWSA 2PYOA 5AY8C 4NFTA 3AZJD 2CWEA 2HUEB 5B32C 5B32G 5GT3C 3LZ0A 3AFAD 3AFAB 2ZY5A 1S32C 2ZM5A 5BNVB 2RIQA 1KU5A 5GXQB 2DF4C 3VH6W 1P3KA 2Y2NA 3AZKD 3AZKB 5BS7C 3REJA 4Z5TD 4Z5TB 5CPIA 3B0DB 2G5IC 1R4VA 5AVBC 5B1LC 3X1TA 4J8VD 4J8VB 1KX4D 1KX4B 4J8XD 5DNNC 4AWLC 1EQZC 5F99D 5F99B 2G5HC 4J8UB 4J8UD 3AZFC 2HIOC 4J8WA 3NQJB 1P34A 4CSRB 1P3GB 2W8SA 5B1MD 5B1MB 5CPKC 2CV5B 5B0ZA 2CV5D 3REIC 3WAAD 3AYWA 1ID3D 1ID3B 3LJAC 3AZEC 3X1SA 3A6NC 2NZDC 2Y2LA 3AZMA 4WNNA 3AV2A 3B6FB 3B6FD 1HQ3D 1HQ3B 3VH5T 4ZUXC 3B0CW 4KUDD 4CAYA 3AZJA 4KUDB 5CP6D 5CP6B 3UT9D 3UTAD 3KUYC 3MGPD 3MGPB 2XD5A 3MVDC 4WU9D 4X23C 4WU9B 3W99D 1P3GD 3W99B 3VH6A 4EO5B 4Z2MG 2YFVB 3EPLA 2F8NH 3C1BC 3AZKA 4KHAB 3AFAC 4Z5TA 3W98C 3MGSA 3W96C 1P3LA 1TAFB 3RELD 3RELB 3EPHA 5GXQC 1P3BB 3LELD 3LELB 4J8VA 4LD9C 2AROD 2AROB 4J8XA 4H9NB 2F8NK 1P3MA 3WA9D 3WA9B 3B0DC 4QLCA 5F99A 5FUGB 4J8UA 1U35A 3NQJA 3C1CC 5B32D 2ZY2A 5B32B 4Z2MH 3WTPA 3UTBC 2CV5A 3WAAA 1S32D 1S32B 5JRGA 1KX4C 5GSUA 2Y2IA 3X1UA 4G91C 2JCHA 1ZLAA 3A1IA 3NQUB 2Y2OA 5B1MC 3AZIB 3AZID 1M18A 3UT9A 3UTAA 4ZBJB 3MGPA 1ID3C 5AVCC 5AV8D 5AV8B 3B6FC 2YFVA 1HQ3C 4DQYB 1P3AB 5DNND 5DNNB 3MGQB 3MGQD 5JA4A 4AWLB 4YS3C 1P3PB 4KUDC 5CP6C 1B6WA 4KHAA 1TZYA 3AZFD 1B67A 2F8NB 4WU9C 2F8ND 1TAFA 3W99C 5DNMA 1P3OD 1P3OB 4EO5C 4UUZB 3WKJB 1M19C 3W97A 3LJAD 3LELA 3WKJD 3AZED 3AZEB 3A6ND 3A6NB 2NZDB 2NZDD 4WU8C 4H9NA 3O62C 4KGCC 1BFMA 4ZUXD 4ZUXB 5AY8A 4YM6B 3AZLC 3TU4D 3TU4B 3RELC 5B32A 3KWQC 2Y2MA 5GT3A 1P3BC 1S32A 2BYKB 3MVDD 4X23D 4X23B 3MVDB 3AN2B 2AROC 1P3IC 4G92B 3WA9C 3C1BD 3C1BB 1H3OB 5BS7A 1AOID 1AOIB 3W98D 3W98B 3AV1C 5AVBA 3W96B 2YFWA 3W96D 5B1LA 4H9PA 2Y2QA 2UWXA 5GXQD 2FJ7C 1BH8B 4LD9B 4LD9D 5BNXA 5DNNA 3AZIC 2IO5B 1EQZA 5GT0C 2Y2PA 4DRAA 4ZBJC 2HIOA 3C1CD 4H9RA 3LZ1D 3LZ1B 3C1CB 3AZFA 2F8NA 3UTBD 3UTBB 5AV8C 5CPKA 3REIA 4R8PD 4R8PB 1P3AC 3AZNA 1BH9B 3LJAA 3MGQC 3AZEA 1P3PC 3A6NA 1ULYA 2NZDA 4G91B 5B33B 4H9OA 4ZUXA 2F8NG 2ZY4A 4WZSB 3MNNC 1P3OC 5B40C 3KUYA 3WKJC 5AVCD 5AVCB 2BYKA 4X23A 4NE3A 1Z2CB 5BO0A 3EPKA 3C1BA 4YM6C 4YS3D 4YS3B 5AV6C 1H3OA 3TU4C 1KX3C 2BYMB 3AFAA 3WTPE 4JJNB 3W98A 3W96A 3AN2C 5BNVA 3H0LC 4NE5A 5GXQA 4G92C 1M19D 1M19B 1P3FC 1BH8A 4LD9A 4WU8D 4WU8B 3O62D 3O62B 1AOIC 4KGCB 4KGCD 4NE6A 4HGAB 3AZLD 3AZLB 1F66B 1F66D 3F6TA 3C1CA 3KWQD 3KWQB 3REHB 3UTBA 1P3BD 5B2JC 1KX4A 1BH9A 1P3ID 1P3IB 2IO5C 3KXBD 3KXBB 5CPJC 3AZMC 3LZ1C 5E5AB 4H9QB 4CSRA 1P3GA 5B1MA 3AV1D 3AV1B 5B31D 5B31B 2Y2JA 3EG5B 4R8PC 1JFIB 1ID3A 5AVCA 4Z66D 4Z66B 2FJ7B 2FJ7D 3B6FA 5B33C 1HQ3A 4YS3A 3AV2D 3AV2B 1M1AB 1KX5C 4KUDA 5CP6A 4XZQC 5GT0D 5GT0B 3B6GC 4WU9A 3VH6T 3W99A 3V9RB 1P3AD 1P3PD 2DQNC 3X1VC 4WU8A 4KGCA 3O62A 3B0BA 4JJNC 4QLCC 3AZLA 2LY8A 3REKC 3MNND 5B24C 3MNNB 3RELA 4E44A 4M6BA 3KWQA 5B40D 5B40B 1P3BA 3LZ0D 3LZ0B 2Y2KA 3VH5W 5AV5C 2AROA 1P3IA 5AV9C 3WA9A 4WV4B 5FUGA 4HGAC 4YM6D 1F66C 2NQBC 5AV6D 5AV6B 1KX3D 1KX3B 3REHC 4H9QA 3REJB 2L5AA 3AV1A 1JFIA 3AN2D 1HTAA 1N1JB 3B0CT 2FJ7A 1P3FD 1P3FB 3KXBC 1WWIA 5E5AC 3NQUA 3AZIA 2F2AC 5GT0A 5B31C 5B31G 3R45B 4J8WD 4J8WB 1P34B 5AV8A 5B2JD 5B2JB 4Z66C 5DNMC 1P3AA 3AZHC 3AZGC 4H9SC 3MGQA 1M1AC 3AV2C 1P3PA 2JE5A 5CPJD 5CPJB 3AZMD 3AZMB 2JSSA 3MNNA 4CAYB 3AZJB 1P3OA 3VH5A 5B2IC 5B40A 5B0YC 4UUZA 3WKJA 2BG1A 4XUJC 5B33D 3MGRC 4YM6A 2PYOC 1KX5D 5AV6A 3TU4A 1KX3A 3IP4C 4XZQB 4XZQD 1KX5B 3KSYA 3LZ0C 3MGSD 3MGSB 3AN2A 3MVDA 3B6GB 3B6GD 5C3IB 1P3LB 1P3LD 1N1JA 1P3FA 1P3KC 3A1KA 3X1VB 3X1VD 4J8XB 3REJC 1AOIA 4JJND 3H0MC 1P3MD 1P3MB 5CPIC 4QLCD 4QLCB 3REKD 3R45A 5BT1C 5B24D 5B24B 3REKB 1U35D 1U35B 3WTPD 3WTPB 5B2JA 2RVQC 3X1TC 3WAAB 5JRGD 5JRGB 1T3UA 3KFUG 5AV5D 5AV5B 3AZNC 5GSUD 5GSUB 5AV9D 5AV9B 3X1UD 3X1UB 2XD1A 5CPJA 2NQBD 2NQBB 1ZLAD 1ZLAB 3REHD 3LZ1A 4J8WC 1P34C 3H0RC 3FDDA 5B0ZC 4R8PA 3UT9B 1M18B 3UTAB 1M18D 3AYWC 5G49B 3X1SC 3AL0C 5B33A 4UPKA 5KDMB 5E5AD 2VQRA 5JA4B 1KX5A 4XZQA 2HUEC 3AZJC 1Q9CA 1TZYD 1TZYB 3EPJA 1A7WA 3B6GA 1PZRA 2Y2HA 5DNMD 5DNMB 3AZHD 3AZHB 3AZGD 3AZGB 1F1EA 3W97D 3W97B 1M1AD 3X1VA 3AZKC 2BYMA 4E45A 4JJNA 4Z5TC 3MGSC 5C3IC 1W2EA 5AY8D 3P5JB 5AY8B 5B24A 3REKA 1P3LC 5B2ID 5B2IB 5B0YD 5B0YB 5GT3D 5GT3B 1M19A 4J8VC 5AV5A 4J8XC 4XUJD 4XUJB 5AV9A 3MGRD 3MGRB 1P3MC 2J8PA 5F99C 1F66A 2NQBA 4J8UC 2PYOD 2PYOB 3REHA 1U35C 2ZY3A 3WTPC 4WJ3C 1P3GC 4DRBA 2CV5C 3WAAC 5AVBD 5JRGC 5AVBB 2YFWB 5G49A 5B1LD 5B1LB 4H9PB 5GSUC 3X1UC 3KXBA 1P3KD 1P3KB 5KDMA 1ZLAC 5E5AA 5BNXB 3REJD 1EQZD 5CPID 2Y2GA 5B31A 5CPIB 3UT9C 1M18C 3UTAC 1EQZB 5BT1D 2HIOD 2HIOB 3MGPC 4H9RB 3AZFB 2RVQD 3X1TD 4Z66A 3X1TB 5CPKB 5CPKD 3REID 3REIB 3AZHA 3AZGA 4H9SA 3AZND 3AZNB 3LJAB 1M1AA 2FFFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHL B;  1TZY C;  1P34 D;  4H9O B;  5B0Z D;  5B2I A;  5B0Z B;  3V9R A;  5B0Y A;  3AYW D;  3AYW B;  3KUY D;  3KUY B;  3W97 C;  3LEL C;  3X1S D;  3X1S B;  4XUJ A;  5BO0 B;  4WNN B;  3MGR A;  1WWS A;  2PYO A;  5AY8 C;  4NFT A;  3AZJ D;  2CWE A;  2HUE B;  5B32 C;  5B32 G;  5GT3 C;  3LZ0 A;  3AFA D;  3AFA B;  1S32 C;  5BNV B;  1KU5 A;  5GXQ B;  3VH6 W;  1P3K A;  3AZK D;  3AZK B;  5BS7 C;  3REJ A;  4Z5T D;  4Z5T B;  5CPI A;  3B0D B;  1R4V A;  5AVB C;  5B1L C;  3X1T A;  4J8V D;  4J8V B;  1KX4 D;  1KX4 B;  4J8X D;  5DNN C;  4AWL C;  1EQZ C;  5F99 D;  5F99 B;  4J8U D;  4J8U B;  3AZF C;  2HIO C;  4J8W A;  3NQJ B;  1P34 A;  4CSR B;  1P3G B;  1P3G D;  5B1M D;  5B1M B;  5CPK C;  2CV5 B;  5B0Z A;  2CV5 D;  3REI C;  3WAA D;  3AYW A;  1ID3 D;  1ID3 B;  3LJA C;  3AZE C;  3X1S A;  3A6N C;  2NZD C;  3AZM A;  4WNN A;  3B6F B;  3B6F D;  1HQ3 D;  1HQ3 B;  3VH5 T;  4ZUX C;  3B0C W;  4KUD D;  4CAY A;  3AZJ A;  4KUD B;  5CP6 D;  5CP6 B;  3UT9 D;  3UTA D;  3KUY C;  3MGP D;  3MGP B;  3MVD C;  4WU9 D;  4X23 C;  4WU9 B;  3W99 D;  3W99 B;  3VH6 A;  4EO5 B;  4Z2M G;  2YFV B;  2F8N H;  3C1B C;  3AZK A;  4KHA B;  3AFA C;  4Z5T A;  3W98 C;  3MGS A;  3W96 C;  1P3L A;  1TAF B;  3REL D;  3REL B;  5GXQ C;  1P3B B;  3LEL D;  3LEL B;  4J8V A;  4LD9 C;  2ARO D;  2ARO B;  4J8X A;  4H9N B;  2F8N K;  1P3M A;  3WA9 D;  3WA9 B;  3B0D C;  4QLC A;  5F99 A;  5FUG B;  4J8U A;  1U35 A;  3NQJ A;  3C1C C;  5B32 D;  5B32 B;  4Z2M H;  3WTP A;  3UTB C;  2CV5 A;  3WAA A;  1S32 D;  1S32 B;  5JRG A;  1KX4 C;  5GSU A;  3X1U A;  4G91 C;  1ZLA A;  3NQU B;  3AZI B;  5B1M C;  3AZI D;  1M18 A;  3UT9 A;  3UTA A;  4ZBJ B;  3MGP A;  1ID3 C;  5AVC C;  5AV8 D;  5AV8 B;  3B6F C;  2YFV A;  1HQ3 C;  1P3A B;  5DNN D;  5DNN B;  3MGQ B;  3MGQ D;  5JA4 A;  4AWL B;  4YS3 C;  1P3P B;  4KUD C;  5CP6 C;  1B6W A;  4KHA A;  1TZY A;  3AZF D;  1B67 A;  2F8N B;  4WU9 C;  2F8N D;  1TAF A;  3W99 C;  5DNM A;  1P3O D;  1P3O B;  4EO5 C;  4UUZ B;  3WKJ B;  1M19 C;  3W97 A;  3LJA D;  3LEL A;  3WKJ D;  3AZE D;  3AZE B;  3A6N D;  3A6N B;  2NZD B;  2NZD D;  4WU8 C;  4H9N A;  3O62 C;  4KGC C;  1BFM A;  4ZUX D;  4ZUX B;  5AY8 A;  4YM6 B;  3AZL C;  3TU4 D;  3TU4 B;  3REL C;  5B32 A;  3KWQ C;  5GT3 A;  1P3B C;  1S32 A;  2BYK B;  3MVD D;  4X23 D;  4X23 B;  3MVD B;  3AN2 B;  2ARO C;  1P3I C;  4G92 B;  3WA9 C;  3C1B D;  3C1B B;  1H3O B;  5BS7 A;  1AOI D;  1AOI B;  3W98 D;  3W98 B;  3AV1 C;  5AVB A;  3W96 B;  2YFW A;  3W96 D;  5B1L A;  4H9P A;  5GXQ D;  2FJ7 C;  1BH8 B;  4LD9 B;  4LD9 D;  5BNX A;  5DNN A;  3AZI C;  2IO5 B;  1EQZ A;  5GT0 C;  4DRA A;  4ZBJ C;  2HIO A;  3C1C D;  4H9R A;  3LZ1 D;  3LZ1 B;  3C1C B;  3AZF A;  2F8N A;  3UTB D;  3UTB B;  5AV8 C;  5CPK A;  3REI A;  4R8P D;  4R8P B;  1P3A C;  3AZN A;  1BH9 B;  3LJA A;  3MGQ C;  3AZE A;  1P3P C;  3A6N A;  1ULY A;  2NZD A;  4G91 B;  5B33 B;  4H9O A;  4ZUX A;  2F8N G;  4WZS B;  3MNN C;  1P3O C;  5B40 C;  3KUY A;  3WKJ C;  5AVC D;  5AVC B;  2BYK A;  4X23 A;  4NE3 A;  5BO0 A;  3C1B A;  4YM6 C;  4YS3 D;  4YS3 B;  5AV6 C;  1H3O A;  3TU4 C;  1KX3 C;  2BYM B;  3AFA A;  3WTP E;  4JJN B;  3W98 A;  3W96 A;  3AN2 C;  5BNV A;  4NE5 A;  5GXQ A;  4G92 C;  1M19 D;  1M19 B;  1P3F C;  1BH8 A;  4LD9 A;  4WU8 D;  4WU8 B;  3O62 D;  3O62 B;  1AOI C;  4KGC B;  4KGC D;  4NE6 A;  4HGA B;  3AZL D;  3AZL B;  1F66 B;  1F66 D;  3C1C A;  3KWQ D;  3KWQ B;  3REH B;  3UTB A;  1P3B D;  5B2J C;  1KX4 A;  1BH9 A;  1P3I D;  1P3I B;  2IO5 C;  3KXB D;  3KXB B;  5CPJ C;  3AZM C;  3LZ1 C;  5E5A B;  4H9Q B;  4CSR A;  1P3G A;  5B1M A;  3AV1 D;  3AV1 B;  5B31 D;  5B31 B;  4R8P C;  1JFI B;  1ID3 A;  5AVC A;  4Z66 D;  4Z66 B;  2FJ7 B;  2FJ7 D;  3B6F A;  5B33 C;  1HQ3 A;  4YS3 A;  3AV2 D;  3AV2 B;  1M1A B;  1KX5 C;  4KUD A;  5CP6 A;  4XZQ C;  5GT0 D;  5GT0 B;  3B6G C;  4WU9 A;  3VH6 T;  3W99 A;  3V9R B;  1P3A D;  1P3P D;  3X1V C;  4WU8 A;  4KGC A;  3O62 A;  3B0B A;  4JJN C;  4QLC C;  3AZL A;  2LY8 A;  3REK C;  3MNN D;  5B24 C;  3MNN B;  3REL A;  4E44 A;  4M6B A;  3KWQ A;  5B40 D;  5B40 B;  1P3B A;  3LZ0 D;  3LZ0 B;  3VH5 W;  5AV5 C;  2ARO A;  1P3I A;  5AV9 C;  3WA9 A;  4WV4 B;  5FUG A;  4YM6 D;  4HGA C;  1F66 C;  2NQB C;  5AV6 D;  5AV6 B;  1KX3 D;  1KX3 B;  3REH C;  4H9Q A;  3REJ B;  2L5A A;  3AV1 A;  1JFI A;  3AN2 D;  1HTA A;  1N1J B;  3B0C T;  2FJ7 A;  1P3F D;  1P3F B;  3KXB C;  1WWI A;  5E5A C;  3NQU A;  3AZI A;  5GT0 A;  5B31 C;  5B31 G;  3R45 B;  4J8W D;  4J8W B;  1P34 B;  5AV8 A;  5B2J D;  5B2J B;  4Z66 C;  5DNM C;  1P3A A;  3AZH C;  3AZG C;  4H9S C;  3MGQ A;  1M1A C;  3AV2 C;  1P3P A;  5CPJ D;  5CPJ B;  3AZM D;  3AZM B;  2JSS A;  3MNN A;  4CAY B;  3AZJ B;  1P3O A;  3VH5 A;  5B2I C;  5B40 A;  5B0Y C;  4UUZ A;  3WKJ A;  4XUJ C;  5B33 D;  3MGR C;  4YM6 A;  2PYO C;  1KX5 D;  5AV6 A;  3TU4 A;  1KX3 A;  4XZQ D;  4XZQ B;  1KX5 B;  3KSY A;  3LZ0 C;  3MGS D;  3MGS B;  3AN2 A;  3MVD A;  3B6G B;  3B6G D;  5C3I B;  1P3L B;  1P3L D;  1N1J A;  1P3F A;  1P3K C;  3X1V D;  3X1V B;  4J8X B;  3REJ C;  1AOI A;  4JJN D;  1P3M D;  1P3M B;  5CPI C;  4QLC D;  4QLC B;  3REK D;  3R45 A;  5BT1 C;  5B24 D;  5B24 B;  3REK B;  1U35 D;  1U35 B;  3WTP D;  3WTP B;  5B2J A;  2RVQ C;  3X1T C;  3WAA B;  5JRG D;  5JRG B;  5AV5 D;  5AV5 B;  3AZN C;  5GSU D;  5GSU B;  5AV9 D;  5AV9 B;  3X1U D;  3X1U B;  5CPJ A;  2NQB D;  2NQB B;  1ZLA D;  1ZLA B;  3REH D;  3LZ1 A;  4J8W C;  1P34 C;  5B0Z C;  4R8P A;  3UT9 B;  1M18 B;  3UTA B;  1M18 D;  3AYW C;  5G49 B;  3X1S C;  5B33 A;  5KDM B;  5E5A D;  5JA4 B;  1KX5 A;  4XZQ A;  2HUE C;  3AZJ C;  1Q9C A;  1TZY D;  1TZY B;  1A7W A;  3B6G A;  5DNM D;  5DNM B;  3AZH D;  3AZH B;  3AZG D;  3AZG B;  1F1E A;  3W97 D;  3W97 B;  1M1A D;  3X1V A;  3AZK C;  2BYM A;  4E45 A;  4JJN A;  4Z5T C;  3MGS C;  5C3I C;  3REK A;  5AY8 D;  5AY8 B;  5B24 A;  1P3L C;  5B2I D;  5B2I B;  5B0Y D;  5B0Y B;  5GT3 D;  5GT3 B;  1M19 A;  4J8V C;  5AV5 A;  4J8X C;  4XUJ D;  4XUJ B;  5AV9 A;  3MGR D;  3MGR B;  1P3M C;  5F99 C;  1F66 A;  2NQB A;  4J8U C;  2PYO D;  2PYO B;  3REH A;  1U35 C;  3WTP C;  1P3G C;  4DRB A;  2CV5 C;  3WAA C;  5AVB D;  5JRG C;  5AVB B;  2YFW B;  5G49 A;  5B1L D;  5B1L B;  4H9P B;  5GSU C;  3X1U C;  3KXB A;  1P3K D;  1P3K B;  5KDM A;  1ZLA C;  5E5A A;  5BNX B;  3REJ D;  1EQZ D;  5CPI D;  5CPI B;  5B31 A;  1M18 C;  3UT9 C;  1EQZ B;  3UTA C;  5BT1 D;  2HIO D;  2HIO B;  3MGP C;  4H9R B;  3AZF B;  2RVQ D;  3X1T D;  4Z66 A;  3X1T B;  5CPK B;  5CPK D;  3REI D;  3REI B;  3AZH A;  3AZG A;  4H9S A;  3AZN D;  3AZN B;  3LJA B;  1M1A A;  3AV2 A; 
#chains in the Genus database with same CATH topology
 5CHL B;  1TZY C;  1P34 D;  4H9O B;  5B0Z D;  5B2I A;  5B0Z B;  3V9R A;  5B0Y A;  3AYW D;  3AYW B;  3KUY D;  3KUY B;  3W97 C;  3LEL C;  3X1S D;  3X1S B;  4XUJ A;  5BO0 B;  4WNN B;  3MGR A;  1WWS A;  2PYO A;  5AY8 C;  4NFT A;  3AZJ D;  2CWE A;  2HUE B;  5B32 C;  5B32 G;  5GT3 C;  3LZ0 A;  3AFA D;  3AFA B;  2ZY5 A;  1S32 C;  2ZM5 A;  5BNV B;  2RIQ A;  1KU5 A;  5GXQ B;  2DF4 C;  3VH6 W;  1P3K A;  2Y2N A;  3AZK D;  3AZK B;  5BS7 C;  3REJ A;  4Z5T D;  4Z5T B;  5CPI A;  3B0D B;  2G5I C;  1R4V A;  5AVB C;  5B1L C;  3X1T A;  4J8V D;  4J8V B;  1KX4 D;  1KX4 B;  4J8X D;  5DNN C;  4AWL C;  1EQZ C;  5F99 D;  5F99 B;  2G5H C;  4J8U B;  4J8U D;  3AZF C;  2HIO C;  4J8W A;  3NQJ B;  1P34 A;  4CSR B;  1P3G B;  2W8S A;  5B1M D;  5B1M B;  5CPK C;  2CV5 B;  5B0Z A;  2CV5 D;  3REI C;  3WAA D;  3AYW A;  1ID3 D;  1ID3 B;  3LJA C;  3AZE C;  3X1S A;  3A6N C;  2NZD C;  2Y2L A;  3AZM A;  4WNN A;  3AV2 A;  3B6F B;  3B6F D;  1HQ3 D;  1HQ3 B;  3VH5 T;  4ZUX C;  3B0C W;  4KUD D;  4CAY A;  3AZJ A;  4KUD B;  5CP6 D;  5CP6 B;  3UT9 D;  3UTA D;  3KUY C;  3MGP D;  3MGP B;  2XD5 A;  3MVD C;  4WU9 D;  4X23 C;  4WU9 B;  3W99 D;  1P3G D;  3W99 B;  3VH6 A;  4EO5 B;  4Z2M G;  2YFV B;  3EPL A;  2F8N H;  3C1B C;  3AZK A;  4KHA B;  3AFA C;  4Z5T A;  3W98 C;  3MGS A;  3W96 C;  1P3L A;  1TAF B;  3REL D;  3REL B;  3EPH A;  5GXQ C;  1P3B B;  3LEL D;  3LEL B;  4J8V A;  4LD9 C;  2ARO D;  2ARO B;  4J8X A;  4H9N B;  2F8N K;  1P3M A;  3WA9 D;  3WA9 B;  3B0D C;  4QLC A;  5F99 A;  5FUG B;  4J8U A;  1U35 A;  3NQJ A;  3C1C C;  5B32 D;  2ZY2 A;  5B32 B;  4Z2M H;  3WTP A;  3UTB C;  2CV5 A;  3WAA A;  1S32 D;  1S32 B;  5JRG A;  1KX4 C;  5GSU A;  2Y2I A;  3X1U A;  4G91 C;  2JCH A;  1ZLA A;  3A1I A;  3NQU B;  2Y2O A;  5B1M C;  3AZI B;  3AZI D;  1M18 A;  3UT9 A;  3UTA A;  4ZBJ B;  3MGP A;  1ID3 C;  5AVC C;  5AV8 D;  5AV8 B;  3B6F C;  2YFV A;  1HQ3 C;  4DQY B;  1P3A B;  5DNN D;  5DNN B;  3MGQ B;  3MGQ D;  5JA4 A;  4AWL B;  4YS3 C;  1P3P B;  4KUD C;  5CP6 C;  1B6W A;  4KHA A;  1TZY A;  3AZF D;  1B67 A;  2F8N B;  4WU9 C;  2F8N D;  1TAF A;  3W99 C;  5DNM A;  1P3O D;  1P3O B;  4EO5 C;  4UUZ B;  3WKJ B;  1M19 C;  3W97 A;  3LJA D;  3LEL A;  3WKJ D;  3AZE D;  3AZE B;  3A6N D;  3A6N B;  2NZD B;  2NZD D;  4WU8 C;  4H9N A;  3O62 C;  4KGC C;  1BFM A;  4ZUX D;  4ZUX B;  5AY8 A;  4YM6 B;  3AZL C;  3TU4 D;  3TU4 B;  3REL C;  5B32 A;  3KWQ C;  2Y2M A;  5GT3 A;  1P3B C;  1S32 A;  2BYK B;  3MVD D;  4X23 D;  4X23 B;  3MVD B;  3AN2 B;  2ARO C;  1P3I C;  4G92 B;  3WA9 C;  3C1B D;  3C1B B;  1H3O B;  5BS7 A;  1AOI D;  1AOI B;  3W98 D;  3W98 B;  3AV1 C;  5AVB A;  3W96 B;  2YFW A;  3W96 D;  5B1L A;  4H9P A;  2Y2Q A;  2UWX A;  5GXQ D;  2FJ7 C;  1BH8 B;  4LD9 B;  4LD9 D;  5BNX A;  5DNN A;  3AZI C;  2IO5 B;  1EQZ A;  5GT0 C;  2Y2P A;  4DRA A;  4ZBJ C;  2HIO A;  3C1C D;  4H9R A;  3LZ1 D;  3LZ1 B;  3C1C B;  3AZF A;  2F8N A;  3UTB D;  3UTB B;  5AV8 C;  5CPK A;  3REI A;  4R8P D;  4R8P B;  1P3A C;  3AZN A;  1BH9 B;  3LJA A;  3MGQ C;  3AZE A;  1P3P C;  3A6N A;  1ULY A;  2NZD A;  4G91 B;  5B33 B;  4H9O A;  4ZUX A;  2F8N G;  2ZY4 A;  4WZS B;  3MNN C;  1P3O C;  5B40 C;  3KUY A;  3WKJ C;  5AVC D;  5AVC B;  2BYK A;  4X23 A;  4NE3 A;  1Z2C B;  5BO0 A;  3EPK A;  3C1B A;  4YM6 C;  4YS3 D;  4YS3 B;  5AV6 C;  1H3O A;  3TU4 C;  1KX3 C;  2BYM B;  3AFA A;  3WTP E;  4JJN B;  3W98 A;  3W96 A;  3AN2 C;  5BNV A;  3H0L C;  4NE5 A;  5GXQ A;  4G92 C;  1M19 D;  1M19 B;  1P3F C;  1BH8 A;  4LD9 A;  4WU8 D;  4WU8 B;  3O62 D;  3O62 B;  1AOI C;  4KGC B;  4KGC D;  4NE6 A;  4HGA B;  3AZL D;  3AZL B;  1F66 B;  1F66 D;  3F6T A;  3C1C A;  3KWQ D;  3KWQ B;  3REH B;  3UTB A;  1P3B D;  5B2J C;  1KX4 A;  1BH9 A;  1P3I D;  1P3I B;  2IO5 C;  3KXB D;  3KXB B;  5CPJ C;  3AZM C;  3LZ1 C;  5E5A B;  4H9Q B;  4CSR A;  1P3G A;  5B1M A;  3AV1 D;  3AV1 B;  5B31 D;  5B31 B;  2Y2J A;  3EG5 B;  4R8P C;  1JFI B;  1ID3 A;  5AVC A;  4Z66 D;  4Z66 B;  2FJ7 B;  2FJ7 D;  3B6F A;  5B33 C;  1HQ3 A;  4YS3 A;  3AV2 D;  3AV2 B;  1M1A B;  1KX5 C;  4KUD A;  5CP6 A;  4XZQ C;  5GT0 D;  5GT0 B;  3B6G C;  4WU9 A;  3VH6 T;  3W99 A;  3V9R B;  1P3A D;  1P3P D;  2DQN C;  3X1V C;  4WU8 A;  4KGC A;  3O62 A;  3B0B A;  4JJN C;  4QLC C;  3AZL A;  2LY8 A;  3REK C;  3MNN D;  5B24 C;  3MNN B;  3REL A;  4E44 A;  4M6B A;  3KWQ A;  5B40 D;  5B40 B;  1P3B A;  3LZ0 D;  3LZ0 B;  2Y2K A;  3VH5 W;  5AV5 C;  2ARO A;  1P3I A;  5AV9 C;  3WA9 A;  4WV4 B;  5FUG A;  4HGA C;  4YM6 D;  1F66 C;  2NQB C;  5AV6 D;  5AV6 B;  1KX3 D;  1KX3 B;  3REH C;  4H9Q A;  3REJ B;  2L5A A;  3AV1 A;  1JFI A;  3AN2 D;  1HTA A;  1N1J B;  3B0C T;  2FJ7 A;  1P3F D;  1P3F B;  3KXB C;  1WWI A;  5E5A C;  3NQU A;  3AZI A;  2F2A C;  5GT0 A;  5B31 C;  5B31 G;  3R45 B;  4J8W D;  4J8W B;  1P34 B;  5AV8 A;  5B2J D;  5B2J B;  4Z66 C;  5DNM C;  1P3A A;  3AZH C;  3AZG C;  4H9S C;  3MGQ A;  1M1A C;  3AV2 C;  1P3P A;  2JE5 A;  5CPJ D;  5CPJ B;  3AZM D;  3AZM B;  2JSS A;  3MNN A;  4CAY B;  3AZJ B;  1P3O A;  3VH5 A;  5B2I C;  5B40 A;  5B0Y C;  4UUZ A;  3WKJ A;  2BG1 A;  4XUJ C;  5B33 D;  3MGR C;  4YM6 A;  2PYO C;  1KX5 D;  5AV6 A;  3TU4 A;  1KX3 A;  3IP4 C;  4XZQ B;  4XZQ D;  1KX5 B;  3KSY A;  3LZ0 C;  3MGS D;  3MGS B;  3AN2 A;  3MVD A;  3B6G B;  3B6G D;  5C3I B;  1P3L B;  1P3L D;  1N1J A;  1P3F A;  1P3K C;  3A1K A;  3X1V B;  3X1V D;  4J8X B;  3REJ C;  1AOI A;  4JJN D;  3H0M C;  1P3M D;  1P3M B;  5CPI C;  4QLC D;  4QLC B;  3REK D;  3R45 A;  5BT1 C;  5B24 D;  5B24 B;  3REK B;  1U35 D;  1U35 B;  3WTP D;  3WTP B;  5B2J A;  2RVQ C;  3X1T C;  3WAA B;  5JRG D;  5JRG B;  1T3U A;  3KFU G;  5AV5 D;  5AV5 B;  3AZN C;  5GSU D;  5GSU B;  5AV9 D;  5AV9 B;  3X1U D;  3X1U B;  2XD1 A;  5CPJ A;  2NQB D;  2NQB B;  1ZLA D;  1ZLA B;  3REH D;  3LZ1 A;  4J8W C;  1P34 C;  3H0R C;  3FDD A;  5B0Z C;  4R8P A;  3UT9 B;  1M18 B;  3UTA B;  1M18 D;  3AYW C;  5G49 B;  3X1S C;  3AL0 C;  5B33 A;  4UPK A;  5KDM B;  5E5A D;  2VQR A;  5JA4 B;  1KX5 A;  4XZQ A;  2HUE C;  3AZJ C;  1Q9C A;  1TZY D;  1TZY B;  3EPJ A;  1A7W A;  3B6G A;  1PZR A;  2Y2H A;  5DNM D;  5DNM B;  3AZH D;  3AZH B;  3AZG D;  3AZG B;  1F1E A;  3W97 D;  3W97 B;  1M1A D;  3X1V A;  3AZK C;  2BYM A;  4E45 A;  4JJN A;  4Z5T C;  3MGS C;  5C3I C;  1W2E A;  5AY8 D;  3P5J B;  5AY8 B;  5B24 A;  3REK A;  1P3L C;  5B2I D;  5B2I B;  5B0Y D;  5B0Y B;  5GT3 D;  5GT3 B;  1M19 A;  4J8V C;  5AV5 A;  4J8X C;  4XUJ D;  4XUJ B;  5AV9 A;  3MGR D;  3MGR B;  1P3M C;  2J8P A;  5F99 C;  1F66 A;  2NQB A;  4J8U C;  2PYO D;  2PYO B;  3REH A;  1U35 C;  2ZY3 A;  3WTP C;  4WJ3 C;  1P3G C;  4DRB A;  2CV5 C;  3WAA C;  5AVB D;  5JRG C;  5AVB B;  2YFW B;  5G49 A;  5B1L D;  5B1L B;  4H9P B;  5GSU C;  3X1U C;  3KXB A;  1P3K D;  1P3K B;  5KDM A;  1ZLA C;  5E5A A;  5BNX B;  3REJ D;  1EQZ D;  5CPI D;  2Y2G A;  5B31 A;  5CPI B;  3UT9 C;  1M18 C;  3UTA C;  1EQZ B;  5BT1 D;  2HIO D;  2HIO B;  3MGP C;  4H9R B;  3AZF B;  2RVQ D;  3X1T D;  4Z66 A;  3X1T B;  5CPK B;  5CPK D;  3REI D;  3REI B;  3AZH A;  3AZG A;  4H9S A;  3AZN D;  3AZN B;  3LJA B;  1M1A A;  2FFF B; 
#chains in the Genus database with same CATH homology
 5CHL B;  1TZY C;  1P34 D;  4H9O B;  5B0Z D;  5B2I A;  5B0Z B;  3V9R A;  5B0Y A;  3AYW D;  3AYW B;  3KUY D;  3KUY B;  3W97 C;  3LEL C;  3X1S D;  3X1S B;  4XUJ A;  5BO0 B;  4WNN B;  3MGR A;  1WWS A;  2PYO A;  5AY8 C;  4NFT A;  3AZJ D;  2CWE A;  2HUE B;  5B32 C;  5B32 G;  5GT3 C;  3LZ0 A;  3AFA D;  3AFA B;  2ZY5 A;  1S32 C;  2ZM5 A;  5BNV B;  2RIQ A;  1KU5 A;  5GXQ B;  2DF4 C;  3VH6 W;  1P3K A;  2Y2N A;  3AZK D;  3AZK B;  5BS7 C;  3REJ A;  4Z5T D;  4Z5T B;  5CPI A;  3B0D B;  2G5I C;  1R4V A;  5AVB C;  5B1L C;  3X1T A;  4J8V D;  4J8V B;  1KX4 D;  1KX4 B;  4J8X D;  5DNN C;  4AWL C;  1EQZ C;  5F99 D;  5F99 B;  2G5H C;  4J8U B;  4J8U D;  3AZF C;  2HIO C;  4J8W A;  3NQJ B;  1P34 A;  4CSR B;  1P3G B;  2W8S A;  5B1M D;  5B1M B;  5CPK C;  2CV5 B;  5B0Z A;  2CV5 D;  3REI C;  3WAA D;  3AYW A;  1ID3 D;  1ID3 B;  3LJA C;  3AZE C;  3X1S A;  3A6N C;  2NZD C;  2Y2L A;  3AZM A;  4WNN A;  3AV2 A;  3B6F B;  3B6F D;  1HQ3 D;  1HQ3 B;  3VH5 T;  4ZUX C;  3B0C W;  4KUD D;  4CAY A;  3AZJ A;  4KUD B;  5CP6 D;  5CP6 B;  3UT9 D;  3UTA D;  3KUY C;  3MGP D;  3MGP B;  2XD5 A;  3MVD C;  4WU9 D;  4X23 C;  4WU9 B;  3W99 D;  1P3G D;  3W99 B;  3VH6 A;  4EO5 B;  4Z2M G;  2YFV B;  3EPL A;  2F8N H;  3C1B C;  3AZK A;  4KHA B;  3AFA C;  4Z5T A;  3W98 C;  3MGS A;  3W96 C;  1P3L A;  1TAF B;  3REL D;  3REL B;  3EPH A;  5GXQ C;  1P3B B;  3LEL D;  3LEL B;  4J8V A;  4LD9 C;  2ARO D;  2ARO B;  4J8X A;  4H9N B;  2F8N K;  1P3M A;  3WA9 D;  3WA9 B;  3B0D C;  4QLC A;  5F99 A;  5FUG B;  4J8U A;  1U35 A;  3NQJ A;  3C1C C;  5B32 D;  2ZY2 A;  5B32 B;  4Z2M H;  3WTP A;  3UTB C;  2CV5 A;  3WAA A;  1S32 D;  1S32 B;  5JRG A;  1KX4 C;  5GSU A;  2Y2I A;  3X1U A;  4G91 C;  2JCH A;  1ZLA A;  3A1I A;  3NQU B;  2Y2O A;  5B1M C;  3AZI B;  3AZI D;  1M18 A;  3UT9 A;  3UTA A;  4ZBJ B;  3MGP A;  1ID3 C;  5AVC C;  5AV8 D;  5AV8 B;  3B6F C;  2YFV A;  1HQ3 C;  4DQY B;  1P3A B;  5DNN D;  5DNN B;  3MGQ B;  3MGQ D;  5JA4 A;  4AWL B;  4YS3 C;  1P3P B;  4KUD C;  5CP6 C;  1B6W A;  4KHA A;  1TZY A;  3AZF D;  1B67 A;  2F8N B;  4WU9 C;  2F8N D;  1TAF A;  3W99 C;  5DNM A;  1P3O D;  1P3O B;  4EO5 C;  4UUZ B;  3WKJ B;  1M19 C;  3W97 A;  3LJA D;  3LEL A;  3WKJ D;  3AZE D;  3AZE B;  3A6N D;  3A6N B;  2NZD B;  2NZD D;  4WU8 C;  4H9N A;  3O62 C;  4KGC C;  1BFM A;  4ZUX D;  4ZUX B;  5AY8 A;  4YM6 B;  3AZL C;  3TU4 D;  3TU4 B;  3REL C;  5B32 A;  3KWQ C;  2Y2M A;  5GT3 A;  1P3B C;  1S32 A;  2BYK B;  3MVD D;  4X23 D;  4X23 B;  3MVD B;  3AN2 B;  2ARO C;  1P3I C;  4G92 B;  3WA9 C;  3C1B D;  3C1B B;  1H3O B;  5BS7 A;  1AOI D;  1AOI B;  3W98 D;  3W98 B;  3AV1 C;  5AVB A;  3W96 B;  2YFW A;  3W96 D;  5B1L A;  4H9P A;  2Y2Q A;  2UWX A;  5GXQ D;  2FJ7 C;  1BH8 B;  4LD9 B;  4LD9 D;  5BNX A;  5DNN A;  3AZI C;  2IO5 B;  1EQZ A;  5GT0 C;  2Y2P A;  4DRA A;  4ZBJ C;  2HIO A;  3C1C D;  4H9R A;  3LZ1 D;  3LZ1 B;  3C1C B;  3AZF A;  2F8N A;  3UTB D;  3UTB B;  5AV8 C;  5CPK A;  3REI A;  4R8P D;  4R8P B;  1P3A C;  3AZN A;  1BH9 B;  3LJA A;  3MGQ C;  3AZE A;  1P3P C;  3A6N A;  1ULY A;  2NZD A;  4G91 B;  5B33 B;  4H9O A;  4ZUX A;  2F8N G;  2ZY4 A;  4WZS B;  3MNN C;  1P3O C;  5B40 C;  3KUY A;  3WKJ C;  5AVC D;  5AVC B;  2BYK A;  4X23 A;  4NE3 A;  1Z2C B;  5BO0 A;  3EPK A;  3C1B A;  4YM6 C;  4YS3 D;  4YS3 B;  5AV6 C;  1H3O A;  3TU4 C;  1KX3 C;  2BYM B;  3AFA A;  3WTP E;  4JJN B;  3W98 A;  3W96 A;  3AN2 C;  5BNV A;  3H0L C;  4NE5 A;  5GXQ A;  4G92 C;  1M19 D;  1M19 B;  1P3F C;  1BH8 A;  4LD9 A;  4WU8 D;  4WU8 B;  3O62 D;  3O62 B;  1AOI C;  4KGC B;  4KGC D;  4NE6 A;  4HGA B;  3AZL D;  3AZL B;  1F66 B;  1F66 D;  3F6T A;  3C1C A;  3KWQ D;  3KWQ B;  3REH B;  3UTB A;  1P3B D;  5B2J C;  1KX4 A;  1BH9 A;  1P3I D;  1P3I B;  2IO5 C;  3KXB D;  3KXB B;  5CPJ C;  3AZM C;  3LZ1 C;  5E5A B;  4H9Q B;  4CSR A;  1P3G A;  5B1M A;  3AV1 D;  3AV1 B;  5B31 D;  5B31 B;  2Y2J A;  3EG5 B;  4R8P C;  1JFI B;  1ID3 A;  5AVC A;  4Z66 D;  4Z66 B;  2FJ7 B;  2FJ7 D;  3B6F A;  5B33 C;  1HQ3 A;  4YS3 A;  3AV2 D;  3AV2 B;  1M1A B;  1KX5 C;  4KUD A;  5CP6 A;  4XZQ C;  5GT0 D;  5GT0 B;  3B6G C;  4WU9 A;  3VH6 T;  3W99 A;  3V9R B;  1P3A D;  1P3P D;  2DQN C;  3X1V C;  4WU8 A;  4KGC A;  3O62 A;  3B0B A;  4JJN C;  4QLC C;  3AZL A;  2LY8 A;  3REK C;  3MNN D;  5B24 C;  3MNN B;  3REL A;  4E44 A;  4M6B A;  3KWQ A;  5B40 D;  5B40 B;  1P3B A;  3LZ0 D;  3LZ0 B;  2Y2K A;  3VH5 W;  5AV5 C;  2ARO A;  1P3I A;  5AV9 C;  3WA9 A;  4WV4 B;  5FUG A;  4HGA C;  4YM6 D;  1F66 C;  2NQB C;  5AV6 D;  5AV6 B;  1KX3 D;  1KX3 B;  3REH C;  4H9Q A;  3REJ B;  2L5A A;  3AV1 A;  1JFI A;  3AN2 D;  1HTA A;  1N1J B;  3B0C T;  2FJ7 A;  1P3F D;  1P3F B;  3KXB C;  1WWI A;  5E5A C;  3NQU A;  3AZI A;  2F2A C;  5GT0 A;  5B31 C;  5B31 G;  3R45 B;  4J8W D;  4J8W B;  1P34 B;  5AV8 A;  5B2J D;  5B2J B;  4Z66 C;  5DNM C;  1P3A A;  3AZH C;  3AZG C;  4H9S C;  3MGQ A;  1M1A C;  3AV2 C;  1P3P A;  2JE5 A;  5CPJ D;  5CPJ B;  3AZM D;  3AZM B;  2JSS A;  3MNN A;  4CAY B;  3AZJ B;  1P3O A;  3VH5 A;  5B2I C;  5B40 A;  5B0Y C;  4UUZ A;  3WKJ A;  2BG1 A;  4XUJ C;  5B33 D;  3MGR C;  4YM6 A;  2PYO C;  1KX5 D;  5AV6 A;  3TU4 A;  1KX3 A;  3IP4 C;  4XZQ B;  4XZQ D;  1KX5 B;  3KSY A;  3LZ0 C;  3MGS D;  3MGS B;  3AN2 A;  3MVD A;  3B6G B;  3B6G D;  5C3I B;  1P3L B;  1P3L D;  1N1J A;  1P3F A;  1P3K C;  3A1K A;  3X1V B;  3X1V D;  4J8X B;  3REJ C;  1AOI A;  4JJN D;  3H0M C;  1P3M D;  1P3M B;  5CPI C;  4QLC D;  4QLC B;  3REK D;  3R45 A;  5BT1 C;  5B24 D;  5B24 B;  3REK B;  1U35 D;  1U35 B;  3WTP D;  3WTP B;  5B2J A;  2RVQ C;  3X1T C;  3WAA B;  5JRG D;  5JRG B;  1T3U A;  3KFU G;  5AV5 D;  5AV5 B;  3AZN C;  5GSU D;  5GSU B;  5AV9 D;  5AV9 B;  3X1U D;  3X1U B;  2XD1 A;  5CPJ A;  2NQB D;  2NQB B;  1ZLA D;  1ZLA B;  3REH D;  3LZ1 A;  4J8W C;  1P34 C;  3H0R C;  3FDD A;  5B0Z C;  4R8P A;  3UT9 B;  1M18 B;  3UTA B;  1M18 D;  3AYW C;  5G49 B;  3X1S C;  3AL0 C;  5B33 A;  4UPK A;  5KDM B;  5E5A D;  2VQR A;  5JA4 B;  1KX5 A;  4XZQ A;  2HUE C;  3AZJ C;  1Q9C A;  1TZY D;  1TZY B;  3EPJ A;  1A7W A;  3B6G A;  1PZR A;  2Y2H A;  5DNM D;  5DNM B;  3AZH D;  3AZH B;  3AZG D;  3AZG B;  1F1E A;  3W97 D;  3W97 B;  1M1A D;  3X1V A;  3AZK C;  2BYM A;  4E45 A;  4JJN A;  4Z5T C;  3MGS C;  5C3I C;  1W2E A;  5AY8 D;  3P5J B;  5AY8 B;  5B24 A;  3REK A;  1P3L C;  5B2I D;  5B2I B;  5B0Y D;  5B0Y B;  5GT3 D;  5GT3 B;  1M19 A;  4J8V C;  5AV5 A;  4J8X C;  4XUJ D;  4XUJ B;  5AV9 A;  3MGR D;  3MGR B;  1P3M C;  2J8P A;  5F99 C;  1F66 A;  2NQB A;  4J8U C;  2PYO D;  2PYO B;  3REH A;  1U35 C;  2ZY3 A;  3WTP C;  4WJ3 C;  1P3G C;  4DRB A;  2CV5 C;  3WAA C;  5AVB D;  5JRG C;  5AVB B;  2YFW B;  5G49 A;  5B1L D;  5B1L B;  4H9P B;  5GSU C;  3X1U C;  3KXB A;  1P3K D;  1P3K B;  5KDM A;  1ZLA C;  5E5A A;  5BNX B;  3REJ D;  1EQZ D;  5CPI D;  2Y2G A;  5B31 A;  5CPI B;  3UT9 C;  1M18 C;  3UTA C;  1EQZ B;  5BT1 D;  2HIO D;  2HIO B;  3MGP C;  4H9R B;  3AZF B;  2RVQ D;  3X1T D;  4Z66 A;  3X1T B;  5CPK B;  5CPK D;  3REI D;  3REI B;  3AZH A;  3AZG A;  4H9S A;  3AZN D;  3AZN B;  3LJA B;  1M1A A;  2FFF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...