3W96B

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 77
sequence length 77
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96B00
4WZSB 1ZLAD 3W96B 1ID3A 3TU4A 1N1JA 4E44A 1S32D 1P3LD 3AZJD 1HQ3A 3AV2D 2PYOA 3AZNA 1KX4B 5AV5B 3W99A 3AZFB 3UT9D 1ULYA 3AZKA 1KX3D 4ZUXD 3MGPA 4M6BA 2NZDD 4DRBA 5CP6A 4J8UD 3REHA 1F66D 5B31B 3MGSA 3W96D 1S32C 3R45B 5AV9A 3AYWC 3AZJC 3W97C 2FJ7B 3MGQC 3UT9C 2F8NH 1KX4D 1KX3C 2YFWA 5B1LA 3AZGB 3AZFD 3AV1A 2IO5B 4YS3A 1P3OC 2NQBC 5B1MB 5E5AC 3TU4B 1P3FA 5B31D 1N1JB 3B6GC 3X1SA 4H9PB 2FJ7D 3W99B 4Z66A 3AZKB 5JA4B 5GT3D 3AN2A 3AZGD 5CP6B 3AZLB 4Z2MH 3LZ1C 1P3MC 3UTBA 5F99A 3X1VC 3MGSB 5B1MD 3TU4D 3KUYB 1Q9CA 5JRGA 5B1LB 3W99D 5GT3C 5C3IB 5AV8A 3AZKD 3AV1B 1P34A 4YS3B 3O62C 5DNNC 5CP6D 3AZLD 1P3KA 4HGAC 3KSYA 1ID3C 3X1SB 3MGSD 3AZMB 3KUYD 1HQ3C 4E45A 3UTAC 4Z66B 2PYOC 3AZNC 3W99C 3AN2B 5B1LD 4KGCB 3MGPC 3AV1D 3AYWA 3NQUA 4EO5C 1F1EA 5CP6C 4YS3D 3UTBB 3REHC 5CPJA 5BO0A 4QLCB 3B6FA 1P3FD 4XZQB 3X1SD 1M19B 5GSUB 5AV9C 5B32G 1P3OA 1EQZA 5AVCC 5B24A 1KX5A 5JRGB 2F8NB 5E5AA 3B0CW 2NQBA 4Z66D 4CSRB 5B1LC 3AN2D 4KGCD 2LY8A 3UTBD 5F99D 3KWQA 4QLCD 1WWIA 1P3FC 1TAFA 4H9QB 4XZQD 1M19D 5GSUD 1BH8B 4DRAA 5JRGD 4H9OA 3MNNA 1S32B 2F8ND 3AYWB 3AN2C 3W97B 3VH5W 5CPJB 5F99C 3MGQB 3UT9B 4NFTA 4KUDC 4YM6A 1H3OA 1P3OB 1EQZB 4WU8C 5G49A 5BNXA 2NQBB 5E5AB 2HIOA 5B32A 3B0BA 5JRGC 5AV8C 3B6GB 1P34C 4UUZA 3WTPA 3AYWD 1P3BC 3UTAA 4J8WC 3W97D 1P3KC 5FUGA 5CPJD 3MGQD 5BNVA 4Z5TA 4H9RB 3LZ1B 1P3MB 1P3OD 3X1VB 3B0CT 1EQZD 5B24D 2NQBD 4H9OB 5E5AD 5B40A 3B6GD 5B2JA 4X23A 5AVCA 4KHAA 5CPJC 5GT3B 3B6FC 1H3OB 5BS7A 3A6NA 3O62B 5DNNB 3AZIA 4HGAB 5AVBA 3AZEA 3LZ1D 1EQZC 1P3MD 5B24C 3X1VD 1KX5C 1BFMA 1TZYC 2BYKA 1ID3B 3LJAC 3VH5T 1HQ3B 3UTAB 2BYMA 2PYOB 5FUGB 3AZNB 5AV6A 4J8XC 3KWQC 3MGPB 4EO5B 4H9NA 3O62D 5DNND 3REHB 3REKA 1WWSA 1HTAA 1JFIA 4KUDA 3MNNC 1ID3D 5B2JB 5AV9B 5BT1C 4J8VA 4WU9C 4X23B 5AVCB 4WU8A 5GT0A 1HQ3D 3UTAD 2CV5C 2PYOD 4G91C 3AZND 2YFWB 1B67A 5B0ZA 4CAYA 4Z5TD 3MGPD 1BH9A 2YFVA 4YM6C 3AFAA 2AROA 3MVDC 3AZIB 4LD9A 1P3BA 4J8WA 3AZEB 4Z2MG 3RELA 3REHD 2BYKB 3NQJA 4ZBJB 2HIOC 5B32C 1P3FB 5B40D 3LZ0C 3WTPC 5AV9D 5B2JD 4X23D 5AVCD 2RVQD 5CPIC 4WNNA 4Z5TC 4H9NB 3A6ND 5CPKA 3AZID 5F99B 3KXBA 3AZED 1JFIB 3MGRC 4KUDB 3WKJA 2HUEC 5B40C 5B2JC 4WU8B 1KU5A 1R4VA 4X23C 2RVQC 2JSSA 1TZYA 5AV8B 3LJAA 1P34B 5B31G 1BH9B 2YFVB 3AFAB 2AROB 5BS7C 3A6NC 4XUJC 1P3BB 1ZLAA 4J8WB 3AZIC 3RELB 1P3KB 5AVBC 3AZEC 3NQJB 4J8XA 4ZBJC 3AV2A 4KUDD 3W98A 5GXQA 2L5AA 4R8PC 1P3AA 4WU8D 5GT0D 3AZHA 2NZDA 1M18A 1P3IA 4J8UA 5AV6C 2F8NK 3X1TC 5AV8D 5B0ZD 1P34D 3NQUB 4WU9A 3C1CC 3AFAD 2AROD 4LD9D 1P3BD 3W96A 4J8WD 3REKC 1P3GC 5BO0B 3RELD 2CV5A 1P3KD 1AOID 3B6FB 4G92C 3MVDA 1KX4A 4J8VC 5AV5A 3REJC 3AZFA 5GT0C 5B24B 1KX5B 1TZYB 3LJAB 5AY8C 5B2IC 5B0ZC 3LZ0A 3AFAC 2AROC 3WA9A 4LD9C 4H9SA 3RELC 5CPIA 4J8XB 3KWQB 3R45A 3B6FD 1TAFB 3W98B 2FJ7A 2CWEA 3MGRA 3LELA 1P3IB 1KX5D 3MNNB 1TZYD 3LJAD 5B33C 3X1UC 4WU9B 3V9RA 5KDMA 4AWLB 5B1MA 5CPKC 3VH5A 2CV5B 3KXBC 4G91B 1U35A 4J8XD 3KWQD 3WKJC 4YM6B 3MVDB 4XUJA 4H9PA 3W98D 5GXQD 5G49B 1P3AD 5BNXB 5JA4A 3AZHD 2HIOB 4NE3A 5B32B 1M18D 3AZLA 3B0DC 1P3ID 3LZ0B 3MNND 1AOIC 4UUZB 3WTPB 1P3PA 4R8PA 5BT1D 4WU9D 1ZLAC 3WA9B 4JJNA 5CPIB 1P3LC 1B6WA 3KUYA 5BNVB 2CV5D 3X1TA 2F8NG 4Z5TB 3AV2C 3C1CA 3W98C 4YM6D 5GXQC 3MVDD 5AV5D 4ZUXC 1P3AC 1P3GA 3MGRB 3LELB 5B0YA 3AZHC 2NZDC 1M18C 2HUEB 1P3IC 5B40B 2HIOD 5B32D 4J8UC 3V9RB 5KDMB 3LZ0D 1F66C 3WTPD 3REJA 4KHAB 3WA9D 4AWLC 3W96C 5CPID 5AY8A 3AZMA 5B2IA 3C1BA 1U35B 5CHLB 3A6NB 4XUJB 1KX4C 5AV5C 5AVBB 3AZFC 4KGCA 1M1AA 3REIA 3MGRD 3LELD 1P3PB 4R8PB 4QLCA 2BYMB 4JJNB 5B31C 3WA9C 4H9SC 5AV6B 4XZQA 3X1TB 1M19A 5GSUA 5B33A 1U35D 3X1UA 5DNMA 3C1CB 2FJ7C 3WAAA 4XUJD 2F8NA 1P3GB 3REKB 4CSRA 5B0YB 5AVBD 3AZGC 3LELC 1A7WA 4G92B 2IO5C 4J8VB 3REJB 1P3PD 3VH6W 4R8PD 5GT0B 5B1MC 4JJND 3TU4C 4H9QA 5AY8B 5B2IB 3C1BB 5B0ZB 5AV6D 1U35C 3X1TD 4CAYB 1AOIA 1BH8A 4LD9B 3C1CD 3AZKC 1S32A 3REKD 1P3GD 3REIB 1M1AB 1P3LA 4NE5A 5B0YD 3AZJA 3W97A 3AZLC 3MGQA 3UT9A 1P3PC 4J8VD 1KX3A 4ZUXA 3REJD 4JJNC 3MGSC 5B33B 5AY8D 3KUYC 5B2ID 3X1UB 3C1BD 4WNNB 5DNMB 3AZMD 3WAAB 1F66A 5CPKB 3KXBB 3B6GA 5C3IC 4WV4B 3AV1C 5B0YC 1M1AD 3REID 3WKJB 4YS3C 3VH6A 4H9RA 3X1SC 3B0DB 3AZMC 3LZ1A 3C1BC 1P3MA 1AOIB 5B33D 3X1VA 3X1UD 5DNMD 1ZLAB 3WAAD 4Z66C 5B31A 5CPKD 1P3LB 3KXBD 3AZJB 4KGCC 4NE6A 1M1AC 3REIC 3AV2B 3VH6T 3WKJD 3UTBC 5GXQB 1KX3B 4ZUXB 5GT3A 1P3AB 4QLCC 3AZHB 3AZGA 2NZDB 1M18B 3O62A 4J8UB 4XZQC 5DNNA 1M19C 5GSUC 3WTPE 1F66B 5DNMC 3WAAC
chains in the Genus database with same CATH superfamily
4WZSB 1ZLAD 3W96B 1ID3A 3TU4A 1N1JA 4E44A 1S32D 1P3LD 3AZJD 1HQ3A 3AV2D 2PYOA 3AZNA 1KX4B 5AV5B 3W99A 3AZFB 3UT9D 1ULYA 3AZKA 1KX3D 4ZUXD 3MGPA 4M6BA 2NZDD 4DRBA 5CP6A 4J8UD 3REHA 1F66D 5B31B 3MGSA 3W96D 1S32C 3R45B 5AV9A 3AYWC 3AZJC 3W97C 2FJ7B 3MGQC 3UT9C 2F8NH 1KX4D 1KX3C 2YFWA 5B1LA 3AZGB 3AZFD 3AV1A 3P5JB 2IO5B 4YS3A 1P3OC 2NQBC 5B1MB 5E5AC 3TU4B 1P3FA 5B31D 3H0MC 1N1JB 3B6GC 3X1SA 4H9PB 2FJ7D 3W99B 4Z66A 3AZKB 5JA4B 5GT3D 3AN2A 3AZGD 5CP6B 3AZLB 4Z2MH 3LZ1C 1P3MC 3UTBA 5F99A 3X1VC 3MGSB 5B1MD 3TU4D 3KUYB 1Q9CA 5JRGA 5B1LB 3W99D 5GT3C 5C3IB 5AV8A 3AZKD 3AV1B 1P34A 4YS3B 4WJ3C 3O62C 5DNNC 5CP6D 3AZLD 1P3KA 4HGAC 3KSYA 4DQYB 1ID3C 3X1SB 3MGSD 2JCHA 3AZMB 3KUYD 1HQ3C 4E45A 3UTAC 4Z66B 2PYOC 3AZNC 3W99C 3AN2B 5B1LD 4KGCB 3MGPC 3AV1D 3AYWA 3NQUA 4EO5C 1F1EA 5CP6C 4YS3D 3UTBB 3REHC 5CPJA 5BO0A 4QLCB 3B6FA 1P3FD 4XZQB 3X1SD 1M19B 5GSUB 5AV9C 5B32G 1P3OA 1EQZA 5AVCC 5B24A 1KX5A 5JRGB 2F8NB 5E5AA 3B0CW 2NQBA 4Z66D 4CSRB 5B1LC 3AN2D 3EPHA 4KGCD 2XD5A 2FFFB 2LY8A 3UTBD 2RIQA 5F99D 2Y2GA 3KWQA 4QLCD 3H0RC 1WWIA 1P3FC 1TAFA 4H9QB 4XZQD 1M19D 5GSUD 1BH8B 4DRAA 5JRGD 4H9OA 3MNNA 1S32B 2F8ND 3A1KA 3AYWB 3AN2C 1Z2CB 3W97B 3VH5W 5CPJB 5F99C 3MGQB 3UT9B 4NFTA 4KUDC 4YM6A 1H3OA 1P3OB 1EQZB 4WU8C 5G49A 5BNXA 2NQBB 5E5AB 2HIOA 5B32A 3B0BA 5JRGC 5AV8C 3B6GB 2F2AC 1P34C 4UUZA 3WTPA 3AYWD 3EPLA 1P3BC 3UTAA 4J8WC 3W97D 2ZY3A 1P3KC 3EG5B 5FUGA 5CPJD 3MGQD 5BNVA 4Z5TA 4H9RB 3LZ1B 1P3MB 1P3OD 3X1VB 3B0CT 1EQZD 2Y2OA 5B24D 2NQBD 4H9OB 5E5AD 5B40A 3B6GD 3FDDA 5B2JA 4X23A 5AVCA 4KHAA 5CPJC 5GT3B 3B6FC 1H3OB 5BS7A 3A6NA 3O62B 5DNNB 3AZIA 4HGAB 5AVBA 3AZEA 3LZ1D 1EQZC 1P3MD 5B24C 3X1VD 1KX5C 1BFMA 1TZYC 2BYKA 1ID3B 3LJAC 3VH5T 3H0LC 2ZY2A 1HQ3B 3UTAB 2BYMA 2PYOB 5FUGB 3AZNB 5AV6A 4J8XC 3KWQC 3MGPB 4EO5B 4H9NA 3O62D 5DNND 3REHB 3REKA 1WWSA 1HTAA 1JFIA 4KUDA 3MNNC 1ID3D 5B2JB 5AV9B 5BT1C 4J8VA 4WU9C 4X23B 5AVCB 4WU8A 5GT0A 1HQ3D 3UTAD 2CV5C 2PYOD 4G91C 3AZND 2YFWB 1B67A 5B0ZA 4CAYA 4Z5TD 3MGPD 1BH9A 2YFVA 4YM6C 3AFAA 2AROA 3MVDC 3AZIB 4LD9A 1P3BA 4J8WA 3AZEB 4Z2MG 3RELA 3REHD 2BYKB 3NQJA 4ZBJB 1T3UA 2HIOC 5B32C 1P3FB 5B40D 3LZ0C 3WTPC 5B2JD 5AV9D 2Y2IA 4X23D 5AVCD 2RVQD 5CPIC 4WNNA 4Z5TC 4H9NB 3A6ND 5CPKA 3EPJA 3AZID 5F99B 3KXBA 3AZED 1JFIB 3MGRC 4KUDB 3WKJA 2HUEC 5B40C 2Y2LA 5B2JC 4WU8B 1KU5A 1R4VA 4X23C 2RVQC 2JSSA 1TZYA 5AV8B 3LJAA 1P34B 5B31G 1BH9B 2YFVB 3AFAB 3AL0C 2AROB 5BS7C 3A6NC 4XUJC 1P3BB 1ZLAA 4J8WB 3KFUG 3AZIC 3RELB 1P3KB 5AVBC 3AZEC 3NQJB 4J8XA 4ZBJC 3AV2A 4KUDD 3W98A 5GXQA 2L5AA 4R8PC 1P3AA 4WU8D 5GT0D 3AZHA 2NZDA 1M18A 2Y2PA 1P3IA 4J8UA 5AV6C 2F8NK 3X1TC 5AV8D 2Y2JA 5B0ZD 1P34D 3NQUB 4WU9A 2DF4C 3C1CC 3AFAD 2AROD 4LD9D 1P3BD 3W96A 4J8WD 3REKC 1P3GC 5BO0B 3RELD 2CV5A 1P3KD 1AOID 3B6FB 4G92C 2Y2KA 3MVDA 1KX4A 4J8VC 5AV5A 3REJC 3AZFA 5GT0C 5B24B 1KX5B 1TZYB 3LJAB 5AY8C 5B2IC 5B0ZC 3LZ0A 3AFAC 2AROC 3WA9A 4LD9C 4H9SA 3RELC 5CPIA 4J8XB 3KWQB 3R45A 2BG1A 3B6FD 1TAFB 3W98B 2FJ7A 2CWEA 2XD1A 2Y2NA 3LELA 3MGRA 1P3IB 1KX5D 3MNNB 1TZYD 3LJAD 1W2EA 5B33C 3X1UC 4WU9B 3EPKA 3V9RA 5KDMA 4AWLB 5B1MA 5CPKC 2ZY5A 3VH5A 2CV5B 3KXBC 4G91B 1U35A 4J8XD 3KWQD 3WKJC 4YM6B 3MVDB 4XUJA 4H9PA 3W98D 5GXQD 5G49B 1P3AD 5BNXB 5JA4A 3AZHD 2HIOB 4NE3A 5B32B 1M18D 3AZLA 3B0DC 1P3ID 3LZ0B 3MNND 1AOIC 4UUZB 3WTPB 1P3PA 4R8PA 5BT1D 4WU9D 1ZLAC 3WA9B 3F6TA 4JJNA 5CPIB 1P3LC 1B6WA 3KUYA 5BNVB 2CV5D 3X1TA 2F8NG 4Z5TB 3AV2C 3C1CA 3W98C 4YM6D 5GXQC 3MVDD 5AV5D 4ZUXC 1P3AC 1P3GA 3MGRB 1PZRA 3LELB 2Y2MA 5B0YA 3AZHC 2NZDC 1M18C 2HUEB 1P3IC 5B40B 2HIOD 5B32D 4J8UC 3V9RB 5KDMB 3LZ0D 1F66C 3WTPD 3REJA 4KHAB 3WA9D 4AWLC 3W96C 5CPID 5AY8A 3AZMA 5B2IA 2G5IC 3C1BA 1U35B 5CHLB 2ZY4A 3A6NB 4XUJB 1KX4C 5AV5C 5AVBB 3AZFC 2UWXA 4KGCA 1M1AA 3REIA 3MGRD 3LELD 1P3PB 4R8PB 4QLCA 2BYMB 4JJNB 5B31C 3WA9C 4H9SC 5AV6B 4XZQA 3X1TB 1M19A 5GSUA 5B33A 1U35D 3X1UA 5DNMA 3C1CB 2FJ7C 3WAAA 4XUJD 2F8NA 2J8PA 3REKB 1P3GB 4CSRA 5B0YB 5AVBD 3AZGC 3LELC 1A7WA 4G92B 2IO5C 2Y2QA 2ZM5A 4J8VB 3REJB 1P3PD 3VH6W 4R8PD 5GT0B 5B1MC 4JJND 3TU4C 4H9QA 5AY8B 5B2IB 3C1BB 5B0ZB 5AV6D 1U35C 3X1TD 4CAYB 1AOIA 1BH8A 4LD9B 3C1CD 2DQNC 3A1IA 3AZKC 3IP4C 1S32A 3REKD 1P3GD 3REIB 1M1AB 1P3LA 4NE5A 5B0YD 3AZJA 4UPKA 3W97A 3AZLC 3MGQA 3UT9A 1P3PC 4J8VD 1KX3A 4ZUXA 3REJD 4JJNC 3MGSC 5B33B 5AY8D 3KUYC 5B2ID 3X1UB 3C1BD 4WNNB 5DNMB 3AZMD 3WAAB 1F66A 5CPKB 3KXBB 3B6GA 5C3IC 4WV4B 3AV1C 5B0YC 1M1AD 3REID 3WKJB 4YS3C 2VQRA 3VH6A 4H9RA 3X1SC 3B0DB 2Y2HA 2G5HC 3AZMC 3LZ1A 3C1BC 1P3MA 1AOIB 5B33D 3X1VA 3X1UD 5DNMD 1ZLAB 3WAAD 4Z66C 5B31A 5CPKD 1P3LB 3KXBD 3AZJB 4KGCC 4NE6A 2W8SA 3REIC 1M1AC 3AV2B 3VH6T 3WKJD 3UTBC 5GXQB 1KX3B 4ZUXB 5GT3A 1P3AB 4QLCC 3AZHB 3AZGA 2NZDB 1M18B 2JE5A 3O62A 4J8UB 4XZQC 5DNNA 1M19C 5GSUC 3WTPE 1F66B 5DNMC 3WAAC
chains in the Genus database with same CATH topology
4WZSB 1ZLAD 3W96B 1ID3A 3TU4A 1N1JA 4E44A 1S32D 1P3LD 3AZJD 1HQ3A 3AV2D 2PYOA 3AZNA 1KX4B 5AV5B 3W99A 3AZFB 3UT9D 1ULYA 3AZKA 1KX3D 4ZUXD 3MGPA 4M6BA 2NZDD 4DRBA 5CP6A 4J8UD 3REHA 1F66D 5B31B 3MGSA 3W96D 1S32C 3R45B 5AV9A 3AYWC 3AZJC 3W97C 2FJ7B 3MGQC 3UT9C 2F8NH 1KX4D 1KX3C 2YFWA 5B1LA 3AZGB 3AZFD 3AV1A 3P5JB 2IO5B 4YS3A 1P3OC 2NQBC 5B1MB 5E5AC 3TU4B 1P3FA 5B31D 3H0MC 1N1JB 3B6GC 3X1SA 4H9PB 2FJ7D 3W99B 4Z66A 3AZKB 5JA4B 5GT3D 3AN2A 3AZGD 5CP6B 3AZLB 4Z2MH 3LZ1C 1P3MC 3UTBA 5F99A 3X1VC 3MGSB 5B1MD 3TU4D 3KUYB 1Q9CA 5JRGA 5B1LB 3W99D 5GT3C 5C3IB 5AV8A 3AZKD 3AV1B 1P34A 4YS3B 4WJ3C 3O62C 5DNNC 5CP6D 3AZLD 1P3KA 4HGAC 3KSYA 4DQYB 1ID3C 3X1SB 3MGSD 2JCHA 3AZMB 3KUYD 1HQ3C 4E45A 3UTAC 4Z66B 2PYOC 3AZNC 3W99C 3AN2B 5B1LD 4KGCB 3MGPC 3AV1D 3AYWA 3NQUA 4EO5C 1F1EA 5CP6C 4YS3D 3UTBB 3REHC 5CPJA 5BO0A 4QLCB 3B6FA 1P3FD 4XZQB 3X1SD 1M19B 5GSUB 5AV9C 5B32G 1P3OA 1EQZA 5AVCC 5B24A 1KX5A 5JRGB 2F8NB 5E5AA 3B0CW 2NQBA 4Z66D 4CSRB 5B1LC 3AN2D 3EPHA 4KGCD 2XD5A 2FFFB 2LY8A 3UTBD 2RIQA 5F99D 2Y2GA 3KWQA 4QLCD 3H0RC 1WWIA 1P3FC 1TAFA 4H9QB 4XZQD 1M19D 5GSUD 1BH8B 4DRAA 5JRGD 4H9OA 3MNNA 1S32B 2F8ND 3A1KA 3AYWB 3AN2C 1Z2CB 3W97B 3VH5W 5CPJB 5F99C 3MGQB 3UT9B 4NFTA 4KUDC 4YM6A 1H3OA 1P3OB 1EQZB 4WU8C 5G49A 5BNXA 2NQBB 5E5AB 2HIOA 5B32A 3B0BA 5JRGC 5AV8C 3B6GB 2F2AC 1P34C 4UUZA 3WTPA 3AYWD 3EPLA 1P3BC 3UTAA 4J8WC 3W97D 2ZY3A 1P3KC 3EG5B 5FUGA 5CPJD 3MGQD 5BNVA 4Z5TA 4H9RB 3LZ1B 1P3MB 1P3OD 3X1VB 3B0CT 1EQZD 2Y2OA 5B24D 2NQBD 4H9OB 5E5AD 5B40A 3B6GD 3FDDA 5B2JA 4X23A 5AVCA 4KHAA 5CPJC 5GT3B 3B6FC 1H3OB 5BS7A 3A6NA 3O62B 5DNNB 3AZIA 4HGAB 5AVBA 3AZEA 3LZ1D 1EQZC 1P3MD 5B24C 3X1VD 1KX5C 1BFMA 1TZYC 2BYKA 1ID3B 3LJAC 3VH5T 3H0LC 2ZY2A 1HQ3B 3UTAB 2BYMA 2PYOB 5FUGB 3AZNB 5AV6A 4J8XC 3KWQC 3MGPB 4EO5B 4H9NA 3O62D 5DNND 3REHB 3REKA 1WWSA 1HTAA 1JFIA 4KUDA 3MNNC 1ID3D 5B2JB 5AV9B 5BT1C 4J8VA 4WU9C 4X23B 5AVCB 4WU8A 5GT0A 1HQ3D 3UTAD 2CV5C 2PYOD 4G91C 3AZND 2YFWB 1B67A 5B0ZA 4CAYA 4Z5TD 3MGPD 1BH9A 2YFVA 4YM6C 3AFAA 2AROA 3MVDC 3AZIB 4LD9A 1P3BA 4J8WA 3AZEB 4Z2MG 3RELA 3REHD 2BYKB 3NQJA 4ZBJB 1T3UA 2HIOC 5B32C 1P3FB 5B40D 3LZ0C 3WTPC 5B2JD 5AV9D 2Y2IA 4X23D 5AVCD 2RVQD 5CPIC 4WNNA 4Z5TC 4H9NB 3A6ND 5CPKA 3EPJA 3AZID 5F99B 3KXBA 3AZED 1JFIB 3MGRC 4KUDB 3WKJA 2HUEC 5B40C 2Y2LA 5B2JC 4WU8B 1KU5A 1R4VA 4X23C 2RVQC 2JSSA 1TZYA 5AV8B 3LJAA 1P34B 5B31G 1BH9B 2YFVB 3AFAB 3AL0C 2AROB 5BS7C 3A6NC 4XUJC 1P3BB 1ZLAA 4J8WB 3KFUG 3AZIC 3RELB 1P3KB 5AVBC 3AZEC 3NQJB 4J8XA 4ZBJC 3AV2A 4KUDD 3W98A 5GXQA 2L5AA 4R8PC 1P3AA 4WU8D 5GT0D 3AZHA 2NZDA 1M18A 2Y2PA 1P3IA 4J8UA 5AV6C 2F8NK 3X1TC 5AV8D 2Y2JA 5B0ZD 1P34D 3NQUB 4WU9A 2DF4C 3C1CC 3AFAD 2AROD 4LD9D 1P3BD 3W96A 4J8WD 3REKC 1P3GC 5BO0B 3RELD 2CV5A 1P3KD 1AOID 3B6FB 4G92C 2Y2KA 3MVDA 1KX4A 4J8VC 5AV5A 3REJC 3AZFA 5GT0C 5B24B 1KX5B 1TZYB 3LJAB 5AY8C 5B2IC 5B0ZC 3LZ0A 3AFAC 2AROC 3WA9A 4LD9C 4H9SA 3RELC 5CPIA 4J8XB 3KWQB 3R45A 2BG1A 3B6FD 1TAFB 3W98B 2FJ7A 2CWEA 2XD1A 2Y2NA 3LELA 3MGRA 1P3IB 1KX5D 3MNNB 1TZYD 3LJAD 1W2EA 5B33C 3X1UC 4WU9B 3EPKA 3V9RA 5KDMA 4AWLB 5B1MA 5CPKC 2ZY5A 3VH5A 2CV5B 3KXBC 4G91B 1U35A 4J8XD 3KWQD 3WKJC 4YM6B 3MVDB 4XUJA 4H9PA 3W98D 5GXQD 5G49B 1P3AD 5BNXB 5JA4A 3AZHD 2HIOB 4NE3A 5B32B 1M18D 3AZLA 3B0DC 1P3ID 3LZ0B 3MNND 1AOIC 4UUZB 3WTPB 1P3PA 4R8PA 5BT1D 4WU9D 1ZLAC 3WA9B 3F6TA 4JJNA 5CPIB 1P3LC 1B6WA 3KUYA 5BNVB 2CV5D 3X1TA 2F8NG 4Z5TB 3AV2C 3C1CA 3W98C 4YM6D 5GXQC 3MVDD 5AV5D 4ZUXC 1P3AC 1P3GA 3MGRB 1PZRA 3LELB 2Y2MA 5B0YA 3AZHC 2NZDC 1M18C 2HUEB 1P3IC 5B40B 2HIOD 5B32D 4J8UC 3V9RB 5KDMB 3LZ0D 1F66C 3WTPD 3REJA 4KHAB 3WA9D 4AWLC 3W96C 5CPID 5AY8A 3AZMA 5B2IA 2G5IC 3C1BA 1U35B 5CHLB 2ZY4A 3A6NB 4XUJB 1KX4C 5AV5C 5AVBB 3AZFC 2UWXA 4KGCA 1M1AA 3REIA 3MGRD 3LELD 1P3PB 4R8PB 4QLCA 2BYMB 4JJNB 5B31C 3WA9C 4H9SC 5AV6B 4XZQA 3X1TB 1M19A 5GSUA 5B33A 1U35D 3X1UA 5DNMA 3C1CB 2FJ7C 3WAAA 4XUJD 2F8NA 2J8PA 3REKB 1P3GB 4CSRA 5B0YB 5AVBD 3AZGC 3LELC 1A7WA 4G92B 2IO5C 2Y2QA 2ZM5A 4J8VB 3REJB 1P3PD 3VH6W 4R8PD 5GT0B 5B1MC 4JJND 3TU4C 4H9QA 5AY8B 5B2IB 3C1BB 5B0ZB 5AV6D 1U35C 3X1TD 4CAYB 1AOIA 1BH8A 4LD9B 3C1CD 2DQNC 3A1IA 3AZKC 3IP4C 1S32A 3REKD 1P3GD 3REIB 1M1AB 1P3LA 4NE5A 5B0YD 3AZJA 4UPKA 3W97A 3AZLC 3MGQA 3UT9A 1P3PC 4J8VD 1KX3A 4ZUXA 3REJD 4JJNC 3MGSC 5B33B 5AY8D 3KUYC 5B2ID 3X1UB 3C1BD 4WNNB 5DNMB 3AZMD 3WAAB 1F66A 5CPKB 3KXBB 3B6GA 5C3IC 4WV4B 3AV1C 5B0YC 1M1AD 3REID 3WKJB 4YS3C 2VQRA 3VH6A 4H9RA 3X1SC 3B0DB 2Y2HA 2G5HC 3AZMC 3LZ1A 3C1BC 1P3MA 1AOIB 5B33D 3X1VA 3X1UD 5DNMD 1ZLAB 3WAAD 4Z66C 5B31A 5CPKD 1P3LB 3KXBD 3AZJB 4KGCC 4NE6A 2W8SA 3REIC 1M1AC 3AV2B 3VH6T 3WKJD 3UTBC 5GXQB 1KX3B 4ZUXB 5GT3A 1P3AB 4QLCC 3AZHB 3AZGA 2NZDB 1M18B 2JE5A 3O62A 4J8UB 4XZQC 5DNNA 1M19C 5GSUC 3WTPE 1F66B 5DNMC 3WAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZS B;  1ZLA D;  3W96 B;  1ID3 A;  3TU4 A;  1N1J A;  4E44 A;  1S32 D;  1P3L D;  3AZJ D;  1HQ3 A;  3AV2 D;  2PYO A;  3AZN A;  1KX4 B;  5AV5 B;  3W99 A;  3AZF B;  3UT9 D;  1ULY A;  3AZK A;  1KX3 D;  4ZUX D;  3MGP A;  4M6B A;  2NZD D;  4DRB A;  5CP6 A;  4J8U D;  3REH A;  1F66 D;  5B31 B;  3MGS A;  3W96 D;  1S32 C;  3R45 B;  5AV9 A;  3AYW C;  3AZJ C;  3W97 C;  2FJ7 B;  3MGQ C;  3UT9 C;  2F8N H;  1KX4 D;  1KX3 C;  2YFW A;  5B1L A;  3AZG B;  3AZF D;  3AV1 A;  2IO5 B;  4YS3 A;  1P3O C;  2NQB C;  5B1M B;  5E5A C;  3TU4 B;  1P3F A;  5B31 D;  1N1J B;  3B6G C;  3X1S A;  4H9P B;  2FJ7 D;  3W99 B;  4Z66 A;  3AZK B;  5JA4 B;  5GT3 D;  3AN2 A;  3AZG D;  5CP6 B;  3AZL B;  4Z2M H;  3LZ1 C;  1P3M C;  3UTB A;  5F99 A;  3X1V C;  3MGS B;  5B1M D;  3TU4 D;  3KUY B;  1Q9C A;  5JRG A;  5B1L B;  3W99 D;  5GT3 C;  5C3I B;  5AV8 A;  3AZK D;  3AV1 B;  1P34 A;  4YS3 B;  3O62 C;  5DNN C;  5CP6 D;  3AZL D;  1P3K A;  4HGA C;  3KSY A;  1ID3 C;  3X1S B;  3MGS D;  3AZM B;  3KUY D;  1HQ3 C;  4E45 A;  3UTA C;  4Z66 B;  2PYO C;  3AZN C;  3W99 C;  3AN2 B;  5B1L D;  4KGC B;  3MGP C;  3AV1 D;  3AYW A;  3NQU A;  4EO5 C;  1F1E A;  5CP6 C;  4YS3 D;  3UTB B;  3REH C;  5CPJ A;  5BO0 A;  4QLC B;  3B6F A;  1P3F D;  4XZQ B;  3X1S D;  1M19 B;  5GSU B;  5AV9 C;  5B32 G;  1P3O A;  1EQZ A;  5AVC C;  5B24 A;  1KX5 A;  5JRG B;  2F8N B;  5E5A A;  3B0C W;  2NQB A;  4Z66 D;  4CSR B;  5B1L C;  3AN2 D;  4KGC D;  2LY8 A;  3UTB D;  5F99 D;  3KWQ A;  4QLC D;  1WWI A;  1P3F C;  1TAF A;  4H9Q B;  4XZQ D;  1M19 D;  5GSU D;  1BH8 B;  4DRA A;  5JRG D;  4H9O A;  3MNN A;  1S32 B;  2F8N D;  3AYW B;  3AN2 C;  3W97 B;  3VH5 W;  5CPJ B;  5F99 C;  3MGQ B;  3UT9 B;  4NFT A;  4KUD C;  4YM6 A;  1H3O A;  1P3O B;  1EQZ B;  4WU8 C;  5G49 A;  5BNX A;  2NQB B;  5E5A B;  2HIO A;  5B32 A;  3B0B A;  5JRG C;  5AV8 C;  3B6G B;  1P34 C;  4UUZ A;  3WTP A;  3AYW D;  1P3B C;  3UTA A;  4J8W C;  3W97 D;  1P3K C;  5FUG A;  5CPJ D;  3MGQ D;  5BNV A;  4Z5T A;  4H9R B;  3LZ1 B;  1P3M B;  1P3O D;  3X1V B;  3B0C T;  1EQZ D;  5B24 D;  2NQB D;  4H9O B;  5E5A D;  5B40 A;  3B6G D;  5B2J A;  4X23 A;  5AVC A;  4KHA A;  5CPJ C;  5GT3 B;  3B6F C;  1H3O B;  5BS7 A;  3A6N A;  3O62 B;  5DNN B;  3AZI A;  4HGA B;  5AVB A;  3AZE A;  3LZ1 D;  1EQZ C;  1P3M D;  5B24 C;  3X1V D;  1KX5 C;  1BFM A;  1TZY C;  2BYK A;  1ID3 B;  3LJA C;  3VH5 T;  1HQ3 B;  3UTA B;  2BYM A;  2PYO B;  5FUG B;  3AZN B;  5AV6 A;  4J8X C;  3KWQ C;  3MGP B;  4EO5 B;  4H9N A;  3O62 D;  5DNN D;  3REH B;  3REK A;  1WWS A;  1HTA A;  1JFI A;  4KUD A;  3MNN C;  1ID3 D;  5B2J B;  5AV9 B;  5BT1 C;  4J8V A;  4WU9 C;  4X23 B;  5AVC B;  4WU8 A;  5GT0 A;  1HQ3 D;  3UTA D;  2CV5 C;  2PYO D;  4G91 C;  3AZN D;  2YFW B;  1B67 A;  5B0Z A;  4CAY A;  4Z5T D;  3MGP D;  1BH9 A;  2YFV A;  4YM6 C;  3AFA A;  2ARO A;  3MVD C;  3AZI B;  4LD9 A;  1P3B A;  4J8W A;  3AZE B;  4Z2M G;  3REL A;  3REH D;  2BYK B;  3NQJ A;  4ZBJ B;  2HIO C;  5B32 C;  1P3F B;  5B40 D;  3LZ0 C;  3WTP C;  5AV9 D;  5B2J D;  4X23 D;  5AVC D;  2RVQ D;  5CPI C;  4WNN A;  4Z5T C;  4H9N B;  3A6N D;  5CPK A;  3AZI D;  5F99 B;  3KXB A;  3AZE D;  1JFI B;  3MGR C;  4KUD B;  3WKJ A;  2HUE C;  5B40 C;  5B2J C;  4WU8 B;  1KU5 A;  1R4V A;  4X23 C;  2RVQ C;  2JSS A;  1TZY A;  5AV8 B;  3LJA A;  1P34 B;  5B31 G;  1BH9 B;  2YFV B;  3AFA B;  2ARO B;  5BS7 C;  3A6N C;  4XUJ C;  1P3B B;  1ZLA A;  4J8W B;  3AZI C;  3REL B;  1P3K B;  5AVB C;  3AZE C;  3NQJ B;  4J8X A;  4ZBJ C;  3AV2 A;  4KUD D;  3W98 A;  5GXQ A;  2L5A A;  4R8P C;  1P3A A;  4WU8 D;  5GT0 D;  3AZH A;  2NZD A;  1M18 A;  1P3I A;  4J8U A;  5AV6 C;  2F8N K;  3X1T C;  5AV8 D;  5B0Z D;  1P34 D;  3NQU B;  4WU9 A;  3C1C C;  3AFA D;  2ARO D;  4LD9 D;  1P3B D;  3W96 A;  4J8W D;  3REK C;  1P3G C;  5BO0 B;  3REL D;  2CV5 A;  1P3K D;  1AOI D;  3B6F B;  4G92 C;  3MVD A;  1KX4 A;  4J8V C;  5AV5 A;  3REJ C;  3AZF A;  5GT0 C;  5B24 B;  1KX5 B;  1TZY B;  3LJA B;  5AY8 C;  5B2I C;  5B0Z C;  3LZ0 A;  3AFA C;  2ARO C;  3WA9 A;  4LD9 C;  4H9S A;  3REL C;  5CPI A;  4J8X B;  3KWQ B;  3R45 A;  3B6F D;  1TAF B;  3W98 B;  2FJ7 A;  2CWE A;  3MGR A;  3LEL A;  1P3I B;  1KX5 D;  3MNN B;  1TZY D;  3LJA D;  5B33 C;  3X1U C;  4WU9 B;  3V9R A;  5KDM A;  4AWL B;  5B1M A;  5CPK C;  3VH5 A;  2CV5 B;  3KXB C;  4G91 B;  1U35 A;  4J8X D;  3KWQ D;  3WKJ C;  4YM6 B;  3MVD B;  4XUJ A;  4H9P A;  3W98 D;  5GXQ D;  5G49 B;  1P3A D;  5BNX B;  5JA4 A;  3AZH D;  2HIO B;  4NE3 A;  5B32 B;  1M18 D;  3AZL A;  3B0D C;  1P3I D;  3LZ0 B;  3MNN D;  1AOI C;  4UUZ B;  3WTP B;  1P3P A;  4R8P A;  5BT1 D;  4WU9 D;  1ZLA C;  3WA9 B;  4JJN A;  5CPI B;  1P3L C;  1B6W A;  3KUY A;  5BNV B;  2CV5 D;  3X1T A;  2F8N G;  4Z5T B;  3AV2 C;  3C1C A;  3W98 C;  4YM6 D;  5GXQ C;  3MVD D;  5AV5 D;  4ZUX C;  1P3A C;  1P3G A;  3MGR B;  3LEL B;  5B0Y A;  3AZH C;  2NZD C;  1M18 C;  2HUE B;  1P3I C;  5B40 B;  2HIO D;  5B32 D;  4J8U C;  3V9R B;  5KDM B;  3LZ0 D;  1F66 C;  3WTP D;  3REJ A;  4KHA B;  3WA9 D;  4AWL C;  3W96 C;  5CPI D;  5AY8 A;  3AZM A;  5B2I A;  3C1B A;  1U35 B;  5CHL B;  3A6N B;  4XUJ B;  1KX4 C;  5AV5 C;  5AVB B;  3AZF C;  4KGC A;  1M1A A;  3REI A;  3MGR D;  3LEL D;  1P3P B;  4R8P B;  4QLC A;  2BYM B;  4JJN B;  5B31 C;  3WA9 C;  4H9S C;  5AV6 B;  4XZQ A;  3X1T B;  1M19 A;  5GSU A;  5B33 A;  1U35 D;  3X1U A;  5DNM A;  3C1C B;  2FJ7 C;  3WAA A;  4XUJ D;  2F8N A;  1P3G B;  3REK B;  4CSR A;  5B0Y B;  5AVB D;  3AZG C;  3LEL C;  1A7W A;  4G92 B;  2IO5 C;  4J8V B;  3REJ B;  1P3P D;  3VH6 W;  4R8P D;  5GT0 B;  5B1M C;  4JJN D;  3TU4 C;  4H9Q A;  5AY8 B;  5B2I B;  3C1B B;  5B0Z B;  5AV6 D;  1U35 C;  3X1T D;  4CAY B;  1AOI A;  1BH8 A;  4LD9 B;  3C1C D;  3AZK C;  1S32 A;  3REK D;  1P3G D;  3REI B;  1M1A B;  1P3L A;  4NE5 A;  5B0Y D;  3AZJ A;  3W97 A;  3AZL C;  3MGQ A;  3UT9 A;  1P3P C;  4J8V D;  1KX3 A;  4ZUX A;  3REJ D;  4JJN C;  3MGS C;  5B33 B;  5AY8 D;  3KUY C;  5B2I D;  3X1U B;  3C1B D;  4WNN B;  5DNM B;  3AZM D;  3WAA B;  1F66 A;  5CPK B;  3KXB B;  3B6G A;  5C3I C;  4WV4 B;  3AV1 C;  5B0Y C;  1M1A D;  3REI D;  3WKJ B;  4YS3 C;  3VH6 A;  4H9R A;  3X1S C;  3B0D B;  3AZM C;  3LZ1 A;  3C1B C;  1P3M A;  1AOI B;  5B33 D;  3X1V A;  3X1U D;  5DNM D;  1ZLA B;  3WAA D;  4Z66 C;  5B31 A;  5CPK D;  1P3L B;  3KXB D;  3AZJ B;  4KGC C;  4NE6 A;  1M1A C;  3REI C;  3AV2 B;  3VH6 T;  3WKJ D;  3UTB C;  5GXQ B;  1KX3 B;  4ZUX B;  5GT3 A;  1P3A B;  4QLC C;  3AZH B;  3AZG A;  2NZD B;  1M18 B;  3O62 A;  4J8U B;  4XZQ C;  5DNN A;  1M19 C;  5GSU C;  3WTP E;  1F66 B;  5DNM C;  3WAA C; 
#chains in the Genus database with same CATH topology
 4WZS B;  1ZLA D;  3W96 B;  1ID3 A;  3TU4 A;  1N1J A;  4E44 A;  1S32 D;  1P3L D;  3AZJ D;  1HQ3 A;  3AV2 D;  2PYO A;  3AZN A;  1KX4 B;  5AV5 B;  3W99 A;  3AZF B;  3UT9 D;  1ULY A;  3AZK A;  1KX3 D;  4ZUX D;  3MGP A;  4M6B A;  2NZD D;  4DRB A;  5CP6 A;  4J8U D;  3REH A;  1F66 D;  5B31 B;  3MGS A;  3W96 D;  1S32 C;  3R45 B;  5AV9 A;  3AYW C;  3AZJ C;  3W97 C;  2FJ7 B;  3MGQ C;  3UT9 C;  2F8N H;  1KX4 D;  1KX3 C;  2YFW A;  5B1L A;  3AZG B;  3AZF D;  3AV1 A;  3P5J B;  2IO5 B;  4YS3 A;  1P3O C;  2NQB C;  5B1M B;  5E5A C;  3TU4 B;  1P3F A;  5B31 D;  3H0M C;  1N1J B;  3B6G C;  3X1S A;  4H9P B;  2FJ7 D;  3W99 B;  4Z66 A;  3AZK B;  5JA4 B;  5GT3 D;  3AN2 A;  3AZG D;  5CP6 B;  3AZL B;  4Z2M H;  3LZ1 C;  1P3M C;  3UTB A;  5F99 A;  3X1V C;  3MGS B;  5B1M D;  3TU4 D;  3KUY B;  1Q9C A;  5JRG A;  5B1L B;  3W99 D;  5GT3 C;  5C3I B;  5AV8 A;  3AZK D;  3AV1 B;  1P34 A;  4YS3 B;  4WJ3 C;  3O62 C;  5DNN C;  5CP6 D;  3AZL D;  1P3K A;  4HGA C;  3KSY A;  4DQY B;  1ID3 C;  3X1S B;  3MGS D;  2JCH A;  3AZM B;  3KUY D;  1HQ3 C;  4E45 A;  3UTA C;  4Z66 B;  2PYO C;  3AZN C;  3W99 C;  3AN2 B;  5B1L D;  4KGC B;  3MGP C;  3AV1 D;  3AYW A;  3NQU A;  4EO5 C;  1F1E A;  5CP6 C;  4YS3 D;  3UTB B;  3REH C;  5CPJ A;  5BO0 A;  4QLC B;  3B6F A;  1P3F D;  4XZQ B;  3X1S D;  1M19 B;  5GSU B;  5AV9 C;  5B32 G;  1P3O A;  1EQZ A;  5AVC C;  5B24 A;  1KX5 A;  5JRG B;  2F8N B;  5E5A A;  3B0C W;  2NQB A;  4Z66 D;  4CSR B;  5B1L C;  3AN2 D;  3EPH A;  4KGC D;  2XD5 A;  2FFF B;  2LY8 A;  3UTB D;  2RIQ A;  5F99 D;  2Y2G A;  3KWQ A;  4QLC D;  3H0R C;  1WWI A;  1P3F C;  1TAF A;  4H9Q B;  4XZQ D;  1M19 D;  5GSU D;  1BH8 B;  4DRA A;  5JRG D;  4H9O A;  3MNN A;  1S32 B;  2F8N D;  3A1K A;  3AYW B;  3AN2 C;  1Z2C B;  3W97 B;  3VH5 W;  5CPJ B;  5F99 C;  3MGQ B;  3UT9 B;  4NFT A;  4KUD C;  4YM6 A;  1H3O A;  1P3O B;  1EQZ B;  4WU8 C;  5G49 A;  5BNX A;  2NQB B;  5E5A B;  2HIO A;  5B32 A;  3B0B A;  5JRG C;  5AV8 C;  3B6G B;  2F2A C;  1P34 C;  4UUZ A;  3WTP A;  3AYW D;  3EPL A;  1P3B C;  3UTA A;  4J8W C;  3W97 D;  2ZY3 A;  1P3K C;  3EG5 B;  5FUG A;  5CPJ D;  3MGQ D;  5BNV A;  4Z5T A;  4H9R B;  3LZ1 B;  1P3M B;  1P3O D;  3X1V B;  3B0C T;  1EQZ D;  2Y2O A;  5B24 D;  2NQB D;  4H9O B;  5E5A D;  5B40 A;  3B6G D;  3FDD A;  5B2J A;  4X23 A;  5AVC A;  4KHA A;  5CPJ C;  5GT3 B;  3B6F C;  1H3O B;  5BS7 A;  3A6N A;  3O62 B;  5DNN B;  3AZI A;  4HGA B;  5AVB A;  3AZE A;  3LZ1 D;  1EQZ C;  1P3M D;  5B24 C;  3X1V D;  1KX5 C;  1BFM A;  1TZY C;  2BYK A;  1ID3 B;  3LJA C;  3VH5 T;  3H0L C;  2ZY2 A;  1HQ3 B;  3UTA B;  2BYM A;  2PYO B;  5FUG B;  3AZN B;  5AV6 A;  4J8X C;  3KWQ C;  3MGP B;  4EO5 B;  4H9N A;  3O62 D;  5DNN D;  3REH B;  3REK A;  1WWS A;  1HTA A;  1JFI A;  4KUD A;  3MNN C;  1ID3 D;  5B2J B;  5AV9 B;  5BT1 C;  4J8V A;  4WU9 C;  4X23 B;  5AVC B;  4WU8 A;  5GT0 A;  1HQ3 D;  3UTA D;  2CV5 C;  2PYO D;  4G91 C;  3AZN D;  2YFW B;  1B67 A;  5B0Z A;  4CAY A;  4Z5T D;  3MGP D;  1BH9 A;  2YFV A;  4YM6 C;  3AFA A;  2ARO A;  3MVD C;  3AZI B;  4LD9 A;  1P3B A;  4J8W A;  3AZE B;  4Z2M G;  3REL A;  3REH D;  2BYK B;  3NQJ A;  4ZBJ B;  1T3U A;  2HIO C;  5B32 C;  1P3F B;  5B40 D;  3LZ0 C;  3WTP C;  5B2J D;  5AV9 D;  2Y2I A;  4X23 D;  5AVC D;  2RVQ D;  5CPI C;  4WNN A;  4Z5T C;  4H9N B;  3A6N D;  5CPK A;  3EPJ A;  3AZI D;  5F99 B;  3KXB A;  3AZE D;  1JFI B;  3MGR C;  4KUD B;  3WKJ A;  2HUE C;  5B40 C;  2Y2L A;  5B2J C;  4WU8 B;  1KU5 A;  1R4V A;  4X23 C;  2RVQ C;  2JSS A;  1TZY A;  5AV8 B;  3LJA A;  1P34 B;  5B31 G;  1BH9 B;  2YFV B;  3AFA B;  3AL0 C;  2ARO B;  5BS7 C;  3A6N C;  4XUJ C;  1P3B B;  1ZLA A;  4J8W B;  3KFU G;  3AZI C;  3REL B;  1P3K B;  5AVB C;  3AZE C;  3NQJ B;  4J8X A;  4ZBJ C;  3AV2 A;  4KUD D;  3W98 A;  5GXQ A;  2L5A A;  4R8P C;  1P3A A;  4WU8 D;  5GT0 D;  3AZH A;  2NZD A;  1M18 A;  2Y2P A;  1P3I A;  4J8U A;  5AV6 C;  2F8N K;  3X1T C;  5AV8 D;  2Y2J A;  5B0Z D;  1P34 D;  3NQU B;  4WU9 A;  2DF4 C;  3C1C C;  3AFA D;  2ARO D;  4LD9 D;  1P3B D;  3W96 A;  4J8W D;  3REK C;  1P3G C;  5BO0 B;  3REL D;  2CV5 A;  1P3K D;  1AOI D;  3B6F B;  4G92 C;  2Y2K A;  3MVD A;  1KX4 A;  4J8V C;  5AV5 A;  3REJ C;  3AZF A;  5GT0 C;  5B24 B;  1KX5 B;  1TZY B;  3LJA B;  5AY8 C;  5B2I C;  5B0Z C;  3LZ0 A;  3AFA C;  2ARO C;  3WA9 A;  4LD9 C;  4H9S A;  3REL C;  5CPI A;  4J8X B;  3KWQ B;  3R45 A;  2BG1 A;  3B6F D;  1TAF B;  3W98 B;  2FJ7 A;  2CWE A;  2XD1 A;  2Y2N A;  3LEL A;  3MGR A;  1P3I B;  1KX5 D;  3MNN B;  1TZY D;  3LJA D;  1W2E A;  5B33 C;  3X1U C;  4WU9 B;  3EPK A;  3V9R A;  5KDM A;  4AWL B;  5B1M A;  5CPK C;  2ZY5 A;  3VH5 A;  2CV5 B;  3KXB C;  4G91 B;  1U35 A;  4J8X D;  3KWQ D;  3WKJ C;  4YM6 B;  3MVD B;  4XUJ A;  4H9P A;  3W98 D;  5GXQ D;  5G49 B;  1P3A D;  5BNX B;  5JA4 A;  3AZH D;  2HIO B;  4NE3 A;  5B32 B;  1M18 D;  3AZL A;  3B0D C;  1P3I D;  3LZ0 B;  3MNN D;  1AOI C;  4UUZ B;  3WTP B;  1P3P A;  4R8P A;  5BT1 D;  4WU9 D;  1ZLA C;  3WA9 B;  3F6T A;  4JJN A;  5CPI B;  1P3L C;  1B6W A;  3KUY A;  5BNV B;  2CV5 D;  3X1T A;  2F8N G;  4Z5T B;  3AV2 C;  3C1C A;  3W98 C;  4YM6 D;  5GXQ C;  3MVD D;  5AV5 D;  4ZUX C;  1P3A C;  1P3G A;  3MGR B;  1PZR A;  3LEL B;  2Y2M A;  5B0Y A;  3AZH C;  2NZD C;  1M18 C;  2HUE B;  1P3I C;  5B40 B;  2HIO D;  5B32 D;  4J8U C;  3V9R B;  5KDM B;  3LZ0 D;  1F66 C;  3WTP D;  3REJ A;  4KHA B;  3WA9 D;  4AWL C;  3W96 C;  5CPI D;  5AY8 A;  3AZM A;  5B2I A;  2G5I C;  3C1B A;  1U35 B;  5CHL B;  2ZY4 A;  3A6N B;  4XUJ B;  1KX4 C;  5AV5 C;  5AVB B;  3AZF C;  2UWX A;  4KGC A;  1M1A A;  3REI A;  3MGR D;  3LEL D;  1P3P B;  4R8P B;  4QLC A;  2BYM B;  4JJN B;  5B31 C;  3WA9 C;  4H9S C;  5AV6 B;  4XZQ A;  3X1T B;  1M19 A;  5GSU A;  5B33 A;  1U35 D;  3X1U A;  5DNM A;  3C1C B;  2FJ7 C;  3WAA A;  4XUJ D;  2F8N A;  2J8P A;  3REK B;  1P3G B;  4CSR A;  5B0Y B;  5AVB D;  3AZG C;  3LEL C;  1A7W A;  4G92 B;  2IO5 C;  2Y2Q A;  2ZM5 A;  4J8V B;  3REJ B;  1P3P D;  3VH6 W;  4R8P D;  5GT0 B;  5B1M C;  4JJN D;  3TU4 C;  4H9Q A;  5AY8 B;  5B2I B;  3C1B B;  5B0Z B;  5AV6 D;  1U35 C;  3X1T D;  4CAY B;  1AOI A;  1BH8 A;  4LD9 B;  3C1C D;  2DQN C;  3A1I A;  3AZK C;  3IP4 C;  1S32 A;  3REK D;  1P3G D;  3REI B;  1M1A B;  1P3L A;  4NE5 A;  5B0Y D;  3AZJ A;  4UPK A;  3W97 A;  3AZL C;  3MGQ A;  3UT9 A;  1P3P C;  4J8V D;  1KX3 A;  4ZUX A;  3REJ D;  4JJN C;  3MGS C;  5B33 B;  5AY8 D;  3KUY C;  5B2I D;  3X1U B;  3C1B D;  4WNN B;  5DNM B;  3AZM D;  3WAA B;  1F66 A;  5CPK B;  3KXB B;  3B6G A;  5C3I C;  4WV4 B;  3AV1 C;  5B0Y C;  1M1A D;  3REI D;  3WKJ B;  4YS3 C;  2VQR A;  3VH6 A;  4H9R A;  3X1S C;  3B0D B;  2Y2H A;  2G5H C;  3AZM C;  3LZ1 A;  3C1B C;  1P3M A;  1AOI B;  5B33 D;  3X1V A;  3X1U D;  5DNM D;  1ZLA B;  3WAA D;  4Z66 C;  5B31 A;  5CPK D;  1P3L B;  3KXB D;  3AZJ B;  4KGC C;  4NE6 A;  2W8S A;  3REI C;  1M1A C;  3AV2 B;  3VH6 T;  3WKJ D;  3UTB C;  5GXQ B;  1KX3 B;  4ZUX B;  5GT3 A;  1P3A B;  4QLC C;  3AZH B;  3AZG A;  2NZD B;  1M18 B;  2JE5 A;  3O62 A;  4J8U B;  4XZQ C;  5DNN A;  1M19 C;  5GSU C;  3WTP E;  1F66 B;  5DNM C;  3WAA C; 
#chains in the Genus database with same CATH homology
 4WZS B;  1ZLA D;  3W96 B;  1ID3 A;  3TU4 A;  1N1J A;  4E44 A;  1S32 D;  1P3L D;  3AZJ D;  1HQ3 A;  3AV2 D;  2PYO A;  3AZN A;  1KX4 B;  5AV5 B;  3W99 A;  3AZF B;  3UT9 D;  1ULY A;  3AZK A;  1KX3 D;  4ZUX D;  3MGP A;  4M6B A;  2NZD D;  4DRB A;  5CP6 A;  4J8U D;  3REH A;  1F66 D;  5B31 B;  3MGS A;  3W96 D;  1S32 C;  3R45 B;  5AV9 A;  3AYW C;  3AZJ C;  3W97 C;  2FJ7 B;  3MGQ C;  3UT9 C;  2F8N H;  1KX4 D;  1KX3 C;  2YFW A;  5B1L A;  3AZG B;  3AZF D;  3AV1 A;  3P5J B;  2IO5 B;  4YS3 A;  1P3O C;  2NQB C;  5B1M B;  5E5A C;  3TU4 B;  1P3F A;  5B31 D;  3H0M C;  1N1J B;  3B6G C;  3X1S A;  4H9P B;  2FJ7 D;  3W99 B;  4Z66 A;  3AZK B;  5JA4 B;  5GT3 D;  3AN2 A;  3AZG D;  5CP6 B;  3AZL B;  4Z2M H;  3LZ1 C;  1P3M C;  3UTB A;  5F99 A;  3X1V C;  3MGS B;  5B1M D;  3TU4 D;  3KUY B;  1Q9C A;  5JRG A;  5B1L B;  3W99 D;  5GT3 C;  5C3I B;  5AV8 A;  3AZK D;  3AV1 B;  1P34 A;  4YS3 B;  4WJ3 C;  3O62 C;  5DNN C;  5CP6 D;  3AZL D;  1P3K A;  4HGA C;  3KSY A;  4DQY B;  1ID3 C;  3X1S B;  3MGS D;  2JCH A;  3AZM B;  3KUY D;  1HQ3 C;  4E45 A;  3UTA C;  4Z66 B;  2PYO C;  3AZN C;  3W99 C;  3AN2 B;  5B1L D;  4KGC B;  3MGP C;  3AV1 D;  3AYW A;  3NQU A;  4EO5 C;  1F1E A;  5CP6 C;  4YS3 D;  3UTB B;  3REH C;  5CPJ A;  5BO0 A;  4QLC B;  3B6F A;  1P3F D;  4XZQ B;  3X1S D;  1M19 B;  5GSU B;  5AV9 C;  5B32 G;  1P3O A;  1EQZ A;  5AVC C;  5B24 A;  1KX5 A;  5JRG B;  2F8N B;  5E5A A;  3B0C W;  2NQB A;  4Z66 D;  4CSR B;  5B1L C;  3AN2 D;  3EPH A;  4KGC D;  2XD5 A;  2FFF B;  2LY8 A;  3UTB D;  2RIQ A;  5F99 D;  2Y2G A;  3KWQ A;  4QLC D;  3H0R C;  1WWI A;  1P3F C;  1TAF A;  4H9Q B;  4XZQ D;  1M19 D;  5GSU D;  1BH8 B;  4DRA A;  5JRG D;  4H9O A;  3MNN A;  1S32 B;  2F8N D;  3A1K A;  3AYW B;  3AN2 C;  1Z2C B;  3W97 B;  3VH5 W;  5CPJ B;  5F99 C;  3MGQ B;  3UT9 B;  4NFT A;  4KUD C;  4YM6 A;  1H3O A;  1P3O B;  1EQZ B;  4WU8 C;  5G49 A;  5BNX A;  2NQB B;  5E5A B;  2HIO A;  5B32 A;  3B0B A;  5JRG C;  5AV8 C;  3B6G B;  2F2A C;  1P34 C;  4UUZ A;  3WTP A;  3AYW D;  3EPL A;  1P3B C;  3UTA A;  4J8W C;  3W97 D;  2ZY3 A;  1P3K C;  3EG5 B;  5FUG A;  5CPJ D;  3MGQ D;  5BNV A;  4Z5T A;  4H9R B;  3LZ1 B;  1P3M B;  1P3O D;  3X1V B;  3B0C T;  1EQZ D;  2Y2O A;  5B24 D;  2NQB D;  4H9O B;  5E5A D;  5B40 A;  3B6G D;  3FDD A;  5B2J A;  4X23 A;  5AVC A;  4KHA A;  5CPJ C;  5GT3 B;  3B6F C;  1H3O B;  5BS7 A;  3A6N A;  3O62 B;  5DNN B;  3AZI A;  4HGA B;  5AVB A;  3AZE A;  3LZ1 D;  1EQZ C;  1P3M D;  5B24 C;  3X1V D;  1KX5 C;  1BFM A;  1TZY C;  2BYK A;  1ID3 B;  3LJA C;  3VH5 T;  3H0L C;  2ZY2 A;  1HQ3 B;  3UTA B;  2BYM A;  2PYO B;  5FUG B;  3AZN B;  5AV6 A;  4J8X C;  3KWQ C;  3MGP B;  4EO5 B;  4H9N A;  3O62 D;  5DNN D;  3REH B;  3REK A;  1WWS A;  1HTA A;  1JFI A;  4KUD A;  3MNN C;  1ID3 D;  5B2J B;  5AV9 B;  5BT1 C;  4J8V A;  4WU9 C;  4X23 B;  5AVC B;  4WU8 A;  5GT0 A;  1HQ3 D;  3UTA D;  2CV5 C;  2PYO D;  4G91 C;  3AZN D;  2YFW B;  1B67 A;  5B0Z A;  4CAY A;  4Z5T D;  3MGP D;  1BH9 A;  2YFV A;  4YM6 C;  3AFA A;  2ARO A;  3MVD C;  3AZI B;  4LD9 A;  1P3B A;  4J8W A;  3AZE B;  4Z2M G;  3REL A;  3REH D;  2BYK B;  3NQJ A;  4ZBJ B;  1T3U A;  2HIO C;  5B32 C;  1P3F B;  5B40 D;  3LZ0 C;  3WTP C;  5B2J D;  5AV9 D;  2Y2I A;  4X23 D;  5AVC D;  2RVQ D;  5CPI C;  4WNN A;  4Z5T C;  4H9N B;  3A6N D;  5CPK A;  3EPJ A;  3AZI D;  5F99 B;  3KXB A;  3AZE D;  1JFI B;  3MGR C;  4KUD B;  3WKJ A;  2HUE C;  5B40 C;  2Y2L A;  5B2J C;  4WU8 B;  1KU5 A;  1R4V A;  4X23 C;  2RVQ C;  2JSS A;  1TZY A;  5AV8 B;  3LJA A;  1P34 B;  5B31 G;  1BH9 B;  2YFV B;  3AFA B;  3AL0 C;  2ARO B;  5BS7 C;  3A6N C;  4XUJ C;  1P3B B;  1ZLA A;  4J8W B;  3KFU G;  3AZI C;  3REL B;  1P3K B;  5AVB C;  3AZE C;  3NQJ B;  4J8X A;  4ZBJ C;  3AV2 A;  4KUD D;  3W98 A;  5GXQ A;  2L5A A;  4R8P C;  1P3A A;  4WU8 D;  5GT0 D;  3AZH A;  2NZD A;  1M18 A;  2Y2P A;  1P3I A;  4J8U A;  5AV6 C;  2F8N K;  3X1T C;  5AV8 D;  2Y2J A;  5B0Z D;  1P34 D;  3NQU B;  4WU9 A;  2DF4 C;  3C1C C;  3AFA D;  2ARO D;  4LD9 D;  1P3B D;  3W96 A;  4J8W D;  3REK C;  1P3G C;  5BO0 B;  3REL D;  2CV5 A;  1P3K D;  1AOI D;  3B6F B;  4G92 C;  2Y2K A;  3MVD A;  1KX4 A;  4J8V C;  5AV5 A;  3REJ C;  3AZF A;  5GT0 C;  5B24 B;  1KX5 B;  1TZY B;  3LJA B;  5AY8 C;  5B2I C;  5B0Z C;  3LZ0 A;  3AFA C;  2ARO C;  3WA9 A;  4LD9 C;  4H9S A;  3REL C;  5CPI A;  4J8X B;  3KWQ B;  3R45 A;  2BG1 A;  3B6F D;  1TAF B;  3W98 B;  2FJ7 A;  2CWE A;  2XD1 A;  2Y2N A;  3LEL A;  3MGR A;  1P3I B;  1KX5 D;  3MNN B;  1TZY D;  3LJA D;  1W2E A;  5B33 C;  3X1U C;  4WU9 B;  3EPK A;  3V9R A;  5KDM A;  4AWL B;  5B1M A;  5CPK C;  2ZY5 A;  3VH5 A;  2CV5 B;  3KXB C;  4G91 B;  1U35 A;  4J8X D;  3KWQ D;  3WKJ C;  4YM6 B;  3MVD B;  4XUJ A;  4H9P A;  3W98 D;  5GXQ D;  5G49 B;  1P3A D;  5BNX B;  5JA4 A;  3AZH D;  2HIO B;  4NE3 A;  5B32 B;  1M18 D;  3AZL A;  3B0D C;  1P3I D;  3LZ0 B;  3MNN D;  1AOI C;  4UUZ B;  3WTP B;  1P3P A;  4R8P A;  5BT1 D;  4WU9 D;  1ZLA C;  3WA9 B;  3F6T A;  4JJN A;  5CPI B;  1P3L C;  1B6W A;  3KUY A;  5BNV B;  2CV5 D;  3X1T A;  2F8N G;  4Z5T B;  3AV2 C;  3C1C A;  3W98 C;  4YM6 D;  5GXQ C;  3MVD D;  5AV5 D;  4ZUX C;  1P3A C;  1P3G A;  3MGR B;  1PZR A;  3LEL B;  2Y2M A;  5B0Y A;  3AZH C;  2NZD C;  1M18 C;  2HUE B;  1P3I C;  5B40 B;  2HIO D;  5B32 D;  4J8U C;  3V9R B;  5KDM B;  3LZ0 D;  1F66 C;  3WTP D;  3REJ A;  4KHA B;  3WA9 D;  4AWL C;  3W96 C;  5CPI D;  5AY8 A;  3AZM A;  5B2I A;  2G5I C;  3C1B A;  1U35 B;  5CHL B;  2ZY4 A;  3A6N B;  4XUJ B;  1KX4 C;  5AV5 C;  5AVB B;  3AZF C;  2UWX A;  4KGC A;  1M1A A;  3REI A;  3MGR D;  3LEL D;  1P3P B;  4R8P B;  4QLC A;  2BYM B;  4JJN B;  5B31 C;  3WA9 C;  4H9S C;  5AV6 B;  4XZQ A;  3X1T B;  1M19 A;  5GSU A;  5B33 A;  1U35 D;  3X1U A;  5DNM A;  3C1C B;  2FJ7 C;  3WAA A;  4XUJ D;  2F8N A;  2J8P A;  3REK B;  1P3G B;  4CSR A;  5B0Y B;  5AVB D;  3AZG C;  3LEL C;  1A7W A;  4G92 B;  2IO5 C;  2Y2Q A;  2ZM5 A;  4J8V B;  3REJ B;  1P3P D;  3VH6 W;  4R8P D;  5GT0 B;  5B1M C;  4JJN D;  3TU4 C;  4H9Q A;  5AY8 B;  5B2I B;  3C1B B;  5B0Z B;  5AV6 D;  1U35 C;  3X1T D;  4CAY B;  1AOI A;  1BH8 A;  4LD9 B;  3C1C D;  2DQN C;  3A1I A;  3AZK C;  3IP4 C;  1S32 A;  3REK D;  1P3G D;  3REI B;  1M1A B;  1P3L A;  4NE5 A;  5B0Y D;  3AZJ A;  4UPK A;  3W97 A;  3AZL C;  3MGQ A;  3UT9 A;  1P3P C;  4J8V D;  1KX3 A;  4ZUX A;  3REJ D;  4JJN C;  3MGS C;  5B33 B;  5AY8 D;  3KUY C;  5B2I D;  3X1U B;  3C1B D;  4WNN B;  5DNM B;  3AZM D;  3WAA B;  1F66 A;  5CPK B;  3KXB B;  3B6G A;  5C3I C;  4WV4 B;  3AV1 C;  5B0Y C;  1M1A D;  3REI D;  3WKJ B;  4YS3 C;  2VQR A;  3VH6 A;  4H9R A;  3X1S C;  3B0D B;  2Y2H A;  2G5H C;  3AZM C;  3LZ1 A;  3C1B C;  1P3M A;  1AOI B;  5B33 D;  3X1V A;  3X1U D;  5DNM D;  1ZLA B;  3WAA D;  4Z66 C;  5B31 A;  5CPK D;  1P3L B;  3KXB D;  3AZJ B;  4KGC C;  4NE6 A;  2W8S A;  3REI C;  1M1A C;  3AV2 B;  3VH6 T;  3WKJ D;  3UTB C;  5GXQ B;  1KX3 B;  4ZUX B;  5GT3 A;  1P3A B;  4QLC C;  3AZH B;  3AZG A;  2NZD B;  1M18 B;  2JE5 A;  3O62 A;  4J8U B;  4XZQ C;  5DNN A;  1M19 C;  5GSU C;  3WTP E;  1F66 B;  5DNM C;  3WAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...