3W96D

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96D00
1P3MD 3LJAB 1N1JA 5AVBD 1BH9A 1P3PA 5B33D 5JA4B 5AV5D 3AZEC 1U35A 3C1CC 3W99D 3MVDA 4H9RA 3AZHC 4XZQA 4XUJC 1P3IA 4HGAC 2BYKA 5GXQB 3WAAA 4JJND 3W98A 1P3AC 3B6FC 1ID3A 3WA9A 4YS3C 4J8XD 3AZGA 5AV8A 3MGSA 4J8UB 5CPKD 1KX3A 5G49B 3AZLB 1M19A 3A6ND 1TAFB 4CSRB 5CP6A 3X1VB 3KWQC 4Z5TA 3LZ0D 5AVCC 1S32D 2AROB 5DNNC 1P3FD 1KX4A 5AY8D 5AV9C 3KUYA 3LZ1C 4WU9C 4WU8A 5B31D 4WNNB 5B1MD 3AV2C 3AZJB 5KDMB 3REHD 2YFVB 3W96D 5B1LB 5CHLB 3WTPB 2LY8A 3MGPB 5B32G 5B0ZC 5CPJA 1N1JB 1BH9B 2HIOA 3REIA 3WTPE 3AFAD 3UTBA 3LELD 4YM6D 1U35B 3NQJA 1EQZD 4ZUXA 4H9RB 2BYMA 4XZQB 1P3IB 5DNMC 2BYKB 1P3LB 2NQBC 3WAAB 3KWQA 3W98B 3WA9B 5CPKC 1ID3B 5AVCA 3AZGB 5E5AB 3REKD 2IO5B 3MGRB 5AV8B 3MGSB 5BNXA 4WU9A 1P3PD 1KX3B 3RELD 5B2IC 1M19B 3MVDD 4G91C 3AV2A 3W97D 3LZ0C 5CP6B 1S32C 5AY8C 4Z5TB 1F66C 1KX4B 5B32B 5B40A 3B6GC 5B2JD 3KUYB 5B31C 5B1MC 4WU8B 2YFWA 5AV8D 5B0ZA 4J8WC 4CAYA 1M1AC 3B0CT 3REHC 2F8NH 3AZMA 5BT1D 4KUDD 2PYOD 4X23C 1AOID 5GSUA 1P3OC 5DNMA 1KX4D 2NQBA 2HIOB 2NZDC 4QLCA 3AFAC 4WU8D 4AWLB 1TZYD 2HUEB 3UTBB 1HTAA 2F8ND 3NQJB 3TU4C 5C3IC 4KGCC 4ZUXB 4DRBA 3AZNC 2AROA 2BYMB 4Z66A 4H9QA 5AV6D 3AZKC 3UT9D 4UUZA 1KU5A 3REKC 3B0DB 4NE3A 4J8VA 5FUGA 3KWQB 3X1UA 3KXBC 5AVCB 5F99D 5CPJD 5BNXB 3REID 4WU9B 5B0YC 4LD9D 4J8WA 4NE6A 1JFIA 2YFVA 2FJ7D 1KX5D 3REJA 4M6BA 5GT0D 1M1AA 3AV2B 2CV5D 5CPID 4Z2MH 1BFMA 4KHAA 4WZSB 4X23A 5B40B 5JRGD 3AYWD 1P3OA 1ZLAA 2YFWB 4WV4B 5B0ZB 4CAYB 5B24D 3UTAA 1P3GA 5B31G 3O62A 3C1BC 1P34A 1P3KC 1M18A 5GT3D 3X1TD 1P3LA 1P3BA 3AZMB 3X1SD 1AOIC 3TU4A 4KGCA 3MGRD 3AZIC 1HQ3A 5E5AA 3AV1A 3LJAD 5GSUB 5DNMB 3AZKA 3MGQA 2NQBB 4E45A 3VH6A 3KXBA 4QLCB 3MNNA 4H9SA 5B0YA 3WKJC 5GXQD 5B32A 3AN2A 4Z66B 3AZFA 4H9QB 4UUZB 5GSUD 3VH5A 4J8UD 4J8VB 5FUGB 3X1UB 1F66B 3AZLD 4QLCD 4E44A 2FJ7C 1KX5C 3AZEA 3C1CA 4J8WB 1JFIB 4R8PC 3AZHA 3VH5W 3REJB 2CV5C 4XUJA 3X1VD 4G92B 1M1AB 1P3MC 5AVBC 2AROD 3B0BA 5B33C 4KHAB 5JRGC 3AYWC 3KSYA 1P3AA 3B6FA 4YS3A 1B67A 5AV5C 4X23B 3X1UD 1P3OB 3W99C 2JSSA 1ZLAB 5B24C 3AZJD 3V9RA 2L5AA 3UTAB 3X1TC 1P3GB 1H3OA 3O62B 1P34B 3X1SC 2RVQD 4JJNC 1M18B 4J8XC 1R4VA 1P3BB 5B1LD 3LJAC 3TU4B 4KGCB 3WTPD 3MGPD 1HQ3B 4H9PA 4EO5C 5DNNA 3AZNB 3AV1B 5AV9A 3AZKB 3LZ1A 3MGQB 3A6NC 4ZBJC 3KXBB 1U35D 3MNNB 4XZQD 1P3ID 1P3FC 5B0YB 2F8NG 1P3LD 5BO0A 3WAAD 3AN2B 3AZFB 3W98D 3WA9D 1ID3D 1P3MA 5AVBA 5E5AD 3AZGD 3MGSD 3MGQD 3AZLC 1KX3D 4DRAA 3MNND 1M19D 3AZEB 3W96C 3X1VC 4NE5A 3C1CB 5CP6D 3AZHB 4XUJB 1ULYA 4HGAB 4Z5TD 4JJNA 3NQUA 5B32D 4J8XA 3KUYD 1P3AB 3B6FB 5CPKA 4YS3B 3LELC 4YM6C 1EQZC 3A6NA 3V9RB 5B2IA 3AZED 1H3OB 3C1CD 5B1LC 5BS7C 3LZ0A 3WTPC 3MGPC 1S32A 1P3FA 1B6WA 5AY8A 4Z2MG 1P3PC 1F66A 4H9PB 5DNNB 1P3AD 3B6GA 5AV9B 2HIOD 3RELC 3LZ1B 5B31A 5B1MA 1U35C 3MVDC 3UTBD 3W97C 4XZQC 1P3IC 4ZUXD 3REHA 3WAAC 3W96A 3W98C 1ID3C 5B2JC 5BO0B 3VH6T 3AZGC 2IO5C 3KWQD 5AV8C 1P3MB 5AVCD 5AVBB 3LZ1D 4WU9D 2NZDA 3AFAA 5AV5B 3LELA 4YM6A 1EQZA 5BT1C 4KUDC 2PYOC 3AV2D 3VH5T 4Z5TC 1KX4C 3AZNA 3R45A 4JJNB 3NQUB 5B40D 4J8XB 4WU8C 5BNVA 3REKA 1TZYC 5CPKB 4EO5B 1F1EA 5B0ZD 3RELA 3A6NB 4ZBJB 5AV6C 3W97A 5B2IB 3UT9C 3AZMD 4G91B 3VH6W 3LZ0B 1S32B 5F99C 1P3FB 5DNMD 5AY8B 5CPJC 5B2JA 2HIOC 2NQBD 4NFTA 3REIC 4AWLC 2HUEC 3B6GB 4LD9C 3UTBC 5B31B 5B1MB 5GT0C 4ZUXC 5CPIC 3C1BA 1P3KA 5B2ID 3REHB 4Z66D 4KUDA 3B0DC 2PYOA 1AOIA 3W96B 3AZIA 4J8VD 1F66D 3B6GD 1TZYA 5GT3C 2NZDB 3AFAB 3LELB 2F8NA 4YM6B 4J8WD 1EQZB 3REJD 3MGRC 1M1AD 4H9NB 3WKJA 5C3IB 5AV6A 3UT9A 5B40C 2CWEA 3R45B 4H9OA 4X23D 1A7WA 5F99A 5BNVB 3REKB 1P3OD 1ZLAD 1P3PB 4LD9A 2NZDD 3RELB 3UTAD 1P3GD 2FJ7A 5GXQC 3O62D 1BH8A 5GT0A 3AZMC 1P34D 1M18D 1KX5A 3MVDB 3W97B 4R8PA 1P3BD 2CV5A 5CPIA 5GSUC 3TU4D 4KGCD 4J8UC 1HQ3D 3AZND 3AV1D 5B33A 5JRGA 3AZKD 3AYWA 5B2JB 4QLCC 5AV5A 3KXBD 3W99A 5B24A 5GT3A 2AROC 3X1TA 5B0YD 4Z66C 3C1BB 1P3KB 3X1SA 3MGRA 3AN2D 3AZFD 2F8NK 4KUDB 1WWSA 2PYOB 1AOIB 3LJAA 4J8VC 3X1UC 3AZIB 3AZJC 5JA4A 1TZYB 2RVQC 3REJC 4G92C 2F8NB 3AZHD 4XUJD 3C1BD 5GXQA 1WWIA 1P3KD 3WKJB 5AV6B 1Q9CA 3UT9B 3B6FD 4J8UA 4YS3D 3AZID 1ZLAC 4H9OB 5F99B 5G49A 5CPJB 3AZLA 3UTAC 1P3GC 3REIB 3O62C 1P34C 1M18C 1TAFA 4CSRA 4LD9B 1P3LC 2FJ7B 1P3BC 1KX5B 1BH8B 5GT0B 3X1VA 3WA9C 4R8PB 1HQ3C 5E5AC 3AV1C 2CV5B 5CPIB 3WKJD 3MGSC 3MGQC 5DNND 1KX3C 5B33B 5AV9D 5JRGB 3AYWB 4WNNA 3MNNC 1M19C 3AZJA 3W99B 5CP6C 3B0CW 4H9SC 5KDMA 5B24B 4H9NA 5GT3B 5B32C 3AN2C 3X1TB 3AZFC 5B1LA 5BS7A 3X1SB 3KUYC 4R8PD 3WTPA 3MGPA
chains in the Genus database with same CATH superfamily
1P3MD 3LJAB 1N1JA 5AVBD 1BH9A 2Y2QA 5B33D 1P3PA 5JA4B 5AV5D 3AZEC 1U35A 3C1CC 3W99D 3MVDA 2XD5A 4H9RA 3AZHC 4XZQA 4XUJC 1P3IA 4HGAC 2BYKA 5GXQB 3WAAA 4JJND 3W98A 1P3AC 3B6FC 1ID3A 3WA9A 4YS3C 4J8XD 3AZGA 5AV8A 3MGSA 4J8UB 5CPKD 1KX3A 5G49B 3AZLB 2Y2IA 1M19A 3A6ND 1TAFB 4CSRB 5CP6A 3X1VB 3KWQC 4Z5TA 3LZ0D 5AVCC 1S32D 2AROB 5DNNC 1P3FD 1KX4A 5AY8D 5AV9C 3KUYA 3LZ1C 4WU9C 4WU8A 5B31D 4WNNB 5B1MD 2VQRA 1W2EA 3AV2C 3AZJB 5KDMB 3REHD 2YFVB 3A1IA 3W96D 5B1LB 5CHLB 3WTPB 2LY8A 3MGPB 3IP4C 5B32G 5B0ZC 5CPJA 1N1JB 1BH9B 2HIOA 3REIA 3WTPE 3AFAD 3UTBA 3LELD 4YM6D 1U35B 3NQJA 1EQZD 4ZUXA 4H9RB 2BYMA 4XZQB 2G5IC 2UWXA 1P3IB 5DNMC 2BYKB 1P3LB 2NQBC 3WAAB 3KWQA 3W98B 3WA9B 5CPKC 1ID3B 5AVCA 3AZGB 5E5AB 3REKD 2IO5B 3MGRB 2DQNC 5AV8B 3MGSB 5BNXA 4WU9A 1P3PD 1KX3B 2DF4C 3RELD 5B2IC 1M19B 3MVDD 4G91C 3AV2A 3W97D 3LZ0C 5CP6B 1S32C 5AY8C 4Z5TB 1F66C 1KX4B 5B32B 5B40A 3EPHA 3B6GC 5B2JD 3KUYB 5B31C 5B1MC 4WU8B 2YFWA 5AV8D 5B0ZA 4J8WC 4CAYA 1M1AC 3B0CT 3P5JB 3REHC 2F8NH 3AZMA 5BT1D 4KUDD 2XD1A 4X23C 1AOID 2PYOD 5GSUA 1P3OC 5DNMA 1KX4D 2NQBA 2HIOB 2NZDC 4QLCA 3AFAC 4WU8D 4AWLB 1TZYD 2HUEB 3UTBB 1HTAA 2F8ND 3NQJB 3TU4C 5C3IC 4KGCC 4ZUXB 4DRBA 3AZNC 2AROA 2BYMB 4Z66A 4H9QA 5AV6D 3AZKC 3UT9D 4UUZA 1KU5A 3REKC 3B0DB 4NE3A 4J8VA 5FUGA 3KWQB 3X1UA 3KXBC 5AVCB 5F99D 2Y2JA 5CPJD 5BNXB 3REID 4WU9B 2Y2GA 5B0YC 4LD9D 4J8WA 4NE6A 1JFIA 2YFVA 2FJ7D 1KX5D 3REJA 4M6BA 5GT0D 1M1AA 3AV2B 2CV5D 5CPID 4Z2MH 3EPKA 1BFMA 4KHAA 4WZSB 4X23A 5B40B 5JRGD 3AYWD 1P3OA 1ZLAA 2Y2OA 2YFWB 4WV4B 5B0ZB 4CAYB 5B24D 3UTAA 1P3GA 5B31G 3O62A 3C1BC 1P34A 1P3KC 1M18A 5GT3D 3X1TD 1P3LA 1P3BA 3AZMB 3X1SD 1AOIC 3TU4A 4KGCA 3MGRD 3AZIC 1HQ3A 5E5AA 3AV1A 3LJAD 5GSUB 5DNMB 3AZKA 1Z2CB 3MGQA 2NQBB 3H0RC 4E45A 3VH6A 3KXBA 4QLCB 3MNNA 4H9SA 5B0YA 4UPKA 3WKJC 2J8PA 5GXQD 5B32A 3AN2A 4Z66B 3AZFA 4H9QB 4UUZB 5GSUD 3VH5A 4J8UD 4J8VB 5FUGB 3X1UB 1F66B 3AZLD 4QLCD 4E44A 2FJ7C 1KX5C 3AZEA 3C1CA 4J8WB 1JFIB 4R8PC 3AZHA 3VH5W 3REJB 2CV5C 4XUJA 3X1VD 4G92B 1M1AB 1P3MC 5AVBC 2AROD 2JCHA 3B0BA 5B33C 4KHAB 5JRGC 3AYWC 3KSYA 1P3AA 3B6FA 4YS3A 1B67A 5AV5C 4X23B 3X1UD 1P3OB 3W99C 2JSSA 1ZLAB 5B24C 3AZJD 3V9RA 2L5AA 3UTAB 3EPJA 3X1TC 1P3GB 1H3OA 3O62B 1P34B 3X1SC 2RVQD 4JJNC 1M18B 4J8XC 1R4VA 1P3BB 5B1LD 3LJAC 3TU4B 4WJ3C 4KGCB 3WTPD 3MGPD 1HQ3B 4H9PA 4EO5C 5DNNA 3AZNB 3AV1B 5AV9A 3AZKB 3LZ1A 3MGQB 3A6NC 4ZBJC 3KXBB 1U35D 3MNNB 4XZQD 1P3ID 1P3FC 5B0YB 2F8NG 1P3LD 5BO0A 3A1KA 3WAAD 3AN2B 3AZFB 3W98D 3WA9D 1ID3D 1P3MA 5AVBA 5E5AD 3AZGD 3MGSD 3H0LC 3MGQD 3AZLC 1KX3D 4DRAA 3MNND 1M19D 3AZEB 3W96C 2RIQA 3X1VC 4NE5A 3C1CB 5CP6D 3AZHB 4XUJB 1ULYA 4HGAB 4Z5TD 4JJNA 2Y2MA 3NQUA 5B32D 4J8XA 3KUYD 1P3AB 3B6FB 5CPKA 3AL0C 4YS3B 3LELC 4YM6C 1EQZC 2BG1A 3A6NA 3V9RB 5B2IA 3AZED 1H3OB 2ZY3A 3C1CD 5B1LC 5BS7C 3LZ0A 3WTPC 3MGPC 3EPLA 1S32A 1P3FA 1B6WA 5AY8A 4Z2MG 1P3PC 1F66A 4H9PB 5DNNB 1P3AD 3B6GA 5AV9B 2HIOD 3RELC 3LZ1B 2ZY5A 5B31A 5B1MA 1U35C 3MVDC 3UTBD 3W97C 4XZQC 1P3IC 4ZUXD 3REHA 2JE5A 3WAAC 3W96A 3W98C 1ID3C 5B2JC 5BO0B 3VH6T 3AZGC 2IO5C 2Y2HA 3KWQD 5AV8C 1P3MB 5AVCD 5AVBB 2ZY4A 3LZ1D 4WU9D 2NZDA 3AFAA 3KFUG 5AV5B 3LELA 4YM6A 1EQZA 5BT1C 4KUDC 2PYOC 3AV2D 3VH5T 4Z5TC 1KX4C 3AZNA 3R45A 4JJNB 3NQUB 5B40D 4J8XB 4WU8C 5BNVA 3REKA 1TZYC 5CPKB 4EO5B 1F1EA 5B0ZD 3RELA 3A6NB 4ZBJB 5AV6C 3W97A 5B2IB 3UT9C 3AZMD 4G91B 3VH6W 3LZ0B 3H0MC 1S32B 5F99C 1P3FB 5DNMD 5AY8B 5CPJC 5B2JA 2HIOC 2NQBD 4NFTA 3REIC 4DQYB 4AWLC 2HUEC 3B6GB 4LD9C 3UTBC 5B31B 5B1MB 5GT0C 4ZUXC 2Y2PA 5CPIC 3C1BA 2ZY2A 1P3KA 5B2ID 3REHB 4Z66D 4KUDA 3B0DC 2PYOA 1AOIA 3W96B 3AZIA 4J8VD 1F66D 3B6GD 1TZYA 5GT3C 2NZDB 3AFAB 3LELB 2F8NA 4YM6B 4J8WD 1EQZB 3REJD 3MGRC 1M1AD 2Y2KA 4H9NB 3WKJA 5C3IB 5AV6A 3UT9A 5B40C 2CWEA 3R45B 4H9OA 4X23D 1A7WA 5F99A 5BNVB 3REKB 1P3OD 1ZLAD 1T3UA 1P3PB 4LD9A 2NZDD 3RELB 3UTAD 1P3GD 2FJ7A 5GXQC 3O62D 1BH8A 5GT0A 3AZMC 1P34D 1M18D 1KX5A 3MVDB 3W97B 4R8PA 1P3BD 2CV5A 5CPIA 5GSUC 3TU4D 4KGCD 4J8UC 1HQ3D 3AZND 3AV1D 5B33A 5JRGA 3AZKD 3AYWA 5B2JB 4QLCC 5AV5A 3KXBD 3W99A 5B24A 2FFFB 2AROC 5GT3A 5B0YD 3F6TA 4Z66C 3C1BB 3X1TA 1P3KB 3X1SA 3MGRA 3AN2D 3AZFD 2F8NK 4KUDB 2F2AC 1WWSA 2PYOB 1AOIB 3LJAA 4J8VC 3X1UC 3AZIB 3AZJC 2ZM5A 5JA4A 1TZYB 2RVQC 2G5HC 3REJC 4G92C 2F8NB 3AZHD 4XUJD 3C1BD 5GXQA 1WWIA 1P3KD 3WKJB 5AV6B 1Q9CA 3UT9B 3B6FD 4J8UA 4YS3D 3AZID 1ZLAC 4H9OB 3EG5B 5F99B 5G49A 3FDDA 5CPJB 3AZLA 3UTAC 1P3GC 3REIB 3O62C 1P34C 1M18C 1TAFA 4CSRA 4LD9B 1P3LC 2FJ7B 1P3BC 1KX5B 1BH8B 5GT0B 3X1VA 3WA9C 2Y2NA 1HQ3C 5E5AC 4R8PB 3AV1C 2CV5B 5CPIB 3WKJD 2W8SA 1PZRA 3MGSC 3MGQC 5DNND 1KX3C 5B33B 5AV9D 5JRGB 3AYWB 4WNNA 3MNNC 1M19C 3AZJA 3W99B 5CP6C 3B0CW 4H9SC 5KDMA 5B24B 4H9NA 2Y2LA 5GT3B 5B32C 3AN2C 3AZFC 3X1TB 5B1LA 5BS7A 3X1SB 3KUYC 4R8PD 3WTPA 3MGPA
chains in the Genus database with same CATH topology
1P3MD 3LJAB 1N1JA 5AVBD 1BH9A 2Y2QA 5B33D 1P3PA 5JA4B 5AV5D 3AZEC 1U35A 3C1CC 3W99D 3MVDA 2XD5A 4H9RA 3AZHC 4XZQA 4XUJC 1P3IA 4HGAC 2BYKA 5GXQB 3WAAA 4JJND 3W98A 1P3AC 3B6FC 1ID3A 3WA9A 4YS3C 4J8XD 3AZGA 5AV8A 3MGSA 4J8UB 5CPKD 1KX3A 5G49B 3AZLB 2Y2IA 1M19A 3A6ND 1TAFB 4CSRB 5CP6A 3X1VB 3KWQC 4Z5TA 3LZ0D 5AVCC 1S32D 2AROB 5DNNC 1P3FD 1KX4A 5AY8D 5AV9C 3KUYA 3LZ1C 4WU9C 4WU8A 5B31D 4WNNB 5B1MD 2VQRA 1W2EA 3AV2C 3AZJB 5KDMB 3REHD 2YFVB 3A1IA 3W96D 5B1LB 5CHLB 3WTPB 2LY8A 3MGPB 3IP4C 5B32G 5B0ZC 5CPJA 1N1JB 1BH9B 2HIOA 3REIA 3WTPE 3AFAD 3UTBA 3LELD 4YM6D 1U35B 3NQJA 1EQZD 4ZUXA 4H9RB 2BYMA 4XZQB 2G5IC 2UWXA 1P3IB 5DNMC 2BYKB 1P3LB 2NQBC 3WAAB 3KWQA 3W98B 3WA9B 5CPKC 1ID3B 5AVCA 3AZGB 5E5AB 3REKD 2IO5B 3MGRB 2DQNC 5AV8B 3MGSB 5BNXA 4WU9A 1P3PD 1KX3B 2DF4C 3RELD 5B2IC 1M19B 3MVDD 4G91C 3AV2A 3W97D 3LZ0C 5CP6B 1S32C 5AY8C 4Z5TB 1F66C 1KX4B 5B32B 5B40A 3EPHA 3B6GC 5B2JD 3KUYB 5B31C 5B1MC 4WU8B 2YFWA 5AV8D 5B0ZA 4J8WC 4CAYA 1M1AC 3B0CT 3P5JB 3REHC 2F8NH 3AZMA 5BT1D 4KUDD 2XD1A 4X23C 1AOID 2PYOD 5GSUA 1P3OC 5DNMA 1KX4D 2NQBA 2HIOB 2NZDC 4QLCA 3AFAC 4WU8D 4AWLB 1TZYD 2HUEB 3UTBB 1HTAA 2F8ND 3NQJB 3TU4C 5C3IC 4KGCC 4ZUXB 4DRBA 3AZNC 2AROA 2BYMB 4Z66A 4H9QA 5AV6D 3AZKC 3UT9D 4UUZA 1KU5A 3REKC 3B0DB 4NE3A 4J8VA 5FUGA 3KWQB 3X1UA 3KXBC 5AVCB 5F99D 2Y2JA 5CPJD 5BNXB 3REID 4WU9B 2Y2GA 5B0YC 4LD9D 4J8WA 4NE6A 1JFIA 2YFVA 2FJ7D 1KX5D 3REJA 4M6BA 5GT0D 1M1AA 3AV2B 2CV5D 5CPID 4Z2MH 3EPKA 1BFMA 4KHAA 4WZSB 4X23A 5B40B 5JRGD 3AYWD 1P3OA 1ZLAA 2Y2OA 2YFWB 4WV4B 5B0ZB 4CAYB 5B24D 3UTAA 1P3GA 5B31G 3O62A 3C1BC 1P34A 1P3KC 1M18A 5GT3D 3X1TD 1P3LA 1P3BA 3AZMB 3X1SD 1AOIC 3TU4A 4KGCA 3MGRD 3AZIC 1HQ3A 5E5AA 3AV1A 3LJAD 5GSUB 5DNMB 3AZKA 1Z2CB 3MGQA 2NQBB 3H0RC 4E45A 3VH6A 3KXBA 4QLCB 3MNNA 4H9SA 5B0YA 4UPKA 3WKJC 2J8PA 5GXQD 5B32A 3AN2A 4Z66B 3AZFA 4H9QB 4UUZB 5GSUD 3VH5A 4J8UD 4J8VB 5FUGB 3X1UB 1F66B 3AZLD 4QLCD 4E44A 2FJ7C 1KX5C 3AZEA 3C1CA 4J8WB 1JFIB 4R8PC 3AZHA 3VH5W 3REJB 2CV5C 4XUJA 3X1VD 4G92B 1M1AB 1P3MC 5AVBC 2AROD 2JCHA 3B0BA 5B33C 4KHAB 5JRGC 3AYWC 3KSYA 1P3AA 3B6FA 4YS3A 1B67A 5AV5C 4X23B 3X1UD 1P3OB 3W99C 2JSSA 1ZLAB 5B24C 3AZJD 3V9RA 2L5AA 3UTAB 3EPJA 3X1TC 1P3GB 1H3OA 3O62B 1P34B 3X1SC 2RVQD 4JJNC 1M18B 4J8XC 1R4VA 1P3BB 5B1LD 3LJAC 3TU4B 4WJ3C 4KGCB 3WTPD 3MGPD 1HQ3B 4H9PA 4EO5C 5DNNA 3AZNB 3AV1B 5AV9A 3AZKB 3LZ1A 3MGQB 3A6NC 4ZBJC 3KXBB 1U35D 3MNNB 4XZQD 1P3ID 1P3FC 5B0YB 2F8NG 1P3LD 5BO0A 3A1KA 3WAAD 3AN2B 3AZFB 3W98D 3WA9D 1ID3D 1P3MA 5AVBA 5E5AD 3AZGD 3MGSD 3H0LC 3MGQD 3AZLC 1KX3D 4DRAA 3MNND 1M19D 3AZEB 3W96C 2RIQA 3X1VC 4NE5A 3C1CB 5CP6D 3AZHB 4XUJB 1ULYA 4HGAB 4Z5TD 4JJNA 2Y2MA 3NQUA 5B32D 4J8XA 3KUYD 1P3AB 3B6FB 5CPKA 3AL0C 4YS3B 3LELC 4YM6C 1EQZC 2BG1A 3A6NA 3V9RB 5B2IA 3AZED 1H3OB 2ZY3A 3C1CD 5B1LC 5BS7C 3LZ0A 3WTPC 3MGPC 3EPLA 1S32A 1P3FA 1B6WA 5AY8A 4Z2MG 1P3PC 1F66A 4H9PB 5DNNB 1P3AD 3B6GA 5AV9B 2HIOD 3RELC 3LZ1B 2ZY5A 5B31A 5B1MA 1U35C 3MVDC 3UTBD 3W97C 4XZQC 1P3IC 4ZUXD 3REHA 2JE5A 3WAAC 3W96A 3W98C 1ID3C 5B2JC 5BO0B 3VH6T 3AZGC 2IO5C 2Y2HA 3KWQD 5AV8C 1P3MB 5AVCD 5AVBB 2ZY4A 3LZ1D 4WU9D 2NZDA 3AFAA 3KFUG 5AV5B 3LELA 4YM6A 1EQZA 5BT1C 4KUDC 2PYOC 3AV2D 3VH5T 4Z5TC 1KX4C 3AZNA 3R45A 4JJNB 3NQUB 5B40D 4J8XB 4WU8C 5BNVA 3REKA 1TZYC 5CPKB 4EO5B 1F1EA 5B0ZD 3RELA 3A6NB 4ZBJB 5AV6C 3W97A 5B2IB 3UT9C 3AZMD 4G91B 3VH6W 3LZ0B 3H0MC 1S32B 5F99C 1P3FB 5DNMD 5AY8B 5CPJC 5B2JA 2HIOC 2NQBD 4NFTA 3REIC 4DQYB 4AWLC 2HUEC 3B6GB 4LD9C 3UTBC 5B31B 5B1MB 5GT0C 4ZUXC 2Y2PA 5CPIC 3C1BA 2ZY2A 1P3KA 5B2ID 3REHB 4Z66D 4KUDA 3B0DC 2PYOA 1AOIA 3W96B 3AZIA 4J8VD 1F66D 3B6GD 1TZYA 5GT3C 2NZDB 3AFAB 3LELB 2F8NA 4YM6B 4J8WD 1EQZB 3REJD 3MGRC 1M1AD 2Y2KA 4H9NB 3WKJA 5C3IB 5AV6A 3UT9A 5B40C 2CWEA 3R45B 4H9OA 4X23D 1A7WA 5F99A 5BNVB 3REKB 1P3OD 1ZLAD 1T3UA 1P3PB 4LD9A 2NZDD 3RELB 3UTAD 1P3GD 2FJ7A 5GXQC 3O62D 1BH8A 5GT0A 3AZMC 1P34D 1M18D 1KX5A 3MVDB 3W97B 4R8PA 1P3BD 2CV5A 5CPIA 5GSUC 3TU4D 4KGCD 4J8UC 1HQ3D 3AZND 3AV1D 5B33A 5JRGA 3AZKD 3AYWA 5B2JB 4QLCC 5AV5A 3KXBD 3W99A 5B24A 2FFFB 2AROC 5GT3A 5B0YD 3F6TA 4Z66C 3C1BB 3X1TA 1P3KB 3X1SA 3MGRA 3AN2D 3AZFD 2F8NK 4KUDB 2F2AC 1WWSA 2PYOB 1AOIB 3LJAA 4J8VC 3X1UC 3AZIB 3AZJC 2ZM5A 5JA4A 1TZYB 2RVQC 2G5HC 3REJC 4G92C 2F8NB 3AZHD 4XUJD 3C1BD 5GXQA 1WWIA 1P3KD 3WKJB 5AV6B 1Q9CA 3UT9B 3B6FD 4J8UA 4YS3D 3AZID 1ZLAC 4H9OB 3EG5B 5F99B 5G49A 3FDDA 5CPJB 3AZLA 3UTAC 1P3GC 3REIB 3O62C 1P34C 1M18C 1TAFA 4CSRA 4LD9B 1P3LC 2FJ7B 1P3BC 1KX5B 1BH8B 5GT0B 3X1VA 3WA9C 2Y2NA 1HQ3C 5E5AC 4R8PB 3AV1C 2CV5B 5CPIB 3WKJD 2W8SA 1PZRA 3MGSC 3MGQC 5DNND 1KX3C 5B33B 5AV9D 5JRGB 3AYWB 4WNNA 3MNNC 1M19C 3AZJA 3W99B 5CP6C 3B0CW 4H9SC 5KDMA 5B24B 4H9NA 2Y2LA 5GT3B 5B32C 3AN2C 3AZFC 3X1TB 5B1LA 5BS7A 3X1SB 3KUYC 4R8PD 3WTPA 3MGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M D;  3LJA B;  1N1J A;  5AVB D;  1BH9 A;  1P3P A;  5B33 D;  5JA4 B;  5AV5 D;  3AZE C;  1U35 A;  3C1C C;  3W99 D;  3MVD A;  4H9R A;  3AZH C;  4XZQ A;  4XUJ C;  1P3I A;  4HGA C;  2BYK A;  5GXQ B;  3WAA A;  4JJN D;  3W98 A;  1P3A C;  3B6F C;  1ID3 A;  3WA9 A;  4YS3 C;  4J8X D;  3AZG A;  5AV8 A;  3MGS A;  4J8U B;  5CPK D;  1KX3 A;  5G49 B;  3AZL B;  1M19 A;  3A6N D;  1TAF B;  4CSR B;  5CP6 A;  3X1V B;  3KWQ C;  4Z5T A;  3LZ0 D;  5AVC C;  1S32 D;  2ARO B;  5DNN C;  1P3F D;  1KX4 A;  5AY8 D;  5AV9 C;  3KUY A;  3LZ1 C;  4WU9 C;  4WU8 A;  5B31 D;  4WNN B;  5B1M D;  3AV2 C;  3AZJ B;  5KDM B;  3REH D;  2YFV B;  3W96 D;  5B1L B;  5CHL B;  3WTP B;  2LY8 A;  3MGP B;  5B32 G;  5B0Z C;  5CPJ A;  1N1J B;  1BH9 B;  2HIO A;  3REI A;  3WTP E;  3AFA D;  3UTB A;  3LEL D;  4YM6 D;  1U35 B;  3NQJ A;  1EQZ D;  4ZUX A;  4H9R B;  2BYM A;  4XZQ B;  1P3I B;  5DNM C;  2BYK B;  1P3L B;  2NQB C;  3WAA B;  3KWQ A;  3W98 B;  3WA9 B;  5CPK C;  1ID3 B;  5AVC A;  3AZG B;  5E5A B;  3REK D;  2IO5 B;  3MGR B;  5AV8 B;  3MGS B;  5BNX A;  4WU9 A;  1P3P D;  1KX3 B;  3REL D;  5B2I C;  1M19 B;  3MVD D;  4G91 C;  3AV2 A;  3W97 D;  3LZ0 C;  5CP6 B;  1S32 C;  5AY8 C;  4Z5T B;  1F66 C;  1KX4 B;  5B32 B;  5B40 A;  3B6G C;  5B2J D;  3KUY B;  5B31 C;  5B1M C;  4WU8 B;  2YFW A;  5AV8 D;  5B0Z A;  4J8W C;  4CAY A;  1M1A C;  3B0C T;  3REH C;  2F8N H;  3AZM A;  5BT1 D;  4KUD D;  2PYO D;  4X23 C;  1AOI D;  5GSU A;  1P3O C;  5DNM A;  1KX4 D;  2NQB A;  2HIO B;  2NZD C;  4QLC A;  3AFA C;  4WU8 D;  4AWL B;  1TZY D;  2HUE B;  3UTB B;  1HTA A;  2F8N D;  3NQJ B;  3TU4 C;  5C3I C;  4KGC C;  4ZUX B;  4DRB A;  3AZN C;  2ARO A;  2BYM B;  4Z66 A;  4H9Q A;  5AV6 D;  3AZK C;  3UT9 D;  4UUZ A;  1KU5 A;  3REK C;  3B0D B;  4NE3 A;  4J8V A;  5FUG A;  3KWQ B;  3X1U A;  3KXB C;  5AVC B;  5F99 D;  5CPJ D;  5BNX B;  3REI D;  4WU9 B;  5B0Y C;  4LD9 D;  4J8W A;  4NE6 A;  1JFI A;  2YFV A;  2FJ7 D;  1KX5 D;  3REJ A;  4M6B A;  5GT0 D;  1M1A A;  3AV2 B;  2CV5 D;  5CPI D;  4Z2M H;  1BFM A;  4KHA A;  4WZS B;  4X23 A;  5B40 B;  5JRG D;  3AYW D;  1P3O A;  1ZLA A;  2YFW B;  4WV4 B;  5B0Z B;  4CAY B;  5B24 D;  3UTA A;  1P3G A;  5B31 G;  3O62 A;  3C1B C;  1P34 A;  1P3K C;  1M18 A;  5GT3 D;  3X1T D;  1P3L A;  1P3B A;  3AZM B;  3X1S D;  1AOI C;  3TU4 A;  4KGC A;  3MGR D;  3AZI C;  1HQ3 A;  5E5A A;  3AV1 A;  3LJA D;  5GSU B;  5DNM B;  3AZK A;  3MGQ A;  2NQB B;  4E45 A;  3VH6 A;  3KXB A;  4QLC B;  3MNN A;  4H9S A;  5B0Y A;  3WKJ C;  5GXQ D;  5B32 A;  3AN2 A;  4Z66 B;  3AZF A;  4H9Q B;  4UUZ B;  5GSU D;  3VH5 A;  4J8U D;  4J8V B;  5FUG B;  3X1U B;  1F66 B;  3AZL D;  4QLC D;  4E44 A;  2FJ7 C;  1KX5 C;  3AZE A;  3C1C A;  4J8W B;  1JFI B;  4R8P C;  3AZH A;  3VH5 W;  3REJ B;  2CV5 C;  4XUJ A;  3X1V D;  4G92 B;  1M1A B;  1P3M C;  5AVB C;  2ARO D;  3B0B A;  5B33 C;  4KHA B;  5JRG C;  3AYW C;  3KSY A;  1P3A A;  3B6F A;  4YS3 A;  1B67 A;  5AV5 C;  4X23 B;  3X1U D;  1P3O B;  3W99 C;  2JSS A;  1ZLA B;  5B24 C;  3AZJ D;  3V9R A;  2L5A A;  3UTA B;  3X1T C;  1P3G B;  1H3O A;  3O62 B;  1P34 B;  3X1S C;  2RVQ D;  4JJN C;  1M18 B;  4J8X C;  1R4V A;  1P3B B;  5B1L D;  3LJA C;  3TU4 B;  4KGC B;  3WTP D;  3MGP D;  1HQ3 B;  4H9P A;  4EO5 C;  5DNN A;  3AZN B;  3AV1 B;  5AV9 A;  3AZK B;  3LZ1 A;  3MGQ B;  3A6N C;  4ZBJ C;  3KXB B;  1U35 D;  3MNN B;  4XZQ D;  1P3I D;  1P3F C;  5B0Y B;  2F8N G;  1P3L D;  5BO0 A;  3WAA D;  3AN2 B;  3AZF B;  3W98 D;  3WA9 D;  1ID3 D;  1P3M A;  5AVB A;  5E5A D;  3AZG D;  3MGS D;  3MGQ D;  3AZL C;  1KX3 D;  4DRA A;  3MNN D;  1M19 D;  3AZE B;  3W96 C;  3X1V C;  4NE5 A;  3C1C B;  5CP6 D;  3AZH B;  4XUJ B;  1ULY A;  4HGA B;  4Z5T D;  4JJN A;  3NQU A;  5B32 D;  4J8X A;  3KUY D;  1P3A B;  3B6F B;  5CPK A;  4YS3 B;  3LEL C;  4YM6 C;  1EQZ C;  3A6N A;  3V9R B;  5B2I A;  3AZE D;  1H3O B;  3C1C D;  5B1L C;  5BS7 C;  3LZ0 A;  3WTP C;  3MGP C;  1S32 A;  1P3F A;  1B6W A;  5AY8 A;  4Z2M G;  1P3P C;  1F66 A;  4H9P B;  5DNN B;  1P3A D;  3B6G A;  5AV9 B;  2HIO D;  3REL C;  3LZ1 B;  5B31 A;  5B1M A;  1U35 C;  3MVD C;  3UTB D;  3W97 C;  4XZQ C;  1P3I C;  4ZUX D;  3REH A;  3WAA C;  3W96 A;  3W98 C;  1ID3 C;  5B2J C;  5BO0 B;  3VH6 T;  3AZG C;  2IO5 C;  3KWQ D;  5AV8 C;  1P3M B;  5AVC D;  5AVB B;  3LZ1 D;  4WU9 D;  2NZD A;  3AFA A;  5AV5 B;  3LEL A;  4YM6 A;  1EQZ A;  5BT1 C;  4KUD C;  2PYO C;  3AV2 D;  3VH5 T;  4Z5T C;  1KX4 C;  3AZN A;  3R45 A;  4JJN B;  3NQU B;  5B40 D;  4J8X B;  4WU8 C;  5BNV A;  3REK A;  1TZY C;  5CPK B;  4EO5 B;  1F1E A;  5B0Z D;  3REL A;  3A6N B;  4ZBJ B;  5AV6 C;  3W97 A;  5B2I B;  3UT9 C;  3AZM D;  4G91 B;  3VH6 W;  3LZ0 B;  1S32 B;  5F99 C;  1P3F B;  5DNM D;  5AY8 B;  5CPJ C;  5B2J A;  2HIO C;  2NQB D;  4NFT A;  3REI C;  4AWL C;  2HUE C;  3B6G B;  4LD9 C;  3UTB C;  5B31 B;  5B1M B;  5GT0 C;  4ZUX C;  5CPI C;  3C1B A;  1P3K A;  5B2I D;  3REH B;  4Z66 D;  4KUD A;  3B0D C;  2PYO A;  1AOI A;  3W96 B;  3AZI A;  4J8V D;  1F66 D;  3B6G D;  1TZY A;  5GT3 C;  2NZD B;  3AFA B;  3LEL B;  2F8N A;  4YM6 B;  4J8W D;  1EQZ B;  3REJ D;  3MGR C;  1M1A D;  4H9N B;  3WKJ A;  5C3I B;  5AV6 A;  3UT9 A;  5B40 C;  2CWE A;  3R45 B;  4H9O A;  4X23 D;  1A7W A;  5F99 A;  5BNV B;  3REK B;  1P3O D;  1ZLA D;  1P3P B;  4LD9 A;  2NZD D;  3REL B;  3UTA D;  1P3G D;  2FJ7 A;  5GXQ C;  3O62 D;  1BH8 A;  5GT0 A;  3AZM C;  1P34 D;  1M18 D;  1KX5 A;  3MVD B;  3W97 B;  4R8P A;  1P3B D;  2CV5 A;  5CPI A;  5GSU C;  3TU4 D;  4KGC D;  4J8U C;  1HQ3 D;  3AZN D;  3AV1 D;  5B33 A;  5JRG A;  3AZK D;  3AYW A;  5B2J B;  4QLC C;  5AV5 A;  3KXB D;  3W99 A;  5B24 A;  5GT3 A;  2ARO C;  3X1T A;  5B0Y D;  4Z66 C;  3C1B B;  1P3K B;  3X1S A;  3MGR A;  3AN2 D;  3AZF D;  2F8N K;  4KUD B;  1WWS A;  2PYO B;  1AOI B;  3LJA A;  4J8V C;  3X1U C;  3AZI B;  3AZJ C;  5JA4 A;  1TZY B;  2RVQ C;  3REJ C;  4G92 C;  2F8N B;  3AZH D;  4XUJ D;  3C1B D;  5GXQ A;  1WWI A;  1P3K D;  3WKJ B;  5AV6 B;  1Q9C A;  3UT9 B;  3B6F D;  4J8U A;  4YS3 D;  3AZI D;  1ZLA C;  4H9O B;  5F99 B;  5G49 A;  5CPJ B;  3AZL A;  3UTA C;  1P3G C;  3REI B;  3O62 C;  1P34 C;  1M18 C;  1TAF A;  4CSR A;  4LD9 B;  1P3L C;  2FJ7 B;  1P3B C;  1KX5 B;  1BH8 B;  5GT0 B;  3X1V A;  3WA9 C;  4R8P B;  1HQ3 C;  5E5A C;  3AV1 C;  2CV5 B;  5CPI B;  3WKJ D;  3MGS C;  3MGQ C;  5DNN D;  1KX3 C;  5B33 B;  5AV9 D;  5JRG B;  3AYW B;  4WNN A;  3MNN C;  1M19 C;  3AZJ A;  3W99 B;  5CP6 C;  3B0C W;  4H9S C;  5KDM A;  5B24 B;  4H9N A;  5GT3 B;  5B32 C;  3AN2 C;  3X1T B;  3AZF C;  5B1L A;  5BS7 A;  3X1S B;  3KUY C;  4R8P D;  3WTP A;  3MGP A; 
#chains in the Genus database with same CATH topology
 1P3M D;  3LJA B;  1N1J A;  5AVB D;  1BH9 A;  2Y2Q A;  5B33 D;  1P3P A;  5JA4 B;  5AV5 D;  3AZE C;  1U35 A;  3C1C C;  3W99 D;  3MVD A;  2XD5 A;  4H9R A;  3AZH C;  4XZQ A;  4XUJ C;  1P3I A;  4HGA C;  2BYK A;  5GXQ B;  3WAA A;  4JJN D;  3W98 A;  1P3A C;  3B6F C;  1ID3 A;  3WA9 A;  4YS3 C;  4J8X D;  3AZG A;  5AV8 A;  3MGS A;  4J8U B;  5CPK D;  1KX3 A;  5G49 B;  3AZL B;  2Y2I A;  1M19 A;  3A6N D;  1TAF B;  4CSR B;  5CP6 A;  3X1V B;  3KWQ C;  4Z5T A;  3LZ0 D;  5AVC C;  1S32 D;  2ARO B;  5DNN C;  1P3F D;  1KX4 A;  5AY8 D;  5AV9 C;  3KUY A;  3LZ1 C;  4WU9 C;  4WU8 A;  5B31 D;  4WNN B;  5B1M D;  2VQR A;  1W2E A;  3AV2 C;  3AZJ B;  5KDM B;  3REH D;  2YFV B;  3A1I A;  3W96 D;  5B1L B;  5CHL B;  3WTP B;  2LY8 A;  3MGP B;  3IP4 C;  5B32 G;  5B0Z C;  5CPJ A;  1N1J B;  1BH9 B;  2HIO A;  3REI A;  3WTP E;  3AFA D;  3UTB A;  3LEL D;  4YM6 D;  1U35 B;  3NQJ A;  1EQZ D;  4ZUX A;  4H9R B;  2BYM A;  4XZQ B;  2G5I C;  2UWX A;  1P3I B;  5DNM C;  2BYK B;  1P3L B;  2NQB C;  3WAA B;  3KWQ A;  3W98 B;  3WA9 B;  5CPK C;  1ID3 B;  5AVC A;  3AZG B;  5E5A B;  3REK D;  2IO5 B;  3MGR B;  2DQN C;  5AV8 B;  3MGS B;  5BNX A;  4WU9 A;  1P3P D;  1KX3 B;  2DF4 C;  3REL D;  5B2I C;  1M19 B;  3MVD D;  4G91 C;  3AV2 A;  3W97 D;  3LZ0 C;  5CP6 B;  1S32 C;  5AY8 C;  4Z5T B;  1F66 C;  1KX4 B;  5B32 B;  5B40 A;  3EPH A;  3B6G C;  5B2J D;  3KUY B;  5B31 C;  5B1M C;  4WU8 B;  2YFW A;  5AV8 D;  5B0Z A;  4J8W C;  4CAY A;  1M1A C;  3B0C T;  3P5J B;  3REH C;  2F8N H;  3AZM A;  5BT1 D;  4KUD D;  2XD1 A;  4X23 C;  1AOI D;  2PYO D;  5GSU A;  1P3O C;  5DNM A;  1KX4 D;  2NQB A;  2HIO B;  2NZD C;  4QLC A;  3AFA C;  4WU8 D;  4AWL B;  1TZY D;  2HUE B;  3UTB B;  1HTA A;  2F8N D;  3NQJ B;  3TU4 C;  5C3I C;  4KGC C;  4ZUX B;  4DRB A;  3AZN C;  2ARO A;  2BYM B;  4Z66 A;  4H9Q A;  5AV6 D;  3AZK C;  3UT9 D;  4UUZ A;  1KU5 A;  3REK C;  3B0D B;  4NE3 A;  4J8V A;  5FUG A;  3KWQ B;  3X1U A;  3KXB C;  5AVC B;  5F99 D;  2Y2J A;  5CPJ D;  5BNX B;  3REI D;  4WU9 B;  2Y2G A;  5B0Y C;  4LD9 D;  4J8W A;  4NE6 A;  1JFI A;  2YFV A;  2FJ7 D;  1KX5 D;  3REJ A;  4M6B A;  5GT0 D;  1M1A A;  3AV2 B;  2CV5 D;  5CPI D;  4Z2M H;  3EPK A;  1BFM A;  4KHA A;  4WZS B;  4X23 A;  5B40 B;  5JRG D;  3AYW D;  1P3O A;  1ZLA A;  2Y2O A;  2YFW B;  4WV4 B;  5B0Z B;  4CAY B;  5B24 D;  3UTA A;  1P3G A;  5B31 G;  3O62 A;  3C1B C;  1P34 A;  1P3K C;  1M18 A;  5GT3 D;  3X1T D;  1P3L A;  1P3B A;  3AZM B;  3X1S D;  1AOI C;  3TU4 A;  4KGC A;  3MGR D;  3AZI C;  1HQ3 A;  5E5A A;  3AV1 A;  3LJA D;  5GSU B;  5DNM B;  3AZK A;  1Z2C B;  3MGQ A;  2NQB B;  3H0R C;  4E45 A;  3VH6 A;  3KXB A;  4QLC B;  3MNN A;  4H9S A;  5B0Y A;  4UPK A;  3WKJ C;  2J8P A;  5GXQ D;  5B32 A;  3AN2 A;  4Z66 B;  3AZF A;  4H9Q B;  4UUZ B;  5GSU D;  3VH5 A;  4J8U D;  4J8V B;  5FUG B;  3X1U B;  1F66 B;  3AZL D;  4QLC D;  4E44 A;  2FJ7 C;  1KX5 C;  3AZE A;  3C1C A;  4J8W B;  1JFI B;  4R8P C;  3AZH A;  3VH5 W;  3REJ B;  2CV5 C;  4XUJ A;  3X1V D;  4G92 B;  1M1A B;  1P3M C;  5AVB C;  2ARO D;  2JCH A;  3B0B A;  5B33 C;  4KHA B;  5JRG C;  3AYW C;  3KSY A;  1P3A A;  3B6F A;  4YS3 A;  1B67 A;  5AV5 C;  4X23 B;  3X1U D;  1P3O B;  3W99 C;  2JSS A;  1ZLA B;  5B24 C;  3AZJ D;  3V9R A;  2L5A A;  3UTA B;  3EPJ A;  3X1T C;  1P3G B;  1H3O A;  3O62 B;  1P34 B;  3X1S C;  2RVQ D;  4JJN C;  1M18 B;  4J8X C;  1R4V A;  1P3B B;  5B1L D;  3LJA C;  3TU4 B;  4WJ3 C;  4KGC B;  3WTP D;  3MGP D;  1HQ3 B;  4H9P A;  4EO5 C;  5DNN A;  3AZN B;  3AV1 B;  5AV9 A;  3AZK B;  3LZ1 A;  3MGQ B;  3A6N C;  4ZBJ C;  3KXB B;  1U35 D;  3MNN B;  4XZQ D;  1P3I D;  1P3F C;  5B0Y B;  2F8N G;  1P3L D;  5BO0 A;  3A1K A;  3WAA D;  3AN2 B;  3AZF B;  3W98 D;  3WA9 D;  1ID3 D;  1P3M A;  5AVB A;  5E5A D;  3AZG D;  3MGS D;  3H0L C;  3MGQ D;  3AZL C;  1KX3 D;  4DRA A;  3MNN D;  1M19 D;  3AZE B;  3W96 C;  2RIQ A;  3X1V C;  4NE5 A;  3C1C B;  5CP6 D;  3AZH B;  4XUJ B;  1ULY A;  4HGA B;  4Z5T D;  4JJN A;  2Y2M A;  3NQU A;  5B32 D;  4J8X A;  3KUY D;  1P3A B;  3B6F B;  5CPK A;  3AL0 C;  4YS3 B;  3LEL C;  4YM6 C;  1EQZ C;  2BG1 A;  3A6N A;  3V9R B;  5B2I A;  3AZE D;  1H3O B;  2ZY3 A;  3C1C D;  5B1L C;  5BS7 C;  3LZ0 A;  3WTP C;  3MGP C;  3EPL A;  1S32 A;  1P3F A;  1B6W A;  5AY8 A;  4Z2M G;  1P3P C;  1F66 A;  4H9P B;  5DNN B;  1P3A D;  3B6G A;  5AV9 B;  2HIO D;  3REL C;  3LZ1 B;  2ZY5 A;  5B31 A;  5B1M A;  1U35 C;  3MVD C;  3UTB D;  3W97 C;  4XZQ C;  1P3I C;  4ZUX D;  3REH A;  2JE5 A;  3WAA C;  3W96 A;  3W98 C;  1ID3 C;  5B2J C;  5BO0 B;  3VH6 T;  3AZG C;  2IO5 C;  2Y2H A;  3KWQ D;  5AV8 C;  1P3M B;  5AVC D;  5AVB B;  2ZY4 A;  3LZ1 D;  4WU9 D;  2NZD A;  3AFA A;  3KFU G;  5AV5 B;  3LEL A;  4YM6 A;  1EQZ A;  5BT1 C;  4KUD C;  2PYO C;  3AV2 D;  3VH5 T;  4Z5T C;  1KX4 C;  3AZN A;  3R45 A;  4JJN B;  3NQU B;  5B40 D;  4J8X B;  4WU8 C;  5BNV A;  3REK A;  1TZY C;  5CPK B;  4EO5 B;  1F1E A;  5B0Z D;  3REL A;  3A6N B;  4ZBJ B;  5AV6 C;  3W97 A;  5B2I B;  3UT9 C;  3AZM D;  4G91 B;  3VH6 W;  3LZ0 B;  3H0M C;  1S32 B;  5F99 C;  1P3F B;  5DNM D;  5AY8 B;  5CPJ C;  5B2J A;  2HIO C;  2NQB D;  4NFT A;  3REI C;  4DQY B;  4AWL C;  2HUE C;  3B6G B;  4LD9 C;  3UTB C;  5B31 B;  5B1M B;  5GT0 C;  4ZUX C;  2Y2P A;  5CPI C;  3C1B A;  2ZY2 A;  1P3K A;  5B2I D;  3REH B;  4Z66 D;  4KUD A;  3B0D C;  2PYO A;  1AOI A;  3W96 B;  3AZI A;  4J8V D;  1F66 D;  3B6G D;  1TZY A;  5GT3 C;  2NZD B;  3AFA B;  3LEL B;  2F8N A;  4YM6 B;  4J8W D;  1EQZ B;  3REJ D;  3MGR C;  1M1A D;  2Y2K A;  4H9N B;  3WKJ A;  5C3I B;  5AV6 A;  3UT9 A;  5B40 C;  2CWE A;  3R45 B;  4H9O A;  4X23 D;  1A7W A;  5F99 A;  5BNV B;  3REK B;  1P3O D;  1ZLA D;  1T3U A;  1P3P B;  4LD9 A;  2NZD D;  3REL B;  3UTA D;  1P3G D;  2FJ7 A;  5GXQ C;  3O62 D;  1BH8 A;  5GT0 A;  3AZM C;  1P34 D;  1M18 D;  1KX5 A;  3MVD B;  3W97 B;  4R8P A;  1P3B D;  2CV5 A;  5CPI A;  5GSU C;  3TU4 D;  4KGC D;  4J8U C;  1HQ3 D;  3AZN D;  3AV1 D;  5B33 A;  5JRG A;  3AZK D;  3AYW A;  5B2J B;  4QLC C;  5AV5 A;  3KXB D;  3W99 A;  5B24 A;  2FFF B;  2ARO C;  5GT3 A;  5B0Y D;  3F6T A;  4Z66 C;  3C1B B;  3X1T A;  1P3K B;  3X1S A;  3MGR A;  3AN2 D;  3AZF D;  2F8N K;  4KUD B;  2F2A C;  1WWS A;  2PYO B;  1AOI B;  3LJA A;  4J8V C;  3X1U C;  3AZI B;  3AZJ C;  2ZM5 A;  5JA4 A;  1TZY B;  2RVQ C;  2G5H C;  3REJ C;  4G92 C;  2F8N B;  3AZH D;  4XUJ D;  3C1B D;  5GXQ A;  1WWI A;  1P3K D;  3WKJ B;  5AV6 B;  1Q9C A;  3UT9 B;  3B6F D;  4J8U A;  4YS3 D;  3AZI D;  1ZLA C;  4H9O B;  3EG5 B;  5F99 B;  5G49 A;  3FDD A;  5CPJ B;  3AZL A;  3UTA C;  1P3G C;  3REI B;  3O62 C;  1P34 C;  1M18 C;  1TAF A;  4CSR A;  4LD9 B;  1P3L C;  2FJ7 B;  1P3B C;  1KX5 B;  1BH8 B;  5GT0 B;  3X1V A;  3WA9 C;  2Y2N A;  1HQ3 C;  5E5A C;  4R8P B;  3AV1 C;  2CV5 B;  5CPI B;  3WKJ D;  2W8S A;  1PZR A;  3MGS C;  3MGQ C;  5DNN D;  1KX3 C;  5B33 B;  5AV9 D;  5JRG B;  3AYW B;  4WNN A;  3MNN C;  1M19 C;  3AZJ A;  3W99 B;  5CP6 C;  3B0C W;  4H9S C;  5KDM A;  5B24 B;  4H9N A;  2Y2L A;  5GT3 B;  5B32 C;  3AN2 C;  3AZF C;  3X1T B;  5B1L A;  5BS7 A;  3X1S B;  3KUY C;  4R8P D;  3WTP A;  3MGP A; 
#chains in the Genus database with same CATH homology
 1P3M D;  3LJA B;  1N1J A;  5AVB D;  1BH9 A;  2Y2Q A;  5B33 D;  1P3P A;  5JA4 B;  5AV5 D;  3AZE C;  1U35 A;  3C1C C;  3W99 D;  3MVD A;  2XD5 A;  4H9R A;  3AZH C;  4XZQ A;  4XUJ C;  1P3I A;  4HGA C;  2BYK A;  5GXQ B;  3WAA A;  4JJN D;  3W98 A;  1P3A C;  3B6F C;  1ID3 A;  3WA9 A;  4YS3 C;  4J8X D;  3AZG A;  5AV8 A;  3MGS A;  4J8U B;  5CPK D;  1KX3 A;  5G49 B;  3AZL B;  2Y2I A;  1M19 A;  3A6N D;  1TAF B;  4CSR B;  5CP6 A;  3X1V B;  3KWQ C;  4Z5T A;  3LZ0 D;  5AVC C;  1S32 D;  2ARO B;  5DNN C;  1P3F D;  1KX4 A;  5AY8 D;  5AV9 C;  3KUY A;  3LZ1 C;  4WU9 C;  4WU8 A;  5B31 D;  4WNN B;  5B1M D;  2VQR A;  1W2E A;  3AV2 C;  3AZJ B;  5KDM B;  3REH D;  2YFV B;  3A1I A;  3W96 D;  5B1L B;  5CHL B;  3WTP B;  2LY8 A;  3MGP B;  3IP4 C;  5B32 G;  5B0Z C;  5CPJ A;  1N1J B;  1BH9 B;  2HIO A;  3REI A;  3WTP E;  3AFA D;  3UTB A;  3LEL D;  4YM6 D;  1U35 B;  3NQJ A;  1EQZ D;  4ZUX A;  4H9R B;  2BYM A;  4XZQ B;  2G5I C;  2UWX A;  1P3I B;  5DNM C;  2BYK B;  1P3L B;  2NQB C;  3WAA B;  3KWQ A;  3W98 B;  3WA9 B;  5CPK C;  1ID3 B;  5AVC A;  3AZG B;  5E5A B;  3REK D;  2IO5 B;  3MGR B;  2DQN C;  5AV8 B;  3MGS B;  5BNX A;  4WU9 A;  1P3P D;  1KX3 B;  2DF4 C;  3REL D;  5B2I C;  1M19 B;  3MVD D;  4G91 C;  3AV2 A;  3W97 D;  3LZ0 C;  5CP6 B;  1S32 C;  5AY8 C;  4Z5T B;  1F66 C;  1KX4 B;  5B32 B;  5B40 A;  3EPH A;  3B6G C;  5B2J D;  3KUY B;  5B31 C;  5B1M C;  4WU8 B;  2YFW A;  5AV8 D;  5B0Z A;  4J8W C;  4CAY A;  1M1A C;  3B0C T;  3P5J B;  3REH C;  2F8N H;  3AZM A;  5BT1 D;  4KUD D;  2XD1 A;  4X23 C;  1AOI D;  2PYO D;  5GSU A;  1P3O C;  5DNM A;  1KX4 D;  2NQB A;  2HIO B;  2NZD C;  4QLC A;  3AFA C;  4WU8 D;  4AWL B;  1TZY D;  2HUE B;  3UTB B;  1HTA A;  2F8N D;  3NQJ B;  3TU4 C;  5C3I C;  4KGC C;  4ZUX B;  4DRB A;  3AZN C;  2ARO A;  2BYM B;  4Z66 A;  4H9Q A;  5AV6 D;  3AZK C;  3UT9 D;  4UUZ A;  1KU5 A;  3REK C;  3B0D B;  4NE3 A;  4J8V A;  5FUG A;  3KWQ B;  3X1U A;  3KXB C;  5AVC B;  5F99 D;  2Y2J A;  5CPJ D;  5BNX B;  3REI D;  4WU9 B;  2Y2G A;  5B0Y C;  4LD9 D;  4J8W A;  4NE6 A;  1JFI A;  2YFV A;  2FJ7 D;  1KX5 D;  3REJ A;  4M6B A;  5GT0 D;  1M1A A;  3AV2 B;  2CV5 D;  5CPI D;  4Z2M H;  3EPK A;  1BFM A;  4KHA A;  4WZS B;  4X23 A;  5B40 B;  5JRG D;  3AYW D;  1P3O A;  1ZLA A;  2Y2O A;  2YFW B;  4WV4 B;  5B0Z B;  4CAY B;  5B24 D;  3UTA A;  1P3G A;  5B31 G;  3O62 A;  3C1B C;  1P34 A;  1P3K C;  1M18 A;  5GT3 D;  3X1T D;  1P3L A;  1P3B A;  3AZM B;  3X1S D;  1AOI C;  3TU4 A;  4KGC A;  3MGR D;  3AZI C;  1HQ3 A;  5E5A A;  3AV1 A;  3LJA D;  5GSU B;  5DNM B;  3AZK A;  1Z2C B;  3MGQ A;  2NQB B;  3H0R C;  4E45 A;  3VH6 A;  3KXB A;  4QLC B;  3MNN A;  4H9S A;  5B0Y A;  4UPK A;  3WKJ C;  2J8P A;  5GXQ D;  5B32 A;  3AN2 A;  4Z66 B;  3AZF A;  4H9Q B;  4UUZ B;  5GSU D;  3VH5 A;  4J8U D;  4J8V B;  5FUG B;  3X1U B;  1F66 B;  3AZL D;  4QLC D;  4E44 A;  2FJ7 C;  1KX5 C;  3AZE A;  3C1C A;  4J8W B;  1JFI B;  4R8P C;  3AZH A;  3VH5 W;  3REJ B;  2CV5 C;  4XUJ A;  3X1V D;  4G92 B;  1M1A B;  1P3M C;  5AVB C;  2ARO D;  2JCH A;  3B0B A;  5B33 C;  4KHA B;  5JRG C;  3AYW C;  3KSY A;  1P3A A;  3B6F A;  4YS3 A;  1B67 A;  5AV5 C;  4X23 B;  3X1U D;  1P3O B;  3W99 C;  2JSS A;  1ZLA B;  5B24 C;  3AZJ D;  3V9R A;  2L5A A;  3UTA B;  3EPJ A;  3X1T C;  1P3G B;  1H3O A;  3O62 B;  1P34 B;  3X1S C;  2RVQ D;  4JJN C;  1M18 B;  4J8X C;  1R4V A;  1P3B B;  5B1L D;  3LJA C;  3TU4 B;  4WJ3 C;  4KGC B;  3WTP D;  3MGP D;  1HQ3 B;  4H9P A;  4EO5 C;  5DNN A;  3AZN B;  3AV1 B;  5AV9 A;  3AZK B;  3LZ1 A;  3MGQ B;  3A6N C;  4ZBJ C;  3KXB B;  1U35 D;  3MNN B;  4XZQ D;  1P3I D;  1P3F C;  5B0Y B;  2F8N G;  1P3L D;  5BO0 A;  3A1K A;  3WAA D;  3AN2 B;  3AZF B;  3W98 D;  3WA9 D;  1ID3 D;  1P3M A;  5AVB A;  5E5A D;  3AZG D;  3MGS D;  3H0L C;  3MGQ D;  3AZL C;  1KX3 D;  4DRA A;  3MNN D;  1M19 D;  3AZE B;  3W96 C;  2RIQ A;  3X1V C;  4NE5 A;  3C1C B;  5CP6 D;  3AZH B;  4XUJ B;  1ULY A;  4HGA B;  4Z5T D;  4JJN A;  2Y2M A;  3NQU A;  5B32 D;  4J8X A;  3KUY D;  1P3A B;  3B6F B;  5CPK A;  3AL0 C;  4YS3 B;  3LEL C;  4YM6 C;  1EQZ C;  2BG1 A;  3A6N A;  3V9R B;  5B2I A;  3AZE D;  1H3O B;  2ZY3 A;  3C1C D;  5B1L C;  5BS7 C;  3LZ0 A;  3WTP C;  3MGP C;  3EPL A;  1S32 A;  1P3F A;  1B6W A;  5AY8 A;  4Z2M G;  1P3P C;  1F66 A;  4H9P B;  5DNN B;  1P3A D;  3B6G A;  5AV9 B;  2HIO D;  3REL C;  3LZ1 B;  2ZY5 A;  5B31 A;  5B1M A;  1U35 C;  3MVD C;  3UTB D;  3W97 C;  4XZQ C;  1P3I C;  4ZUX D;  3REH A;  2JE5 A;  3WAA C;  3W96 A;  3W98 C;  1ID3 C;  5B2J C;  5BO0 B;  3VH6 T;  3AZG C;  2IO5 C;  2Y2H A;  3KWQ D;  5AV8 C;  1P3M B;  5AVC D;  5AVB B;  2ZY4 A;  3LZ1 D;  4WU9 D;  2NZD A;  3AFA A;  3KFU G;  5AV5 B;  3LEL A;  4YM6 A;  1EQZ A;  5BT1 C;  4KUD C;  2PYO C;  3AV2 D;  3VH5 T;  4Z5T C;  1KX4 C;  3AZN A;  3R45 A;  4JJN B;  3NQU B;  5B40 D;  4J8X B;  4WU8 C;  5BNV A;  3REK A;  1TZY C;  5CPK B;  4EO5 B;  1F1E A;  5B0Z D;  3REL A;  3A6N B;  4ZBJ B;  5AV6 C;  3W97 A;  5B2I B;  3UT9 C;  3AZM D;  4G91 B;  3VH6 W;  3LZ0 B;  3H0M C;  1S32 B;  5F99 C;  1P3F B;  5DNM D;  5AY8 B;  5CPJ C;  5B2J A;  2HIO C;  2NQB D;  4NFT A;  3REI C;  4DQY B;  4AWL C;  2HUE C;  3B6G B;  4LD9 C;  3UTB C;  5B31 B;  5B1M B;  5GT0 C;  4ZUX C;  2Y2P A;  5CPI C;  3C1B A;  2ZY2 A;  1P3K A;  5B2I D;  3REH B;  4Z66 D;  4KUD A;  3B0D C;  2PYO A;  1AOI A;  3W96 B;  3AZI A;  4J8V D;  1F66 D;  3B6G D;  1TZY A;  5GT3 C;  2NZD B;  3AFA B;  3LEL B;  2F8N A;  4YM6 B;  4J8W D;  1EQZ B;  3REJ D;  3MGR C;  1M1A D;  2Y2K A;  4H9N B;  3WKJ A;  5C3I B;  5AV6 A;  3UT9 A;  5B40 C;  2CWE A;  3R45 B;  4H9O A;  4X23 D;  1A7W A;  5F99 A;  5BNV B;  3REK B;  1P3O D;  1ZLA D;  1T3U A;  1P3P B;  4LD9 A;  2NZD D;  3REL B;  3UTA D;  1P3G D;  2FJ7 A;  5GXQ C;  3O62 D;  1BH8 A;  5GT0 A;  3AZM C;  1P34 D;  1M18 D;  1KX5 A;  3MVD B;  3W97 B;  4R8P A;  1P3B D;  2CV5 A;  5CPI A;  5GSU C;  3TU4 D;  4KGC D;  4J8U C;  1HQ3 D;  3AZN D;  3AV1 D;  5B33 A;  5JRG A;  3AZK D;  3AYW A;  5B2J B;  4QLC C;  5AV5 A;  3KXB D;  3W99 A;  5B24 A;  2FFF B;  2ARO C;  5GT3 A;  5B0Y D;  3F6T A;  4Z66 C;  3C1B B;  3X1T A;  1P3K B;  3X1S A;  3MGR A;  3AN2 D;  3AZF D;  2F8N K;  4KUD B;  2F2A C;  1WWS A;  2PYO B;  1AOI B;  3LJA A;  4J8V C;  3X1U C;  3AZI B;  3AZJ C;  2ZM5 A;  5JA4 A;  1TZY B;  2RVQ C;  2G5H C;  3REJ C;  4G92 C;  2F8N B;  3AZH D;  4XUJ D;  3C1B D;  5GXQ A;  1WWI A;  1P3K D;  3WKJ B;  5AV6 B;  1Q9C A;  3UT9 B;  3B6F D;  4J8U A;  4YS3 D;  3AZI D;  1ZLA C;  4H9O B;  3EG5 B;  5F99 B;  5G49 A;  3FDD A;  5CPJ B;  3AZL A;  3UTA C;  1P3G C;  3REI B;  3O62 C;  1P34 C;  1M18 C;  1TAF A;  4CSR A;  4LD9 B;  1P3L C;  2FJ7 B;  1P3B C;  1KX5 B;  1BH8 B;  5GT0 B;  3X1V A;  3WA9 C;  2Y2N A;  1HQ3 C;  5E5A C;  4R8P B;  3AV1 C;  2CV5 B;  5CPI B;  3WKJ D;  2W8S A;  1PZR A;  3MGS C;  3MGQ C;  5DNN D;  1KX3 C;  5B33 B;  5AV9 D;  5JRG B;  3AYW B;  4WNN A;  3MNN C;  1M19 C;  3AZJ A;  3W99 B;  5CP6 C;  3B0C W;  4H9S C;  5KDM A;  5B24 B;  4H9N A;  2Y2L A;  5GT3 B;  5B32 C;  3AN2 C;  3AZF C;  3X1T B;  5B1L A;  5BS7 A;  3X1S B;  3KUY C;  4R8P D;  3WTP A;  3MGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...