3W98A

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98A00
2CV5A 1F66B 3KUYD 3AZKA 3AZMB 1P3PA 3W96D 1TAFB 2NQBC 2IO5B 5CHLB 1F66D 3AZMD 1P34B 3AZEC 4G91B 5E5AB 1M19D 5CPKA 4WU8C 1JFIB 2HIOC 3NQJB 3AZNC 3AYWA 1P34D 4M6BA 1N1JA 5E5AD 4H9NB 5GSUA 3W99B 3AV2A 3AZLC 3MGSB 1BH9B 1KX3A 3NQUA 3AZEB 3W99D 1KX4A 3REJC 4YM6A 3LZ0C 3AZNB 4X23A 3MGSD 3REKA 3TU4A 3W98A 3MGPC 5CPJA 3AZED 1P3MA 2BYKB 2RVQC 3W97C 3AZND 3AZLB 1KX5A 3C1CA 3C1BA 3AZHA 5B0ZB 5CPIC 1U35A 1ID3C 2AROA 3REJB 3LZ0B 3AZJC 5AV5A 1B67A 3AZLD 4YS3C 3KXBC 5B0ZD 5B40A 3REJD 4J8UC 3VH6A 3LZ0D 3AFAA 3X1TA 4HGAC 3REIA 4CAYB 4DRAA 3AZGC 5JRGA 5GT0C 3KUYA 3WKJC 1HQ3C 1ID3B 2CV5C 1P3BA 5B32G 5B24A 4YS3B 1ZLAC 3KXBB 4J8WC 1Q9CA 4LD9C 1ID3D 4J8UB 3X1VC 4YS3D 5GT3A 3KXBD 4KUDA 3LZ1A 3AZGB 1P3LA 2LY8A 3WKJB 5BNXB 1HQ3B 4J8UD 4J8VC 3UTAC 4G92B 5GSUC 4KHAB 1ZLAB 4XUJC 3AZGD 4J8WB 4JJNC 3WKJD 1HQ3D 4LD9B 5GXQA 1KX3C 3X1VB 3LELC 5CP6C 3MNNA 1ZLAD 2FJ7A 5AVCC 4DRBA 4J8WD 3B6FA 3MGSA 4LD9D 4YM6C 3TU4C 4J8XC 3UTAB 5FUGA 3X1VD 3UT9A 4XUJB 1H3OA 4JJNB 3REHC 2YFWA 3B0BA 1M18C 4E45A 4J8VD 3C1BC 3UTAD 5CP6B 1U35C 4R8PC 3VH5A 4XUJD 5AVCB 4JJND 5B33C 3R45A 5B1LC 3X1UC 3MGQA 1P3OB 5B0ZA 2BYMA 1P3FB 5B40C 5CP6D 1S32C 5AVCD 3WTPA 3MVDC 3UTBA 4WU9A 1P3OD 3REHB 1M18B 5B2IB 1M1AC 1P3FD 5B32C 3MGRA 4R8PB 5B33B 5B0YC 5B1LB 5DNMA 3X1UB 3REHD 5B2ID 1M18D 5B2JC 4CSRB 2F8NB 1M19B 1BH8A 5KDMB 1S32B 3AZFC 4H9PA 4R8PD 5B33D 3WA9C 3O62A 1AOIC 2NZDA 5AV6A 5B1LD 3MVDB 3X1UD 4NFTA 5BT1D 2F8ND 1M1AB 4Z5TC 1S32D 5DNNA 5B32B 5AVBA 3B6GC 5B0YB 4Z66C 3MVDD 1TZYA 3KSYA 5B2JB 1M1AD 2NQBB 5B32D 4WZSB 3AZFB 3WA9B 5B0YD 5BO0A 4ZBJC 1AOIB 1P3GC 5B2JD 5AV9A 3MNNC 4Z5TB 2NQBD 4WU8B 1P3AA 3AZFD 2HIOB 3WA9D 5AV8C 1AOID 5BNVA 3B6GB 4NE6A 4Z66B 1P3IC 4E44A 5B31A 3RELC 4Z5TD 4UUZA 4WNNB 4Z2MH 5BS7A 5JA4A 5B1MA 2HIOD 4WU8D 2PYOA 3X1SA 3B6GD 3AZIA 4ZBJB 4Z66D 4XZQA 4H9RA 5G49B 4H9QA 3A6NC 1P3GB 4KGCC 4ZUXC 3LJAC 1P3KA 3KWQA 1ULYA 3AN2C 4QLCC 3WAAA 1P3IB 1EQZA 1P3GD 3MGPB 5AY8C 4WU9C 4H9SA 3AV1C 3W97B 1P3FA 1P3ID 5F99C 3MGPD 3A6NB 4KGCB 5CPIB 2RVQD 3V9RB 5B2IA 3W96A 3AZKC 1P3PC 3W97D 3AZJB 3AN2B 4QLCB 3A6ND 1F66A 3VH6T 3AZMA 4ZUXD 4KGCD 5CPID 5AV6C 4H9OB 5AY8B 4AWLC 1TAFA 3AZJD 3AV1B 1M19A 4HGAB 3AN2D 4QLCD 1BFMA 5F99B 5CPKC 5DNNC 3B0DC 5GT0B 1P34A 3AYWC 5AY8D 2CV5B 1KU5A 5E5AA 3AZKB 3AV1D 1JFIA 3NQJA 5F99D 3AV2C 5GT0D 2CV5D 4AWLB 3AZKD 4H9NA 2NQBA 3W99A 5CPKB 1KX4C 1BH9A 3AYWB 5C3IC 4X23C 3REKC 3AZEA 3W98C 4Z2MG 4J8VB 5CPJC 1P3MC 1N1JB 5GSUB 3AZNA 5CPKD 2YFVB 3AV2B 5B1MC 3AYWD 2BYKA 1KX5C 3C1CC 3B0CT 3AZHC 1KX3B 5GSUD 3NQUB 3LELB 1KX4B 3AZLA 2AROC 3AV2D 5G49A 4YM6B 5AV5C 5C3IB 4X23B 3REKB 3TU4B 4J8XB 3W98B 1KX3D 3REJA 5CPJB 3LELD 1P3MB 3LZ0A 1KX4D 3WTPE 4YM6D 3AFAC 3X1TC 3REIC 4X23D 3W98D 3REKD 3TU4D 4J8XD 1KX5B 3VH5T 3C1BB 5CPJD 3AZHB 5JRGC 3KUYC 1P3MD 1U35B 1WWIA 2AROB 4CAYA 1P3BC 5B24C 5AV5B 5CPIA 1KX5D 1ID3A 3C1BD 3AZHD 3AZMC 5B40B 1U35D 3AZJA 2AROD 4YS3A 3KXBA 4WV4B 5AV5D 3AFAB 3X1TB 3REIB 5GT3C 4KUDC 3LZ1C 4J8UA 5B40D 5JRGB 1P3LC 3X1TD 3AFAD 1P3BB 2F8NH 3REID 5B24B 3AZGA 3WKJA 5BNXA 1HQ3A 5JRGD 2L5AA 4KHAA 1P3BD 1ZLAA 3W99C 5GXQC 5B24D 4J8WA 5GT3B 2FJ7C 4KUDB 4LD9A 1R4VA 3B6FC 1WWSA 3LZ1B 3MGSC 1P3LB 3X1VA 3VH6W 5GT3D 4KUDD 3UT9C 3LZ1D 1P3LD 4J8VA 5B31G 3UTAA 2YFVA 2F8NK 5GXQB 4XUJA 4JJNA 3MNNB 2FJ7B 3B6FB 3MGQC 1A7WA 5AV8B 5B0ZC 3LELA 5CP6A 5GXQD 5AVCA 5FUGB 3MNND 2FJ7D 3RELB 1P3OA 3UT9B 3B6FD 3WTPC 1H3OB 4J8XA 3UTBC 5AV8D 2YFWB 2HUEC 3RELD 3MGRC 4ZUXB 3UT9D 3REHA 1M18A 3LJAB 3R45B 5DNMC 3MGQB 2BYMB 4R8PA 5B33A 5B1LA 3X1UA 3LJAD 3B0CW 3WTPB 3O62C 2NZDC 4CSRA 2F8NA 3MGQD 3UTBB 4WU9B 5KDMA 2CWEA 1S32A 2HUEB 4NE3A 2F8NG 3MVDA 3MGRB 5AVBC 3WTPD 4WU9D 3UTBD 1M1AA 5DNMB 1P3PB 1TZYC 5B32A 4EO5C 5B0YA 1BH8B 3MGRD 3VH5W 4H9PB 3O62B 4G92C 2NZDB 5B2JA 5AV6B 5DNMD 1P3PD 5AV9C 3AZFA 3WA9A 1AOIA 1P3AC 5DNNB 3B0DB 5AVBB 3O62D 2NZDD 5AV6D 1F1EA 4NE5A 4Z5TA 1TZYB 5B31C 4WU8A 2HIOA 4EO5B 3B6GA 5BS7C 4Z66A 5DNND 2PYOC 5AVBD 3X1SC 2JSSA 3AZIC 5BO0B 4XZQC 1TZYD 4WNNA 5AV9B 1P3KC 3KWQC 1P3AB 1P3GA 5BNVB 3WAAC 1EQZC 5AV9D 5B31B 1P3OC 5AV8A 4UUZB 2PYOB 1P3AD 5JA4B 5B1MB 1P3IA 4H9SC 3X1SB 1P3FC 3MGPA 3AZIB 3RELA 4XZQB 4H9RB 4H9QB 3C1CB 5B31D 3W97A 5B2IC 1P3KB 2PYOD 3W96C 5B1MD 3KWQB 3X1SD 3AZID 3A6NA 4KGCA 4XZQD 4ZUXA 3WAAB 3V9RA 1EQZB 3LJAA 3C1CD 1F66C 1P3KD 5BT1C 3KWQD 4QLCA 3AN2A 1M19C 2IO5C 1HTAA 1B6WA 3WAAD 1EQZD 4H9OA 5AY8A 3KUYB 3AV1A 1P34C 3W96B 4G91C 5E5AC 5F99A 5GT0A
chains in the Genus database with same CATH superfamily
2CV5A 1F66B 3KUYD 3AZKA 3AZMB 1P3PA 3W96D 2Y2MA 3EPJA 1TAFB 2NQBC 2IO5B 2G5HC 5CHLB 1F66D 3AZMD 1P34B 3AZEC 4G91B 5E5AB 1M19D 5CPKA 4WU8C 1JFIB 2HIOC 3NQJB 3AZNC 3AYWA 1P34D 4M6BA 1N1JA 5E5AD 4H9NB 5GSUA 3W99B 3AV2A 2ZM5A 3AZLC 3MGSB 1BH9B 1KX3A 3NQUA 3AZEB 3EG5B 3W99D 1KX4A 3REJC 4YM6A 3LZ0C 2FFFB 3AZNB 4X23A 3MGSD 3REKA 3TU4A 3W98A 3MGPC 1T3UA 5CPJA 3AZED 1P3MA 2BYKB 2RVQC 3W97C 3AZND 3AZLB 1KX5A 3C1CA 3C1BA 3AZHA 5B0ZB 5CPIC 1U35A 1ID3C 2AROA 3REJB 3LZ0B 3AZJC 5AV5A 1B67A 3AZLD 2Y2PA 4YS3C 3KXBC 5B0ZD 5B40A 3REJD 4J8UC 3VH6A 3LZ0D 3AFAA 3X1TA 4HGAC 3REIA 4CAYB 4DRAA 3AZGC 5JRGA 5GT0C 3KUYA 3WKJC 1HQ3C 1ID3B 2CV5C 1P3BA 5B32G 5B24A 4YS3B 1ZLAC 3KXBB 4J8WC 1Q9CA 4LD9C 1ID3D 4J8UB 3X1VC 4YS3D 5GT3A 3KXBD 4KUDA 1W2EA 3LZ1A 3AZGB 1P3LA 2LY8A 3WKJB 5BNXB 1HQ3B 4J8UD 4J8VC 3UTAC 4WJ3C 4G92B 5GSUC 4KHAB 1ZLAB 4XUJC 3AZGD 4J8WB 4JJNC 3WKJD 2ZY3A 1HQ3D 4LD9B 5GXQA 1KX3C 3X1VB 3P5JB 5CP6C 3MNNA 3IP4C 3LELC 1ZLAD 2FJ7A 5AVCC 4DRBA 4J8WD 3B6FA 3MGSA 4LD9D 4YM6C 3TU4C 4J8XC 3UTAB 5FUGA 3X1VD 3UT9A 4XUJB 1H3OA 4JJNB 3REHC 2YFWA 3B0BA 1M18C 2RIQA 4E45A 4J8VD 3C1BC 3UTAD 5CP6B 1U35C 4R8PC 3VH5A 4XUJD 5AVCB 4JJND 5B33C 3R45A 5B1LC 3X1UC 3MGQA 1P3OB 5B0ZA 2BYMA 1P3FB 5B40C 5CP6D 1S32C 5AVCD 3WTPA 3MVDC 3UTBA 4WU9A 1P3OD 3REHB 1M18B 5B2IB 1M1AC 1P3FD 5B32C 3MGRA 4R8PB 5B33B 5B0YC 3A1KA 5B1LB 5DNMA 3X1UB 3REHD 5B2ID 1M18D 5B2JC 4CSRB 2F8NB 1M19B 1BH8A 5KDMB 1S32B 3H0LC 3AZFC 4H9PA 4R8PD 5B33D 3WA9C 3O62A 1AOIC 2NZDA 5AV6A 5B1LD 3MVDB 3X1UD 4NFTA 5BT1D 2F8ND 1M1AB 4Z5TC 1S32D 5DNNA 5B32B 2ZY2A 5AVBA 3B6GC 5B0YB 4Z66C 3MVDD 1TZYA 3KSYA 5B2JB 1M1AD 2NQBB 5B32D 4WZSB 3AZFB 3WA9B 5B0YD 5BO0A 4ZBJC 1AOIB 2JE5A 1P3GC 5B2JD 5AV9A 3MNNC 4Z5TB 2NQBD 4WU8B 1P3AA 3AZFD 2HIOB 3WA9D 5AV8C 1AOID 5BNVA 3B6GB 4NE6A 4Z66B 1P3IC 4E44A 5B31A 3RELC 2Y2GA 4UUZA 4WNNB 4Z5TD 4Z2MH 5BS7A 5JA4A 5B1MA 2HIOD 4WU8D 2PYOA 3X1SA 3B6GD 3AZIA 4ZBJB 4Z66D 4XZQA 4H9RA 5G49B 4H9QA 3A6NC 1P3GB 4KGCC 4ZUXC 3LJAC 1P3KA 2JCHA 3KWQA 1ULYA 3AN2C 4QLCC 3WAAA 1P3IB 1EQZA 1P3GD 3MGPB 2J8PA 5AY8C 4WU9C 2F2AC 4H9SA 3AV1C 3W97B 1P3FA 1P3ID 5F99C 3MGPD 3A6NB 4KGCB 5CPIB 2RVQD 3V9RB 5B2IA 3W96A 3AZKC 1P3PC 3W97D 3AZJB 3AN2B 4QLCB 3A6ND 1F66A 3VH6T 3AZMA 4ZUXD 4KGCD 5CPID 5AV6C 4H9OB 5AY8B 4AWLC 4DQYB 1TAFA 3AZJD 3AV1B 1M19A 4HGAB 3AN2D 4QLCD 1BFMA 2UWXA 5F99B 5CPKC 5DNNC 2XD5A 3B0DC 5GT0B 1P34A 3AYWC 5AY8D 2CV5B 1KU5A 5E5AA 3AZKB 3AV1D 1JFIA 3NQJA 5F99D 3AV2C 5GT0D 2CV5D 2ZY5A 4AWLB 3AZKD 4H9NA 2NQBA 3W99A 5CPKB 1KX4C 1BH9A 3AYWB 5C3IC 4X23C 3REKC 3AZEA 3W98C 4Z2MG 4J8VB 5CPJC 1P3MC 1N1JB 5GSUB 3AZNA 5CPKD 2YFVB 3AV2B 5B1MC 3AYWD 2BYKA 1KX5C 2W8SA 3C1CC 3B0CT 3AZHC 1KX3B 5GSUD 3NQUB 3LELB 1KX4B 3AZLA 2AROC 2Y2IA 3AV2D 5G49A 4YM6B 5AV5C 5C3IB 4X23B 3REKB 3TU4B 4J8XB 3W98B 1KX3D 3REJA 5CPJB 3LELD 1P3MB 3LZ0A 1KX4D 1PZRA 3WTPE 2DF4C 4YM6D 3AFAC 3X1TC 3F6TA 3REIC 4X23D 3W98D 3REKD 3TU4D 4J8XD 1KX5B 3VH5T 3C1BB 5CPJD 3AZHB 5JRGC 3KUYC 1P3MD 1U35B 1WWIA 2AROB 4CAYA 1P3BC 5B24C 5AV5B 5CPIA 1KX5D 2BG1A 2ZY4A 1ID3A 3C1BD 3AZHD 3AZMC 5B40B 1U35D 3AZJA 2AROD 4YS3A 3KXBA 4WV4B 5AV5D 3AFAB 3X1TB 3REIB 5GT3C 4KUDC 2Y2NA 3LZ1C 4J8UA 5B40D 5JRGB 1P3LC 2XD1A 3X1TD 3AFAD 1P3BB 2F8NH 3REID 5B24B 3AZGA 3WKJA 5BNXA 1HQ3A 5JRGD 2L5AA 4KHAA 1P3BD 1ZLAA 3W99C 5GXQC 5B24D 4J8WA 5GT3B 2FJ7C 4KUDB 4LD9A 1R4VA 3B6FC 1WWSA 3LZ1B 3MGSC 1P3LB 3X1VA 2G5IC 3VH6W 3FDDA 2Y2OA 5GT3D 4KUDD 3UT9C 3LZ1D 1P3LD 2DQNC 4J8VA 5B31G 3UTAA 2YFVA 2F8NK 5GXQB 4XUJA 4JJNA 3MNNB 2FJ7B 3B6FB 3MGQC 1A7WA 5AV8B 5B0ZC 3LELA 5CP6A 5GXQD 5AVCA 5FUGB 3MNND 2FJ7D 3RELB 1P3OA 3UT9B 3B6FD 3WTPC 1H3OB 4J8XA 3KFUG 3AL0C 3UTBC 3EPLA 5AV8D 2YFWB 2HUEC 3RELD 2Y2KA 3MGRC 4ZUXB 2Y2JA 3UT9D 3REHA 1M18A 3LJAB 2Y2QA 3R45B 5DNMC 3MGQB 2BYMB 4R8PA 5B33A 3A1IA 5B1LA 3X1UA 3LJAD 3B0CW 3WTPB 3O62C 2NZDC 4CSRA 2F8NA 3MGQD 3UTBB 4WU9B 5KDMA 2CWEA 1S32A 2HUEB 4NE3A 2F8NG 3MVDA 3MGRB 5AVBC 3WTPD 4WU9D 3UTBD 1M1AA 5DNMB 1P3PB 1TZYC 5B32A 4EO5C 5B0YA 1BH8B 3MGRD 3VH5W 4H9PB 3O62B 4G92C 2NZDB 5B2JA 5AV6B 5DNMD 1P3PD 5AV9C 3AZFA 3WA9A 1AOIA 1P3AC 5DNNB 3B0DB 5AVBB 3O62D 2NZDD 5AV6D 1F1EA 4NE5A 4Z5TA 1TZYB 5B31C 4WU8A 2HIOA 4EO5B 3B6GA 5BS7C 4Z66A 5DNND 2PYOC 5AVBD 3X1SC 2JSSA 3AZIC 5BO0B 2VQRA 4XZQC 1TZYD 4WNNA 5AV9B 1P3KC 3KWQC 1P3AB 1Z2CB 2Y2LA 4UPKA 1P3GA 5BNVB 3H0RC 3WAAC 1EQZC 5AV9D 5B31B 1P3OC 5AV8A 4UUZB 2PYOB 1P3AD 5JA4B 5B1MB 1P3IA 4H9SC 3X1SB 1P3FC 3MGPA 3AZIB 3RELA 4XZQB 4H9RB 4H9QB 3C1CB 5B31D 3W97A 5B2IC 1P3KB 2PYOD 3W96C 5B1MD 3KWQB 3X1SD 3AZID 3A6NA 4KGCA 4XZQD 4ZUXA 3WAAB 3V9RA 1EQZB 3LJAA 3C1CD 1F66C 3EPKA 1P3KD 5BT1C 3KWQD 4QLCA 2Y2HA 3AN2A 1M19C 2IO5C 3EPHA 1HTAA 1B6WA 3WAAD 1EQZD 4H9OA 5AY8A 3KUYB 3H0MC 3AV1A 1P34C 3W96B 4G91C 5E5AC 5F99A 5GT0A
chains in the Genus database with same CATH topology
2CV5A 1F66B 3KUYD 3AZKA 3AZMB 1P3PA 3W96D 2Y2MA 3EPJA 1TAFB 2NQBC 2IO5B 2G5HC 5CHLB 1F66D 3AZMD 1P34B 3AZEC 4G91B 5E5AB 1M19D 5CPKA 4WU8C 1JFIB 2HIOC 3NQJB 3AZNC 3AYWA 1P34D 4M6BA 1N1JA 5E5AD 4H9NB 5GSUA 3W99B 3AV2A 2ZM5A 3AZLC 3MGSB 1BH9B 1KX3A 3NQUA 3AZEB 3EG5B 3W99D 1KX4A 3REJC 4YM6A 3LZ0C 2FFFB 3AZNB 4X23A 3MGSD 3REKA 3TU4A 3W98A 3MGPC 1T3UA 5CPJA 3AZED 1P3MA 2BYKB 2RVQC 3W97C 3AZND 3AZLB 1KX5A 3C1CA 3C1BA 3AZHA 5B0ZB 5CPIC 1U35A 1ID3C 2AROA 3REJB 3LZ0B 3AZJC 5AV5A 1B67A 3AZLD 2Y2PA 4YS3C 3KXBC 5B0ZD 5B40A 3REJD 4J8UC 3VH6A 3LZ0D 3AFAA 3X1TA 4HGAC 3REIA 4CAYB 4DRAA 3AZGC 5JRGA 5GT0C 3KUYA 3WKJC 1HQ3C 1ID3B 2CV5C 1P3BA 5B32G 5B24A 4YS3B 1ZLAC 3KXBB 4J8WC 1Q9CA 4LD9C 1ID3D 4J8UB 3X1VC 4YS3D 5GT3A 3KXBD 4KUDA 1W2EA 3LZ1A 3AZGB 1P3LA 2LY8A 3WKJB 5BNXB 1HQ3B 4J8UD 4J8VC 3UTAC 4WJ3C 4G92B 5GSUC 4KHAB 1ZLAB 4XUJC 3AZGD 4J8WB 4JJNC 3WKJD 2ZY3A 1HQ3D 4LD9B 5GXQA 1KX3C 3X1VB 3P5JB 5CP6C 3MNNA 3IP4C 3LELC 1ZLAD 2FJ7A 5AVCC 4DRBA 4J8WD 3B6FA 3MGSA 4LD9D 4YM6C 3TU4C 4J8XC 3UTAB 5FUGA 3X1VD 3UT9A 4XUJB 1H3OA 4JJNB 3REHC 2YFWA 3B0BA 1M18C 2RIQA 4E45A 4J8VD 3C1BC 3UTAD 5CP6B 1U35C 4R8PC 3VH5A 4XUJD 5AVCB 4JJND 5B33C 3R45A 5B1LC 3X1UC 3MGQA 1P3OB 5B0ZA 2BYMA 1P3FB 5B40C 5CP6D 1S32C 5AVCD 3WTPA 3MVDC 3UTBA 4WU9A 1P3OD 3REHB 1M18B 5B2IB 1M1AC 1P3FD 5B32C 3MGRA 4R8PB 5B33B 5B0YC 3A1KA 5B1LB 5DNMA 3X1UB 3REHD 5B2ID 1M18D 5B2JC 4CSRB 2F8NB 1M19B 1BH8A 5KDMB 1S32B 3H0LC 3AZFC 4H9PA 4R8PD 5B33D 3WA9C 3O62A 1AOIC 2NZDA 5AV6A 5B1LD 3MVDB 3X1UD 4NFTA 5BT1D 2F8ND 1M1AB 4Z5TC 1S32D 5DNNA 5B32B 2ZY2A 5AVBA 3B6GC 5B0YB 4Z66C 3MVDD 1TZYA 3KSYA 5B2JB 1M1AD 2NQBB 5B32D 4WZSB 3AZFB 3WA9B 5B0YD 5BO0A 4ZBJC 1AOIB 2JE5A 1P3GC 5B2JD 5AV9A 3MNNC 4Z5TB 2NQBD 4WU8B 1P3AA 3AZFD 2HIOB 3WA9D 5AV8C 1AOID 5BNVA 3B6GB 4NE6A 4Z66B 1P3IC 4E44A 5B31A 3RELC 2Y2GA 4UUZA 4WNNB 4Z5TD 4Z2MH 5BS7A 5JA4A 5B1MA 2HIOD 4WU8D 2PYOA 3X1SA 3B6GD 3AZIA 4ZBJB 4Z66D 4XZQA 4H9RA 5G49B 4H9QA 3A6NC 1P3GB 4KGCC 4ZUXC 3LJAC 1P3KA 2JCHA 3KWQA 1ULYA 3AN2C 4QLCC 3WAAA 1P3IB 1EQZA 1P3GD 3MGPB 2J8PA 5AY8C 4WU9C 2F2AC 4H9SA 3AV1C 3W97B 1P3FA 1P3ID 5F99C 3MGPD 3A6NB 4KGCB 5CPIB 2RVQD 3V9RB 5B2IA 3W96A 3AZKC 1P3PC 3W97D 3AZJB 3AN2B 4QLCB 3A6ND 1F66A 3VH6T 3AZMA 4ZUXD 4KGCD 5CPID 5AV6C 4H9OB 5AY8B 4AWLC 4DQYB 1TAFA 3AZJD 3AV1B 1M19A 4HGAB 3AN2D 4QLCD 1BFMA 2UWXA 5F99B 5CPKC 5DNNC 2XD5A 3B0DC 5GT0B 1P34A 3AYWC 5AY8D 2CV5B 1KU5A 5E5AA 3AZKB 3AV1D 1JFIA 3NQJA 5F99D 3AV2C 5GT0D 2CV5D 2ZY5A 4AWLB 3AZKD 4H9NA 2NQBA 3W99A 5CPKB 1KX4C 1BH9A 3AYWB 5C3IC 4X23C 3REKC 3AZEA 3W98C 4Z2MG 4J8VB 5CPJC 1P3MC 1N1JB 5GSUB 3AZNA 5CPKD 2YFVB 3AV2B 5B1MC 3AYWD 2BYKA 1KX5C 2W8SA 3C1CC 3B0CT 3AZHC 1KX3B 5GSUD 3NQUB 3LELB 1KX4B 3AZLA 2AROC 2Y2IA 3AV2D 5G49A 4YM6B 5AV5C 5C3IB 4X23B 3REKB 3TU4B 4J8XB 3W98B 1KX3D 3REJA 5CPJB 3LELD 1P3MB 3LZ0A 1KX4D 1PZRA 3WTPE 2DF4C 4YM6D 3AFAC 3X1TC 3F6TA 3REIC 4X23D 3W98D 3REKD 3TU4D 4J8XD 1KX5B 3VH5T 3C1BB 5CPJD 3AZHB 5JRGC 3KUYC 1P3MD 1U35B 1WWIA 2AROB 4CAYA 1P3BC 5B24C 5AV5B 5CPIA 1KX5D 2BG1A 2ZY4A 1ID3A 3C1BD 3AZHD 3AZMC 5B40B 1U35D 3AZJA 2AROD 4YS3A 3KXBA 4WV4B 5AV5D 3AFAB 3X1TB 3REIB 5GT3C 4KUDC 2Y2NA 3LZ1C 4J8UA 5B40D 5JRGB 1P3LC 2XD1A 3X1TD 3AFAD 1P3BB 2F8NH 3REID 5B24B 3AZGA 3WKJA 5BNXA 1HQ3A 5JRGD 2L5AA 4KHAA 1P3BD 1ZLAA 3W99C 5GXQC 5B24D 4J8WA 5GT3B 2FJ7C 4KUDB 4LD9A 1R4VA 3B6FC 1WWSA 3LZ1B 3MGSC 1P3LB 3X1VA 2G5IC 3VH6W 3FDDA 2Y2OA 5GT3D 4KUDD 3UT9C 3LZ1D 1P3LD 2DQNC 4J8VA 5B31G 3UTAA 2YFVA 2F8NK 5GXQB 4XUJA 4JJNA 3MNNB 2FJ7B 3B6FB 3MGQC 1A7WA 5AV8B 5B0ZC 3LELA 5CP6A 5GXQD 5AVCA 5FUGB 3MNND 2FJ7D 3RELB 1P3OA 3UT9B 3B6FD 3WTPC 1H3OB 4J8XA 3KFUG 3AL0C 3UTBC 3EPLA 5AV8D 2YFWB 2HUEC 3RELD 2Y2KA 3MGRC 4ZUXB 2Y2JA 3UT9D 3REHA 1M18A 3LJAB 2Y2QA 3R45B 5DNMC 3MGQB 2BYMB 4R8PA 5B33A 3A1IA 5B1LA 3X1UA 3LJAD 3B0CW 3WTPB 3O62C 2NZDC 4CSRA 2F8NA 3MGQD 3UTBB 4WU9B 5KDMA 2CWEA 1S32A 2HUEB 4NE3A 2F8NG 3MVDA 3MGRB 5AVBC 3WTPD 4WU9D 3UTBD 1M1AA 5DNMB 1P3PB 1TZYC 5B32A 4EO5C 5B0YA 1BH8B 3MGRD 3VH5W 4H9PB 3O62B 4G92C 2NZDB 5B2JA 5AV6B 5DNMD 1P3PD 5AV9C 3AZFA 3WA9A 1AOIA 1P3AC 5DNNB 3B0DB 5AVBB 3O62D 2NZDD 5AV6D 1F1EA 4NE5A 4Z5TA 1TZYB 5B31C 4WU8A 2HIOA 4EO5B 3B6GA 5BS7C 4Z66A 5DNND 2PYOC 5AVBD 3X1SC 2JSSA 3AZIC 5BO0B 2VQRA 4XZQC 1TZYD 4WNNA 5AV9B 1P3KC 3KWQC 1P3AB 1Z2CB 2Y2LA 4UPKA 1P3GA 5BNVB 3H0RC 3WAAC 1EQZC 5AV9D 5B31B 1P3OC 5AV8A 4UUZB 2PYOB 1P3AD 5JA4B 5B1MB 1P3IA 4H9SC 3X1SB 1P3FC 3MGPA 3AZIB 3RELA 4XZQB 4H9RB 4H9QB 3C1CB 5B31D 3W97A 5B2IC 1P3KB 2PYOD 3W96C 5B1MD 3KWQB 3X1SD 3AZID 3A6NA 4KGCA 4XZQD 4ZUXA 3WAAB 3V9RA 1EQZB 3LJAA 3C1CD 1F66C 3EPKA 1P3KD 5BT1C 3KWQD 4QLCA 2Y2HA 3AN2A 1M19C 2IO5C 3EPHA 1HTAA 1B6WA 3WAAD 1EQZD 4H9OA 5AY8A 3KUYB 3H0MC 3AV1A 1P34C 3W96B 4G91C 5E5AC 5F99A 5GT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 A;  1F66 B;  3KUY D;  3AZK A;  3AZM B;  1P3P A;  3W96 D;  1TAF B;  2NQB C;  2IO5 B;  5CHL B;  1F66 D;  3AZM D;  1P34 B;  3AZE C;  4G91 B;  5E5A B;  1M19 D;  5CPK A;  4WU8 C;  1JFI B;  2HIO C;  3NQJ B;  3AZN C;  3AYW A;  1P34 D;  4M6B A;  1N1J A;  5E5A D;  4H9N B;  5GSU A;  3W99 B;  3AV2 A;  3AZL C;  3MGS B;  1BH9 B;  1KX3 A;  3NQU A;  3AZE B;  3W99 D;  1KX4 A;  3REJ C;  4YM6 A;  3LZ0 C;  3AZN B;  4X23 A;  3MGS D;  3REK A;  3TU4 A;  3W98 A;  3MGP C;  5CPJ A;  3AZE D;  1P3M A;  2BYK B;  2RVQ C;  3W97 C;  3AZN D;  3AZL B;  1KX5 A;  3C1C A;  3C1B A;  3AZH A;  5B0Z B;  5CPI C;  1U35 A;  1ID3 C;  2ARO A;  3REJ B;  3LZ0 B;  3AZJ C;  5AV5 A;  1B67 A;  3AZL D;  4YS3 C;  3KXB C;  5B0Z D;  5B40 A;  3REJ D;  4J8U C;  3VH6 A;  3LZ0 D;  3AFA A;  3X1T A;  4HGA C;  3REI A;  4CAY B;  4DRA A;  3AZG C;  5JRG A;  5GT0 C;  3KUY A;  3WKJ C;  1HQ3 C;  1ID3 B;  2CV5 C;  1P3B A;  5B32 G;  5B24 A;  4YS3 B;  1ZLA C;  3KXB B;  4J8W C;  1Q9C A;  4LD9 C;  1ID3 D;  4J8U B;  3X1V C;  4YS3 D;  5GT3 A;  3KXB D;  4KUD A;  3LZ1 A;  3AZG B;  1P3L A;  2LY8 A;  3WKJ B;  5BNX B;  1HQ3 B;  4J8U D;  4J8V C;  3UTA C;  4G92 B;  5GSU C;  4KHA B;  1ZLA B;  4XUJ C;  3AZG D;  4J8W B;  4JJN C;  3WKJ D;  1HQ3 D;  4LD9 B;  5GXQ A;  1KX3 C;  3X1V B;  3LEL C;  5CP6 C;  3MNN A;  1ZLA D;  2FJ7 A;  5AVC C;  4DRB A;  4J8W D;  3B6F A;  3MGS A;  4LD9 D;  4YM6 C;  3TU4 C;  4J8X C;  3UTA B;  5FUG A;  3X1V D;  3UT9 A;  4XUJ B;  1H3O A;  4JJN B;  3REH C;  2YFW A;  3B0B A;  1M18 C;  4E45 A;  4J8V D;  3C1B C;  3UTA D;  5CP6 B;  1U35 C;  4R8P C;  3VH5 A;  4XUJ D;  5AVC B;  4JJN D;  5B33 C;  3R45 A;  5B1L C;  3X1U C;  3MGQ A;  1P3O B;  5B0Z A;  2BYM A;  1P3F B;  5B40 C;  5CP6 D;  1S32 C;  5AVC D;  3WTP A;  3MVD C;  3UTB A;  4WU9 A;  1P3O D;  3REH B;  1M18 B;  5B2I B;  1M1A C;  1P3F D;  5B32 C;  3MGR A;  4R8P B;  5B33 B;  5B0Y C;  5B1L B;  5DNM A;  3X1U B;  3REH D;  5B2I D;  1M18 D;  5B2J C;  4CSR B;  2F8N B;  1M19 B;  1BH8 A;  5KDM B;  1S32 B;  3AZF C;  4H9P A;  4R8P D;  5B33 D;  3WA9 C;  3O62 A;  1AOI C;  2NZD A;  5AV6 A;  5B1L D;  3MVD B;  3X1U D;  4NFT A;  5BT1 D;  2F8N D;  1M1A B;  4Z5T C;  1S32 D;  5DNN A;  5B32 B;  5AVB A;  3B6G C;  5B0Y B;  4Z66 C;  3MVD D;  1TZY A;  3KSY A;  5B2J B;  1M1A D;  2NQB B;  5B32 D;  4WZS B;  3AZF B;  3WA9 B;  5B0Y D;  5BO0 A;  4ZBJ C;  1AOI B;  1P3G C;  5B2J D;  5AV9 A;  3MNN C;  4Z5T B;  2NQB D;  4WU8 B;  1P3A A;  3AZF D;  2HIO B;  3WA9 D;  5AV8 C;  1AOI D;  5BNV A;  3B6G B;  4NE6 A;  4Z66 B;  1P3I C;  4E44 A;  5B31 A;  3REL C;  4Z5T D;  4UUZ A;  4WNN B;  4Z2M H;  5BS7 A;  5JA4 A;  5B1M A;  2HIO D;  4WU8 D;  2PYO A;  3X1S A;  3B6G D;  3AZI A;  4ZBJ B;  4Z66 D;  4XZQ A;  4H9R A;  5G49 B;  4H9Q A;  3A6N C;  1P3G B;  4KGC C;  4ZUX C;  3LJA C;  1P3K A;  3KWQ A;  1ULY A;  3AN2 C;  4QLC C;  3WAA A;  1P3I B;  1EQZ A;  1P3G D;  3MGP B;  5AY8 C;  4WU9 C;  4H9S A;  3AV1 C;  3W97 B;  1P3F A;  1P3I D;  5F99 C;  3MGP D;  3A6N B;  4KGC B;  5CPI B;  2RVQ D;  3V9R B;  5B2I A;  3W96 A;  3AZK C;  1P3P C;  3W97 D;  3AZJ B;  3AN2 B;  4QLC B;  3A6N D;  1F66 A;  3VH6 T;  3AZM A;  4ZUX D;  4KGC D;  5CPI D;  5AV6 C;  4H9O B;  5AY8 B;  4AWL C;  1TAF A;  3AZJ D;  3AV1 B;  1M19 A;  4HGA B;  3AN2 D;  4QLC D;  1BFM A;  5F99 B;  5CPK C;  5DNN C;  3B0D C;  5GT0 B;  1P34 A;  3AYW C;  5AY8 D;  2CV5 B;  1KU5 A;  5E5A A;  3AZK B;  3AV1 D;  1JFI A;  3NQJ A;  5F99 D;  3AV2 C;  5GT0 D;  2CV5 D;  4AWL B;  3AZK D;  4H9N A;  2NQB A;  3W99 A;  5CPK B;  1KX4 C;  1BH9 A;  3AYW B;  5C3I C;  4X23 C;  3REK C;  3AZE A;  3W98 C;  4Z2M G;  4J8V B;  5CPJ C;  1P3M C;  1N1J B;  5GSU B;  3AZN A;  5CPK D;  2YFV B;  3AV2 B;  5B1M C;  3AYW D;  2BYK A;  1KX5 C;  3C1C C;  3B0C T;  3AZH C;  1KX3 B;  5GSU D;  3NQU B;  3LEL B;  1KX4 B;  3AZL A;  2ARO C;  3AV2 D;  5G49 A;  4YM6 B;  5AV5 C;  5C3I B;  4X23 B;  3REK B;  3TU4 B;  4J8X B;  3W98 B;  1KX3 D;  3REJ A;  5CPJ B;  3LEL D;  1P3M B;  3LZ0 A;  1KX4 D;  3WTP E;  4YM6 D;  3AFA C;  3X1T C;  3REI C;  4X23 D;  3W98 D;  3REK D;  3TU4 D;  4J8X D;  1KX5 B;  3VH5 T;  3C1B B;  5CPJ D;  3AZH B;  5JRG C;  3KUY C;  1P3M D;  1U35 B;  1WWI A;  2ARO B;  4CAY A;  1P3B C;  5B24 C;  5AV5 B;  5CPI A;  1KX5 D;  1ID3 A;  3C1B D;  3AZH D;  3AZM C;  5B40 B;  1U35 D;  3AZJ A;  2ARO D;  4YS3 A;  3KXB A;  4WV4 B;  5AV5 D;  3AFA B;  3X1T B;  3REI B;  5GT3 C;  4KUD C;  3LZ1 C;  4J8U A;  5B40 D;  5JRG B;  1P3L C;  3X1T D;  3AFA D;  1P3B B;  2F8N H;  3REI D;  5B24 B;  3AZG A;  3WKJ A;  5BNX A;  1HQ3 A;  5JRG D;  2L5A A;  4KHA A;  1P3B D;  1ZLA A;  3W99 C;  5GXQ C;  5B24 D;  4J8W A;  5GT3 B;  2FJ7 C;  4KUD B;  4LD9 A;  1R4V A;  3B6F C;  1WWS A;  3LZ1 B;  3MGS C;  1P3L B;  3X1V A;  3VH6 W;  5GT3 D;  4KUD D;  3UT9 C;  3LZ1 D;  1P3L D;  4J8V A;  5B31 G;  3UTA A;  2YFV A;  2F8N K;  5GXQ B;  4XUJ A;  4JJN A;  3MNN B;  2FJ7 B;  3B6F B;  3MGQ C;  1A7W A;  5AV8 B;  5B0Z C;  3LEL A;  5CP6 A;  5GXQ D;  5AVC A;  5FUG B;  3MNN D;  2FJ7 D;  3REL B;  1P3O A;  3UT9 B;  3B6F D;  3WTP C;  1H3O B;  4J8X A;  3UTB C;  5AV8 D;  2YFW B;  2HUE C;  3REL D;  3MGR C;  4ZUX B;  3UT9 D;  3REH A;  1M18 A;  3LJA B;  3R45 B;  5DNM C;  3MGQ B;  2BYM B;  4R8P A;  5B33 A;  5B1L A;  3X1U A;  3LJA D;  3B0C W;  3WTP B;  3O62 C;  2NZD C;  4CSR A;  2F8N A;  3MGQ D;  3UTB B;  4WU9 B;  5KDM A;  2CWE A;  1S32 A;  2HUE B;  4NE3 A;  2F8N G;  3MVD A;  3MGR B;  5AVB C;  3WTP D;  4WU9 D;  3UTB D;  1M1A A;  5DNM B;  1P3P B;  1TZY C;  5B32 A;  4EO5 C;  5B0Y A;  1BH8 B;  3MGR D;  3VH5 W;  4H9P B;  3O62 B;  4G92 C;  2NZD B;  5B2J A;  5AV6 B;  5DNM D;  1P3P D;  5AV9 C;  3AZF A;  3WA9 A;  1AOI A;  1P3A C;  5DNN B;  3B0D B;  5AVB B;  3O62 D;  2NZD D;  5AV6 D;  1F1E A;  4NE5 A;  4Z5T A;  1TZY B;  5B31 C;  4WU8 A;  2HIO A;  4EO5 B;  3B6G A;  5BS7 C;  4Z66 A;  5DNN D;  2PYO C;  5AVB D;  3X1S C;  2JSS A;  3AZI C;  5BO0 B;  4XZQ C;  1TZY D;  4WNN A;  5AV9 B;  1P3K C;  3KWQ C;  1P3A B;  1P3G A;  5BNV B;  3WAA C;  1EQZ C;  5AV9 D;  5B31 B;  1P3O C;  5AV8 A;  4UUZ B;  2PYO B;  1P3A D;  5JA4 B;  5B1M B;  1P3I A;  4H9S C;  3X1S B;  1P3F C;  3MGP A;  3AZI B;  3REL A;  4XZQ B;  4H9R B;  4H9Q B;  3C1C B;  5B31 D;  3W97 A;  5B2I C;  1P3K B;  2PYO D;  3W96 C;  5B1M D;  3KWQ B;  3X1S D;  3AZI D;  3A6N A;  4KGC A;  4XZQ D;  4ZUX A;  3WAA B;  3V9R A;  1EQZ B;  3LJA A;  3C1C D;  1F66 C;  1P3K D;  5BT1 C;  3KWQ D;  4QLC A;  3AN2 A;  1M19 C;  2IO5 C;  1HTA A;  1B6W A;  3WAA D;  1EQZ D;  4H9O A;  5AY8 A;  3KUY B;  3AV1 A;  1P34 C;  3W96 B;  4G91 C;  5E5A C;  5F99 A;  5GT0 A; 
#chains in the Genus database with same CATH topology
 2CV5 A;  1F66 B;  3KUY D;  3AZK A;  3AZM B;  1P3P A;  3W96 D;  2Y2M A;  3EPJ A;  1TAF B;  2NQB C;  2IO5 B;  2G5H C;  5CHL B;  1F66 D;  3AZM D;  1P34 B;  3AZE C;  4G91 B;  5E5A B;  1M19 D;  5CPK A;  4WU8 C;  1JFI B;  2HIO C;  3NQJ B;  3AZN C;  3AYW A;  1P34 D;  4M6B A;  1N1J A;  5E5A D;  4H9N B;  5GSU A;  3W99 B;  3AV2 A;  2ZM5 A;  3AZL C;  3MGS B;  1BH9 B;  1KX3 A;  3NQU A;  3AZE B;  3EG5 B;  3W99 D;  1KX4 A;  3REJ C;  4YM6 A;  3LZ0 C;  2FFF B;  3AZN B;  4X23 A;  3MGS D;  3REK A;  3TU4 A;  3W98 A;  3MGP C;  1T3U A;  5CPJ A;  3AZE D;  1P3M A;  2BYK B;  2RVQ C;  3W97 C;  3AZN D;  3AZL B;  1KX5 A;  3C1C A;  3C1B A;  3AZH A;  5B0Z B;  5CPI C;  1U35 A;  1ID3 C;  2ARO A;  3REJ B;  3LZ0 B;  3AZJ C;  5AV5 A;  1B67 A;  3AZL D;  2Y2P A;  4YS3 C;  3KXB C;  5B0Z D;  5B40 A;  3REJ D;  4J8U C;  3VH6 A;  3LZ0 D;  3AFA A;  3X1T A;  4HGA C;  3REI A;  4CAY B;  4DRA A;  3AZG C;  5JRG A;  5GT0 C;  3KUY A;  3WKJ C;  1HQ3 C;  1ID3 B;  2CV5 C;  1P3B A;  5B32 G;  5B24 A;  4YS3 B;  1ZLA C;  3KXB B;  4J8W C;  1Q9C A;  4LD9 C;  1ID3 D;  4J8U B;  3X1V C;  4YS3 D;  5GT3 A;  3KXB D;  4KUD A;  1W2E A;  3LZ1 A;  3AZG B;  1P3L A;  2LY8 A;  3WKJ B;  5BNX B;  1HQ3 B;  4J8U D;  4J8V C;  3UTA C;  4WJ3 C;  4G92 B;  5GSU C;  4KHA B;  1ZLA B;  4XUJ C;  3AZG D;  4J8W B;  4JJN C;  3WKJ D;  2ZY3 A;  1HQ3 D;  4LD9 B;  5GXQ A;  1KX3 C;  3X1V B;  3P5J B;  5CP6 C;  3MNN A;  3IP4 C;  3LEL C;  1ZLA D;  2FJ7 A;  5AVC C;  4DRB A;  4J8W D;  3B6F A;  3MGS A;  4LD9 D;  4YM6 C;  3TU4 C;  4J8X C;  3UTA B;  5FUG A;  3X1V D;  3UT9 A;  4XUJ B;  1H3O A;  4JJN B;  3REH C;  2YFW A;  3B0B A;  1M18 C;  2RIQ A;  4E45 A;  4J8V D;  3C1B C;  3UTA D;  5CP6 B;  1U35 C;  4R8P C;  3VH5 A;  4XUJ D;  5AVC B;  4JJN D;  5B33 C;  3R45 A;  5B1L C;  3X1U C;  3MGQ A;  1P3O B;  5B0Z A;  2BYM A;  1P3F B;  5B40 C;  5CP6 D;  1S32 C;  5AVC D;  3WTP A;  3MVD C;  3UTB A;  4WU9 A;  1P3O D;  3REH B;  1M18 B;  5B2I B;  1M1A C;  1P3F D;  5B32 C;  3MGR A;  4R8P B;  5B33 B;  5B0Y C;  3A1K A;  5B1L B;  5DNM A;  3X1U B;  3REH D;  5B2I D;  1M18 D;  5B2J C;  4CSR B;  2F8N B;  1M19 B;  1BH8 A;  5KDM B;  1S32 B;  3H0L C;  3AZF C;  4H9P A;  4R8P D;  5B33 D;  3WA9 C;  3O62 A;  1AOI C;  2NZD A;  5AV6 A;  5B1L D;  3MVD B;  3X1U D;  4NFT A;  5BT1 D;  2F8N D;  1M1A B;  4Z5T C;  1S32 D;  5DNN A;  5B32 B;  2ZY2 A;  5AVB A;  3B6G C;  5B0Y B;  4Z66 C;  3MVD D;  1TZY A;  3KSY A;  5B2J B;  1M1A D;  2NQB B;  5B32 D;  4WZS B;  3AZF B;  3WA9 B;  5B0Y D;  5BO0 A;  4ZBJ C;  1AOI B;  2JE5 A;  1P3G C;  5B2J D;  5AV9 A;  3MNN C;  4Z5T B;  2NQB D;  4WU8 B;  1P3A A;  3AZF D;  2HIO B;  3WA9 D;  5AV8 C;  1AOI D;  5BNV A;  3B6G B;  4NE6 A;  4Z66 B;  1P3I C;  4E44 A;  5B31 A;  3REL C;  2Y2G A;  4UUZ A;  4WNN B;  4Z5T D;  4Z2M H;  5BS7 A;  5JA4 A;  5B1M A;  2HIO D;  4WU8 D;  2PYO A;  3X1S A;  3B6G D;  3AZI A;  4ZBJ B;  4Z66 D;  4XZQ A;  4H9R A;  5G49 B;  4H9Q A;  3A6N C;  1P3G B;  4KGC C;  4ZUX C;  3LJA C;  1P3K A;  2JCH A;  3KWQ A;  1ULY A;  3AN2 C;  4QLC C;  3WAA A;  1P3I B;  1EQZ A;  1P3G D;  3MGP B;  2J8P A;  5AY8 C;  4WU9 C;  2F2A C;  4H9S A;  3AV1 C;  3W97 B;  1P3F A;  1P3I D;  5F99 C;  3MGP D;  3A6N B;  4KGC B;  5CPI B;  2RVQ D;  3V9R B;  5B2I A;  3W96 A;  3AZK C;  1P3P C;  3W97 D;  3AZJ B;  3AN2 B;  4QLC B;  3A6N D;  1F66 A;  3VH6 T;  3AZM A;  4ZUX D;  4KGC D;  5CPI D;  5AV6 C;  4H9O B;  5AY8 B;  4AWL C;  4DQY B;  1TAF A;  3AZJ D;  3AV1 B;  1M19 A;  4HGA B;  3AN2 D;  4QLC D;  1BFM A;  2UWX A;  5F99 B;  5CPK C;  5DNN C;  2XD5 A;  3B0D C;  5GT0 B;  1P34 A;  3AYW C;  5AY8 D;  2CV5 B;  1KU5 A;  5E5A A;  3AZK B;  3AV1 D;  1JFI A;  3NQJ A;  5F99 D;  3AV2 C;  5GT0 D;  2CV5 D;  2ZY5 A;  4AWL B;  3AZK D;  4H9N A;  2NQB A;  3W99 A;  5CPK B;  1KX4 C;  1BH9 A;  3AYW B;  5C3I C;  4X23 C;  3REK C;  3AZE A;  3W98 C;  4Z2M G;  4J8V B;  5CPJ C;  1P3M C;  1N1J B;  5GSU B;  3AZN A;  5CPK D;  2YFV B;  3AV2 B;  5B1M C;  3AYW D;  2BYK A;  1KX5 C;  2W8S A;  3C1C C;  3B0C T;  3AZH C;  1KX3 B;  5GSU D;  3NQU B;  3LEL B;  1KX4 B;  3AZL A;  2ARO C;  2Y2I A;  3AV2 D;  5G49 A;  4YM6 B;  5AV5 C;  5C3I B;  4X23 B;  3REK B;  3TU4 B;  4J8X B;  3W98 B;  1KX3 D;  3REJ A;  5CPJ B;  3LEL D;  1P3M B;  3LZ0 A;  1KX4 D;  1PZR A;  3WTP E;  2DF4 C;  4YM6 D;  3AFA C;  3X1T C;  3F6T A;  3REI C;  4X23 D;  3W98 D;  3REK D;  3TU4 D;  4J8X D;  1KX5 B;  3VH5 T;  3C1B B;  5CPJ D;  3AZH B;  5JRG C;  3KUY C;  1P3M D;  1U35 B;  1WWI A;  2ARO B;  4CAY A;  1P3B C;  5B24 C;  5AV5 B;  5CPI A;  1KX5 D;  2BG1 A;  2ZY4 A;  1ID3 A;  3C1B D;  3AZH D;  3AZM C;  5B40 B;  1U35 D;  3AZJ A;  2ARO D;  4YS3 A;  3KXB A;  4WV4 B;  5AV5 D;  3AFA B;  3X1T B;  3REI B;  5GT3 C;  4KUD C;  2Y2N A;  3LZ1 C;  4J8U A;  5B40 D;  5JRG B;  1P3L C;  2XD1 A;  3X1T D;  3AFA D;  1P3B B;  2F8N H;  3REI D;  5B24 B;  3AZG A;  3WKJ A;  5BNX A;  1HQ3 A;  5JRG D;  2L5A A;  4KHA A;  1P3B D;  1ZLA A;  3W99 C;  5GXQ C;  5B24 D;  4J8W A;  5GT3 B;  2FJ7 C;  4KUD B;  4LD9 A;  1R4V A;  3B6F C;  1WWS A;  3LZ1 B;  3MGS C;  1P3L B;  3X1V A;  2G5I C;  3VH6 W;  3FDD A;  2Y2O A;  5GT3 D;  4KUD D;  3UT9 C;  3LZ1 D;  1P3L D;  2DQN C;  4J8V A;  5B31 G;  3UTA A;  2YFV A;  2F8N K;  5GXQ B;  4XUJ A;  4JJN A;  3MNN B;  2FJ7 B;  3B6F B;  3MGQ C;  1A7W A;  5AV8 B;  5B0Z C;  3LEL A;  5CP6 A;  5GXQ D;  5AVC A;  5FUG B;  3MNN D;  2FJ7 D;  3REL B;  1P3O A;  3UT9 B;  3B6F D;  3WTP C;  1H3O B;  4J8X A;  3KFU G;  3AL0 C;  3UTB C;  3EPL A;  5AV8 D;  2YFW B;  2HUE C;  3REL D;  2Y2K A;  3MGR C;  4ZUX B;  2Y2J A;  3UT9 D;  3REH A;  1M18 A;  3LJA B;  2Y2Q A;  3R45 B;  5DNM C;  3MGQ B;  2BYM B;  4R8P A;  5B33 A;  3A1I A;  5B1L A;  3X1U A;  3LJA D;  3B0C W;  3WTP B;  3O62 C;  2NZD C;  4CSR A;  2F8N A;  3MGQ D;  3UTB B;  4WU9 B;  5KDM A;  2CWE A;  1S32 A;  2HUE B;  4NE3 A;  2F8N G;  3MVD A;  3MGR B;  5AVB C;  3WTP D;  4WU9 D;  3UTB D;  1M1A A;  5DNM B;  1P3P B;  1TZY C;  5B32 A;  4EO5 C;  5B0Y A;  1BH8 B;  3MGR D;  3VH5 W;  4H9P B;  3O62 B;  4G92 C;  2NZD B;  5B2J A;  5AV6 B;  5DNM D;  1P3P D;  5AV9 C;  3AZF A;  3WA9 A;  1AOI A;  1P3A C;  5DNN B;  3B0D B;  5AVB B;  3O62 D;  2NZD D;  5AV6 D;  1F1E A;  4NE5 A;  4Z5T A;  1TZY B;  5B31 C;  4WU8 A;  2HIO A;  4EO5 B;  3B6G A;  5BS7 C;  4Z66 A;  5DNN D;  2PYO C;  5AVB D;  3X1S C;  2JSS A;  3AZI C;  5BO0 B;  2VQR A;  4XZQ C;  1TZY D;  4WNN A;  5AV9 B;  1P3K C;  3KWQ C;  1P3A B;  1Z2C B;  2Y2L A;  4UPK A;  1P3G A;  5BNV B;  3H0R C;  3WAA C;  1EQZ C;  5AV9 D;  5B31 B;  1P3O C;  5AV8 A;  4UUZ B;  2PYO B;  1P3A D;  5JA4 B;  5B1M B;  1P3I A;  4H9S C;  3X1S B;  1P3F C;  3MGP A;  3AZI B;  3REL A;  4XZQ B;  4H9R B;  4H9Q B;  3C1C B;  5B31 D;  3W97 A;  5B2I C;  1P3K B;  2PYO D;  3W96 C;  5B1M D;  3KWQ B;  3X1S D;  3AZI D;  3A6N A;  4KGC A;  4XZQ D;  4ZUX A;  3WAA B;  3V9R A;  1EQZ B;  3LJA A;  3C1C D;  1F66 C;  3EPK A;  1P3K D;  5BT1 C;  3KWQ D;  4QLC A;  2Y2H A;  3AN2 A;  1M19 C;  2IO5 C;  3EPH A;  1HTA A;  1B6W A;  3WAA D;  1EQZ D;  4H9O A;  5AY8 A;  3KUY B;  3H0M C;  3AV1 A;  1P34 C;  3W96 B;  4G91 C;  5E5A C;  5F99 A;  5GT0 A; 
#chains in the Genus database with same CATH homology
 2CV5 A;  1F66 B;  3KUY D;  3AZK A;  3AZM B;  1P3P A;  3W96 D;  2Y2M A;  3EPJ A;  1TAF B;  2NQB C;  2IO5 B;  2G5H C;  5CHL B;  1F66 D;  3AZM D;  1P34 B;  3AZE C;  4G91 B;  5E5A B;  1M19 D;  5CPK A;  4WU8 C;  1JFI B;  2HIO C;  3NQJ B;  3AZN C;  3AYW A;  1P34 D;  4M6B A;  1N1J A;  5E5A D;  4H9N B;  5GSU A;  3W99 B;  3AV2 A;  2ZM5 A;  3AZL C;  3MGS B;  1BH9 B;  1KX3 A;  3NQU A;  3AZE B;  3EG5 B;  3W99 D;  1KX4 A;  3REJ C;  4YM6 A;  3LZ0 C;  2FFF B;  3AZN B;  4X23 A;  3MGS D;  3REK A;  3TU4 A;  3W98 A;  3MGP C;  1T3U A;  5CPJ A;  3AZE D;  1P3M A;  2BYK B;  2RVQ C;  3W97 C;  3AZN D;  3AZL B;  1KX5 A;  3C1C A;  3C1B A;  3AZH A;  5B0Z B;  5CPI C;  1U35 A;  1ID3 C;  2ARO A;  3REJ B;  3LZ0 B;  3AZJ C;  5AV5 A;  1B67 A;  3AZL D;  2Y2P A;  4YS3 C;  3KXB C;  5B0Z D;  5B40 A;  3REJ D;  4J8U C;  3VH6 A;  3LZ0 D;  3AFA A;  3X1T A;  4HGA C;  3REI A;  4CAY B;  4DRA A;  3AZG C;  5JRG A;  5GT0 C;  3KUY A;  3WKJ C;  1HQ3 C;  1ID3 B;  2CV5 C;  1P3B A;  5B32 G;  5B24 A;  4YS3 B;  1ZLA C;  3KXB B;  4J8W C;  1Q9C A;  4LD9 C;  1ID3 D;  4J8U B;  3X1V C;  4YS3 D;  5GT3 A;  3KXB D;  4KUD A;  1W2E A;  3LZ1 A;  3AZG B;  1P3L A;  2LY8 A;  3WKJ B;  5BNX B;  1HQ3 B;  4J8U D;  4J8V C;  3UTA C;  4WJ3 C;  4G92 B;  5GSU C;  4KHA B;  1ZLA B;  4XUJ C;  3AZG D;  4J8W B;  4JJN C;  3WKJ D;  2ZY3 A;  1HQ3 D;  4LD9 B;  5GXQ A;  1KX3 C;  3X1V B;  3P5J B;  5CP6 C;  3MNN A;  3IP4 C;  3LEL C;  1ZLA D;  2FJ7 A;  5AVC C;  4DRB A;  4J8W D;  3B6F A;  3MGS A;  4LD9 D;  4YM6 C;  3TU4 C;  4J8X C;  3UTA B;  5FUG A;  3X1V D;  3UT9 A;  4XUJ B;  1H3O A;  4JJN B;  3REH C;  2YFW A;  3B0B A;  1M18 C;  2RIQ A;  4E45 A;  4J8V D;  3C1B C;  3UTA D;  5CP6 B;  1U35 C;  4R8P C;  3VH5 A;  4XUJ D;  5AVC B;  4JJN D;  5B33 C;  3R45 A;  5B1L C;  3X1U C;  3MGQ A;  1P3O B;  5B0Z A;  2BYM A;  1P3F B;  5B40 C;  5CP6 D;  1S32 C;  5AVC D;  3WTP A;  3MVD C;  3UTB A;  4WU9 A;  1P3O D;  3REH B;  1M18 B;  5B2I B;  1M1A C;  1P3F D;  5B32 C;  3MGR A;  4R8P B;  5B33 B;  5B0Y C;  3A1K A;  5B1L B;  5DNM A;  3X1U B;  3REH D;  5B2I D;  1M18 D;  5B2J C;  4CSR B;  2F8N B;  1M19 B;  1BH8 A;  5KDM B;  1S32 B;  3H0L C;  3AZF C;  4H9P A;  4R8P D;  5B33 D;  3WA9 C;  3O62 A;  1AOI C;  2NZD A;  5AV6 A;  5B1L D;  3MVD B;  3X1U D;  4NFT A;  5BT1 D;  2F8N D;  1M1A B;  4Z5T C;  1S32 D;  5DNN A;  5B32 B;  2ZY2 A;  5AVB A;  3B6G C;  5B0Y B;  4Z66 C;  3MVD D;  1TZY A;  3KSY A;  5B2J B;  1M1A D;  2NQB B;  5B32 D;  4WZS B;  3AZF B;  3WA9 B;  5B0Y D;  5BO0 A;  4ZBJ C;  1AOI B;  2JE5 A;  1P3G C;  5B2J D;  5AV9 A;  3MNN C;  4Z5T B;  2NQB D;  4WU8 B;  1P3A A;  3AZF D;  2HIO B;  3WA9 D;  5AV8 C;  1AOI D;  5BNV A;  3B6G B;  4NE6 A;  4Z66 B;  1P3I C;  4E44 A;  5B31 A;  3REL C;  2Y2G A;  4UUZ A;  4WNN B;  4Z5T D;  4Z2M H;  5BS7 A;  5JA4 A;  5B1M A;  2HIO D;  4WU8 D;  2PYO A;  3X1S A;  3B6G D;  3AZI A;  4ZBJ B;  4Z66 D;  4XZQ A;  4H9R A;  5G49 B;  4H9Q A;  3A6N C;  1P3G B;  4KGC C;  4ZUX C;  3LJA C;  1P3K A;  2JCH A;  3KWQ A;  1ULY A;  3AN2 C;  4QLC C;  3WAA A;  1P3I B;  1EQZ A;  1P3G D;  3MGP B;  2J8P A;  5AY8 C;  4WU9 C;  2F2A C;  4H9S A;  3AV1 C;  3W97 B;  1P3F A;  1P3I D;  5F99 C;  3MGP D;  3A6N B;  4KGC B;  5CPI B;  2RVQ D;  3V9R B;  5B2I A;  3W96 A;  3AZK C;  1P3P C;  3W97 D;  3AZJ B;  3AN2 B;  4QLC B;  3A6N D;  1F66 A;  3VH6 T;  3AZM A;  4ZUX D;  4KGC D;  5CPI D;  5AV6 C;  4H9O B;  5AY8 B;  4AWL C;  4DQY B;  1TAF A;  3AZJ D;  3AV1 B;  1M19 A;  4HGA B;  3AN2 D;  4QLC D;  1BFM A;  2UWX A;  5F99 B;  5CPK C;  5DNN C;  2XD5 A;  3B0D C;  5GT0 B;  1P34 A;  3AYW C;  5AY8 D;  2CV5 B;  1KU5 A;  5E5A A;  3AZK B;  3AV1 D;  1JFI A;  3NQJ A;  5F99 D;  3AV2 C;  5GT0 D;  2CV5 D;  2ZY5 A;  4AWL B;  3AZK D;  4H9N A;  2NQB A;  3W99 A;  5CPK B;  1KX4 C;  1BH9 A;  3AYW B;  5C3I C;  4X23 C;  3REK C;  3AZE A;  3W98 C;  4Z2M G;  4J8V B;  5CPJ C;  1P3M C;  1N1J B;  5GSU B;  3AZN A;  5CPK D;  2YFV B;  3AV2 B;  5B1M C;  3AYW D;  2BYK A;  1KX5 C;  2W8S A;  3C1C C;  3B0C T;  3AZH C;  1KX3 B;  5GSU D;  3NQU B;  3LEL B;  1KX4 B;  3AZL A;  2ARO C;  2Y2I A;  3AV2 D;  5G49 A;  4YM6 B;  5AV5 C;  5C3I B;  4X23 B;  3REK B;  3TU4 B;  4J8X B;  3W98 B;  1KX3 D;  3REJ A;  5CPJ B;  3LEL D;  1P3M B;  3LZ0 A;  1KX4 D;  1PZR A;  3WTP E;  2DF4 C;  4YM6 D;  3AFA C;  3X1T C;  3F6T A;  3REI C;  4X23 D;  3W98 D;  3REK D;  3TU4 D;  4J8X D;  1KX5 B;  3VH5 T;  3C1B B;  5CPJ D;  3AZH B;  5JRG C;  3KUY C;  1P3M D;  1U35 B;  1WWI A;  2ARO B;  4CAY A;  1P3B C;  5B24 C;  5AV5 B;  5CPI A;  1KX5 D;  2BG1 A;  2ZY4 A;  1ID3 A;  3C1B D;  3AZH D;  3AZM C;  5B40 B;  1U35 D;  3AZJ A;  2ARO D;  4YS3 A;  3KXB A;  4WV4 B;  5AV5 D;  3AFA B;  3X1T B;  3REI B;  5GT3 C;  4KUD C;  2Y2N A;  3LZ1 C;  4J8U A;  5B40 D;  5JRG B;  1P3L C;  2XD1 A;  3X1T D;  3AFA D;  1P3B B;  2F8N H;  3REI D;  5B24 B;  3AZG A;  3WKJ A;  5BNX A;  1HQ3 A;  5JRG D;  2L5A A;  4KHA A;  1P3B D;  1ZLA A;  3W99 C;  5GXQ C;  5B24 D;  4J8W A;  5GT3 B;  2FJ7 C;  4KUD B;  4LD9 A;  1R4V A;  3B6F C;  1WWS A;  3LZ1 B;  3MGS C;  1P3L B;  3X1V A;  2G5I C;  3VH6 W;  3FDD A;  2Y2O A;  5GT3 D;  4KUD D;  3UT9 C;  3LZ1 D;  1P3L D;  2DQN C;  4J8V A;  5B31 G;  3UTA A;  2YFV A;  2F8N K;  5GXQ B;  4XUJ A;  4JJN A;  3MNN B;  2FJ7 B;  3B6F B;  3MGQ C;  1A7W A;  5AV8 B;  5B0Z C;  3LEL A;  5CP6 A;  5GXQ D;  5AVC A;  5FUG B;  3MNN D;  2FJ7 D;  3REL B;  1P3O A;  3UT9 B;  3B6F D;  3WTP C;  1H3O B;  4J8X A;  3KFU G;  3AL0 C;  3UTB C;  3EPL A;  5AV8 D;  2YFW B;  2HUE C;  3REL D;  2Y2K A;  3MGR C;  4ZUX B;  2Y2J A;  3UT9 D;  3REH A;  1M18 A;  3LJA B;  2Y2Q A;  3R45 B;  5DNM C;  3MGQ B;  2BYM B;  4R8P A;  5B33 A;  3A1I A;  5B1L A;  3X1U A;  3LJA D;  3B0C W;  3WTP B;  3O62 C;  2NZD C;  4CSR A;  2F8N A;  3MGQ D;  3UTB B;  4WU9 B;  5KDM A;  2CWE A;  1S32 A;  2HUE B;  4NE3 A;  2F8N G;  3MVD A;  3MGR B;  5AVB C;  3WTP D;  4WU9 D;  3UTB D;  1M1A A;  5DNM B;  1P3P B;  1TZY C;  5B32 A;  4EO5 C;  5B0Y A;  1BH8 B;  3MGR D;  3VH5 W;  4H9P B;  3O62 B;  4G92 C;  2NZD B;  5B2J A;  5AV6 B;  5DNM D;  1P3P D;  5AV9 C;  3AZF A;  3WA9 A;  1AOI A;  1P3A C;  5DNN B;  3B0D B;  5AVB B;  3O62 D;  2NZD D;  5AV6 D;  1F1E A;  4NE5 A;  4Z5T A;  1TZY B;  5B31 C;  4WU8 A;  2HIO A;  4EO5 B;  3B6G A;  5BS7 C;  4Z66 A;  5DNN D;  2PYO C;  5AVB D;  3X1S C;  2JSS A;  3AZI C;  5BO0 B;  2VQR A;  4XZQ C;  1TZY D;  4WNN A;  5AV9 B;  1P3K C;  3KWQ C;  1P3A B;  1Z2C B;  2Y2L A;  4UPK A;  1P3G A;  5BNV B;  3H0R C;  3WAA C;  1EQZ C;  5AV9 D;  5B31 B;  1P3O C;  5AV8 A;  4UUZ B;  2PYO B;  1P3A D;  5JA4 B;  5B1M B;  1P3I A;  4H9S C;  3X1S B;  1P3F C;  3MGP A;  3AZI B;  3REL A;  4XZQ B;  4H9R B;  4H9Q B;  3C1C B;  5B31 D;  3W97 A;  5B2I C;  1P3K B;  2PYO D;  3W96 C;  5B1M D;  3KWQ B;  3X1S D;  3AZI D;  3A6N A;  4KGC A;  4XZQ D;  4ZUX A;  3WAA B;  3V9R A;  1EQZ B;  3LJA A;  3C1C D;  1F66 C;  3EPK A;  1P3K D;  5BT1 C;  3KWQ D;  4QLC A;  2Y2H A;  3AN2 A;  1M19 C;  2IO5 C;  3EPH A;  1HTA A;  1B6W A;  3WAA D;  1EQZ D;  4H9O A;  5AY8 A;  3KUY B;  3H0M C;  3AV1 A;  1P34 C;  3W96 B;  4G91 C;  5E5A C;  5F99 A;  5GT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...