3W99A

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99A00
3KXBB 3AZHB 5DNMB 1S32B 4KHAA 2HIOA 3UTBA 3WKJD 5E5AB 4JJNB 1P3MD 3AZID 5AY8D 3MGSC 3REKB 2PYOB 3AFAB 5BS7C 4WZSB 4CSRA 3VH5A 3R45A 5B2JD 4CAYA 3UTAC 3TU4B 1P3ID 5CHLB 1P3FD 5DNND 3WKJB 3AV1A 1P3MB 5DNMC 1S32C 4UUZB 1M19C 1P34D 4H9PA 3WTPD 5BO0B 5B2JB 5E5AC 3AZGB 3W97D 5AVBB 2JSSA 3C1CD 3X1VA 1P3IB 1HQ3D 4Z5TD 1P3FB 5DNNB 1EQZA 2PYOC 3REIA 5KDMA 1KU5A 5AV6C 5AV5C 1M18B 4R8PD 1P34B 3WTPB 5GSUD 5GXQA 4KGCD 4YM6A 3UT9A 5B40C 3AZLD 1ULYA 3REHD 2F8NK 3W97B 1P3MC 3AZIC 1HQ3B 4Z5TB 5AY8C 3VH5W 5AV9A 5B24D 4ZUXD 4YS3A 2CV5D 1ID3C 1P3OA 5B0ZD 5B2JC 1P3KD 5CPKA 4R8PB 5B32A 4HGAB 5GSUB 1P3IC 1P3FC 3AZHA 1F66D 3AZLB 3REHB 4EO5B 3LZ0C 1TZYD 2FJ7B 5B24B 4ZUXB 3WTPE 4J8UD 3C1BD 2BYKA 2CV5B 3W98A 1P34C 2NZDA 5B0ZB 3LZ1B 1P3KB 2F8NA 1KX3D 4X23A 4XZQD 3C1CC 5B1LA 5JRGC 1HQ3C 1F66B 3WAAA 4WNNB 1TZYB 1AOID 3W96A 1N1JB 5B31G 4J8UB 1P3PA 3X1TA 4DRBA 1KX4C 5CPJD 3C1BB 4J8VB 3RELD 5CP6D 5AV8D 4KGCC 2HUEB 4Z66A 4H9SC 3REHC 1Q9CA 4EO5C 1KX3B 4XZQB 1JFIB 5GT3D 4NE3A 4ZUXC 3AZNB 3AZGA 2CV5C 3MGQB 5AVBA 4Z2MH 3MGSD 4G91B 5B0ZC 1AOIB 1P3KC 4LD9A 1P3BC 5CPJB 3RELB 5F99D 5AV8B 1F66C 4ZBJC 1U35A 1M18A 5GT3B 3X1VD 1TAFB 4J8WA 4J8UC 2LY8A 3MGSB 2HUEC 1P3AD 2BYMB 1KX3C 3KUYD 3AV2D 4XZQC 1M19D 5BNVA 4WU9D 3B6GA 5B2ID 3LJAA 4J8XA 5CPJC 5B1MD 3REJA 5CP6C 4H9NB 5AV8C 2FJ7A 1ZLAD 1P3AB 5B33A 5AV6D 5AV5D 3KUYB 3AZJD 1KX5D 3AV2B 1M19B 2NQBA 5GT3C 3AYWD 5CPIA 4XUJD 3LZ1A 5B40D 2AROA 4KUDA 3B0DC 5B2IB 1M1AD 5FUGB 3B0BA 3B0CT 1P3GA 3AZKA 3A6NA 3O62A 3NQJB 3WA9D 1ID3D 3VH6W 5F99C 3MVDD 2F8ND 2YFWB 3LELD 5AV6B 5AV5B 3AZJB 1KX5B 4QLCD 5G49B 3X1VC 4G92C 5B1LD 3AYWB 4XUJB 1WWSA 5B40B 5B0YA 3X1SD 3LZ0D 3AZIB 3AN2A 1M1AB 3W99A 5AY8B 5GT0A 4H9OA 1P3AC 5AVCA 3KUYC 3WA9B 3AV2C 3MNND 3MGQA 1ID3B 3NQUA 4WU9C 3X1UA 3LELB 3UT9C 5B2IC 3V9RA 4QLCB 1P3LD 5JRGD 4WV4B 5AV9C 4YS3C 3X1SB 5B1MC 3LZ0B 5B31D 4WU8A 1ZLAC 1KX4D 5CPKC 3AZJC 1KX5C 3MNNB 3AYWC 4XUJC 5B32G 1P3LB 1M1AC 3C1CB 5JRGB 1BFMA 5JA4A 3UTAA 3MGPA 3WA9C 3W98C 5B31B 1BH8B 3MVDC 3AZED 2NZDC 3B6FD 1P3BD 3LELC 3KWQA 1KX4B 4X23C 4QLCC 3AZFD 3KXBA 2F8NG 1B6WA 5B1LC 3AZMD 5DNMA 4KGCB 1S32A 5BNXB 4NE5A 3MGRD 3X1SC 1P3PC 5E5AA 4JJNA 3MNNC 3REJD 3REKA 3B6FB 1P3BB 2PYOA 3AFAA 4Z66C 2HIOD 3UTBD 1P3LC 3AZFB 3AZMB 1BH9B 4ZBJB 3MGRB 3TU4A 5B31C 1B67A 3WKJA 1P3MA 5AY8A 4UUZA 4KHAB 4AWLC 3UTBB 2IO5C 5BO0A 5B2JA 3AV1D 1P3IA 1P3FA 1F1EA 3AZEC 5DNNA 3B6FC 4CSRB 3AZFC 5CP6B 3AZMC 3R45B 4CAYB 3MGRC 1P34A 3VH6A 3WTPA 4E44A 5C3IC 1EQZD 3LJAC 4J8XC 3REID 2L5AA 3W97A 3B0DB 3REJC 3C1CA 1HQ3A 4Z5TA 5B33C 2HIOC 3UTBC 2NQBC 4H9PB 5F99B 5GXQD 4YM6D 3UT9D 1R4VA 2AROC 4R8PA 3X1VB 4H9RB 5GSUA 4G92B 4KGCA 5AV9D 1EQZB 3AZLA 1P3GC 3REIB 5KDMB 4YS3D 3REHA 1P3OD 5B24A 4ZUXA 5CPKD 4NFTA 1A7WA 2CV5A 5B32D 4WU9B 5B0ZA 3AZHD 1P3KA 4YM6B 3UT9B 5BT1D 3AV1C 3AN2C 5AV9B 1F66A 2RVQD 5AVCC 4YS3B 4WNNA 5B1MB 1TZYA 3W98D 2YFVB 1P3OB 1HTAA 2NZDD 1ZLAB 1N1JA 4J8UA 5CPKB 3AFAD 4X23D 3C1BA 4J8VA 5B32B 1EQZC 3REIC 1KX3A 4XZQA 1JFIA 3TU4D 3WAAD 4WU8C 3W96D 1H3OB 1P3PD 3X1TD 3AZNA 3W98B 2BYKB 2CWEA 5GXQC 3MVDB 1AOIA 2NZDB 2F8NB 2F8NH 4YM6C 4Z66D 4X23B 5CPJA 3RELA 5CP6A 5B1LB 5AV8A 4H9QB 3B0CW 3MGPC 3AZGD 3WAAB 5GT3A 5AVBD 1P3OC 1TAFA 3W96B 4LD9D 3KWQC 1P3PB 3X1TB 3VH5T 5B32C 3KXBC 3MGSA 3AZHC 2BYMA 5BS7A 4Z66B 1U35D 1M18D 5BT1C 5F99A 4J8WD 2RVQC 4JJNC 4H9RA 3REKC 4LD9B 3AFAC 4H9NA 4E45A 1P3AA 3B6GD 3KUYA 3AV2A 1U35B 3WAAC 4AWLB 3TU4C 2IO5B 1M19A 4WU9A 4J8WB 3W96C 3LJAD 4J8XD 3WKJC 3X1TC 5B2IA 5FUGA 3AZEB 2FJ7D 5B33D 3NQJA 2NQBD 5B1MA 2YFVA 5BNVB 5CPID 3LZ1D 2YFWA 1ZLAA 3B6GB 2AROD 5AV5A 5AV6A 3AZJA 1KX5A 4KUDD 5G49A 3AZGC 5AVBC 3AYWA 4XUJA 4LD9C 5DNNC 5B40A 5C3IB 4NE6A 3LJAB 4J8XB 3AZKD 3A6ND 1P3GD 3O62D 3REJB 3AZIA 1M1AA 1H3OA 5B33B 2HIOB 3WA9A 1U35C 1M18C 1ID3A 2NQBB 4J8VD 3WTPC 5CPIB 4J8WC 3MVDA 3LELA 2AROB 4KUDB 5B0YD 4QLCA 3W97C 3AN2D 3W99D 4Z5TC 5GT0D 4H9QA 1P3GB 5AVCD 3AZKB 3A6NB 3X1SA 3O62B 3LZ0A 3AZND 3MGQD 3X1UD 3B6GC 4R8PC 3MNNA 4HGAC 5GSUC 3AZLC 5B0YB 3AV1B 1P3LA 5JRGA 3AN2B 3W99B 2FJ7C 5GT0B 4WU8D 4H9OB 5B24C 5AVCB 5B31A 1BH8A 3NQUB 5CPIC 4M6BA 3LZ1C 3X1UB 1KX4A 4KUDC 3V9RB 5BNXA 4H9SA 3UTAD 3AZKC 3A6NC 3MGPD 3O62C 1TZYC 1WWIA 4WU8B 3KWQD 3C1BC 4J8VC 3KXBD 5GXQB 3AZEA 5DNMD 3KSYA 3B6FA 1S32D 1P3BA 3VH6T 5B0YC 3AZFA 3AZMA 3W99C 1BH9A 5GT0C 5JA4B 3UTAB 3MGRA 3MGPB 3AZNC 5E5AD 4JJND 3MGQC 4DRAA 1AOIC 4G91C 3REKD 3X1UC 2PYOD 4Z2MG 3KWQB 3RELC
chains in the Genus database with same CATH superfamily
3KXBB 3AZHB 5DNMB 1S32B 4KHAA 2Y2OA 3P5JB 2HIOA 3UTBA 2W8SA 3WKJD 5E5AB 4JJNB 1P3MD 3AZID 5AY8D 3MGSC 3REKB 2PYOB 3AFAB 5BS7C 4WZSB 4CSRA 3VH5A 3R45A 5B2JD 4CAYA 3UTAC 3TU4B 1P3ID 5CHLB 1P3FD 5DNND 3WKJB 3AV1A 1P3MB 5DNMC 1S32C 4UUZB 3EPJA 1M19C 1Z2CB 1P34D 4H9PA 3WTPD 5BO0B 5B2JB 5E5AC 3AZGB 3W97D 5AVBB 2JSSA 3C1CD 3X1VA 1P3IB 1HQ3D 4Z5TD 1P3FB 5DNNB 1EQZA 2PYOC 2XD5A 5KDMA 3REIA 1KU5A 2Y2LA 5AV6C 5AV5C 1M18B 4R8PD 1P34B 3WTPB 5GSUD 5GXQA 4KGCD 4YM6A 3UT9A 5B40C 3AZLD 1ULYA 3REHD 3A1KA 2F8NK 3W97B 1P3MC 3AZIC 1HQ3B 4Z5TB 5AY8C 3VH5W 5AV9A 5B24D 4ZUXD 4YS3A 2CV5D 1ID3C 1P3OA 3IP4C 5B0ZD 5B2JC 1P3KD 5CPKA 4R8PB 5B32A 4HGAB 5GSUB 1P3IC 1P3FC 3AZHA 1F66D 2DQNC 3AZLB 2Y2PA 3REHB 4EO5B 3LZ0C 1TZYD 2FJ7B 5B24B 4ZUXB 3WTPE 4J8UD 3C1BD 2BYKA 2CV5B 3W98A 1P34C 2NZDA 5B0ZB 3LZ1B 1P3KB 2F8NA 1KX3D 4X23A 4XZQD 3C1CC 5B1LA 5JRGC 1HQ3C 1F66B 2Y2KA 3WAAA 4WNNB 1TZYB 1AOID 3W96A 1N1JB 5B31G 4J8UB 1P3PA 3A1IA 4DRBA 3X1TA 5CPJD 1KX4C 3C1BB 4J8VB 2XD1A 3RELD 5CP6D 5AV8D 4KGCC 2HUEB 4Z66A 4H9SC 3REHC 1Q9CA 4EO5C 1KX3B 4XZQB 1JFIB 5GT3D 4NE3A 4ZUXC 3AZNB 3AZGA 2CV5C 3MGQB 5AVBA 4Z2MH 3MGSD 4G91B 5B0ZC 1AOIB 1P3KC 4LD9A 1P3BC 5CPJB 3RELB 2Y2NA 5F99D 5AV8B 2UWXA 1F66C 4ZBJC 1U35A 1M18A 5GT3B 3X1VD 1TAFB 4J8WA 4J8UC 2LY8A 3MGSB 2HUEC 1P3AD 2BYMB 1KX3C 3KUYD 3AV2D 4XZQC 1M19D 5BNVA 4WU9D 3B6GA 5B2ID 3LJAA 4J8XA 5CPJC 5B1MD 3REJA 5CP6C 4H9NB 5AV8C 2FJ7A 1ZLAD 1P3AB 5B33A 5AV6D 5AV5D 3KUYB 3AZJD 1KX5D 3AV2B 1M19B 2NQBA 5GT3C 3AYWD 5CPIA 4XUJD 3LZ1A 5B40D 2AROA 4KUDA 3B0DC 5B2IB 1M1AD 5FUGB 3B0BA 3B0CT 1P3GA 3AZKA 3A6NA 3O62A 3NQJB 3WA9D 1ID3D 3VH6W 5F99C 3MVDD 2F8ND 2YFWB 3LELD 5AV6B 5AV5B 3FDDA 3AZJB 1KX5B 4QLCD 5G49B 3X1VC 4G92C 5B1LD 3AYWB 2DF4C 4XUJB 1WWSA 5B40B 5B0YA 3X1SD 3LZ0D 3AZIB 3AN2A 1M1AB 3W99A 5AY8B 5GT0A 4H9OA 1P3AC 5AVCA 3KUYC 3WA9B 3AV2C 3MNND 3MGQA 1ID3B 3NQUA 4WU9C 3X1UA 3LELB 3UT9C 5B2IC 3V9RA 4QLCB 4DQYB 3F6TA 5JRGD 1P3LD 4WV4B 5AV9C 4YS3C 3X1SB 5B1MC 3LZ0B 5B31D 2G5IC 4WU8A 1ZLAC 1KX4D 5CPKC 3AZJC 1KX5C 3MNNB 3AYWC 4XUJC 5B32G 2RIQA 1P3LB 1M1AC 3C1CB 5JRGB 1BFMA 5JA4A 3UTAA 3MGPA 3WA9C 3W98C 5B31B 3EPLA 1BH8B 3MVDC 3AZED 2NZDC 3B6FD 1P3BD 3LELC 3KWQA 1KX4B 4X23C 2JE5A 4QLCC 3AZFD 3KXBA 2F8NG 1B6WA 5B1LC 3AZMD 5DNMA 4KGCB 1S32A 5BNXB 4NE5A 3MGRD 3X1SC 2Y2QA 3H0MC 1P3PC 5E5AA 4JJNA 3MNNC 3REJD 3REKA 3B6FB 1P3BB 2PYOA 3AFAA 4Z66C 2HIOD 3UTBD 1P3LC 3AZFB 3AZMB 1BH9B 4ZBJB 3MGRB 3TU4A 5B31C 2Y2GA 1B67A 3WKJA 1P3MA 5AY8A 4UUZA 4KHAB 4AWLC 3UTBB 2IO5C 5BO0A 5B2JA 1W2EA 3AV1D 1P3IA 1P3FA 1F1EA 3AZEC 5DNNA 3B6FC 2F2AC 4CSRB 3AZFC 5CP6B 3AZMC 2ZM5A 3R45B 4CAYB 3MGRC 1P34A 3VH6A 3WTPA 4E44A 5C3IC 1EQZD 3LJAC 4J8XC 3REID 2L5AA 3W97A 3B0DB 3REJC 3C1CA 2FFFB 1HQ3A 4Z5TA 2VQRA 5B33C 2HIOC 3UTBC 2NQBC 4H9PB 5F99B 5GXQD 4YM6D 3UT9D 1R4VA 2AROC 4R8PA 3X1VB 4H9RB 5GSUA 4G92B 4KGCA 5AV9D 1EQZB 3AZLA 1P3GC 3REIB 5KDMB 4YS3D 3REHA 1P3OD 5B24A 4ZUXA 5CPKD 4NFTA 1A7WA 2CV5A 5B32D 4WU9B 2Y2HA 5B0ZA 3AZHD 1P3KA 4YM6B 3UT9B 3EPHA 5BT1D 3AV1C 3AN2C 5AV9B 1F66A 2RVQD 5AVCC 4YS3B 4WNNA 5B1MB 1TZYA 3W98D 2YFVB 1P3OB 1HTAA 2NZDD 1ZLAB 1N1JA 4J8UA 5CPKB 3AFAD 4X23D 3C1BA 4J8VA 5B32B 1EQZC 3REIC 1KX3A 4XZQA 1JFIA 3TU4D 3WAAD 4WU8C 3W96D 4UPKA 1H3OB 1P3PD 3X1TD 3AZNA 3AL0C 3W98B 2BYKB 2CWEA 2ZY5A 5GXQC 3MVDB 1AOIA 2F8NB 2NZDB 2F8NH 4YM6C 4Z66D 2ZY2A 4X23B 5CPJA 3RELA 5CP6A 5B1LB 5AV8A 4H9QB 3B0CW 1T3UA 3MGPC 3AZGD 3WAAB 5GT3A 5AVBD 1P3OC 1TAFA 4WJ3C 3W96B 4LD9D 3KWQC 1P3PB 3X1TB 3VH5T 5B32C 2ZY4A 3KXBC 3MGSA 3AZHC 2BYMA 5BS7A 4Z66B 2J8PA 1U35D 1M18D 5BT1C 5F99A 4J8WD 2RVQC 3KFUG 4JJNC 3H0LC 4H9RA 3REKC 4LD9B 3AFAC 4H9NA 4E45A 1P3AA 3B6GD 3KUYA 3AV2A 1U35B 3WAAC 4AWLB 3TU4C 2IO5B 1M19A 4WU9A 4J8WB 3W96C 3LJAD 4J8XD 3WKJC 3X1TC 5B2IA 5FUGA 3AZEB 2FJ7D 5B33D 3NQJA 2NQBD 5B1MA 2YFVA 5BNVB 5CPID 3LZ1D 2YFWA 1ZLAA 3B6GB 2AROD 5AV5A 5AV6A 3AZJA 1KX5A 4KUDD 5G49A 3AZGC 5AVBC 3AYWA 4XUJA 4LD9C 5DNNC 5B40A 5C3IB 4NE6A 3LJAB 4J8XB 3AZKD 3A6ND 1P3GD 3O62D 3REJB 3AZIA 2Y2JA 1M1AA 1H3OA 5B33B 2G5HC 2HIOB 3WA9A 1U35C 1M18C 1ID3A 2NQBB 4J8VD 3WTPC 5CPIB 2Y2IA 3MVDA 4J8WC 2JCHA 3LELA 2AROB 4KUDB 5B0YD 4QLCA 3W97C 3AN2D 3W99D 4Z5TC 5GT0D 4H9QA 1P3GB 5AVCD 3AZKB 3A6NB 3X1SA 3O62B 3LZ0A 3AZND 3MGQD 3X1UD 3B6GC 4R8PC 3MNNA 2BG1A 4HGAC 5GSUC 3AZLC 5B0YB 3AV1B 1P3LA 5JRGA 2Y2MA 3AN2B 3W99B 2FJ7C 5GT0B 4WU8D 4H9OB 5B24C 5AVCB 3EPKA 5B31A 1BH8A 3NQUB 5CPIC 4M6BA 3LZ1C 3X1UB 1KX4A 4KUDC 3V9RB 5BNXA 4H9SA 3UTAD 3AZKC 3A6NC 3MGPD 3O62C 1TZYC 3H0RC 1WWIA 4WU8B 3KWQD 3EG5B 3C1BC 1PZRA 4J8VC 3KXBD 5GXQB 3AZEA 5DNMD 3KSYA 3B6FA 2ZY3A 1S32D 1P3BA 3VH6T 5B0YC 3AZFA 3AZMA 3W99C 1BH9A 5GT0C 5JA4B 3UTAB 3MGRA 3MGPB 3AZNC 5E5AD 4JJND 3MGQC 4DRAA 1AOIC 4G91C 3REKD 3X1UC 2PYOD 4Z2MG 3KWQB 3RELC
chains in the Genus database with same CATH topology
3KXBB 3AZHB 5DNMB 1S32B 4KHAA 2Y2OA 3P5JB 2HIOA 3UTBA 2W8SA 3WKJD 5E5AB 4JJNB 1P3MD 3AZID 5AY8D 3MGSC 3REKB 2PYOB 3AFAB 5BS7C 4WZSB 4CSRA 3VH5A 3R45A 5B2JD 4CAYA 3UTAC 3TU4B 1P3ID 5CHLB 1P3FD 5DNND 3WKJB 3AV1A 1P3MB 5DNMC 1S32C 4UUZB 3EPJA 1M19C 1Z2CB 1P34D 4H9PA 3WTPD 5BO0B 5B2JB 5E5AC 3AZGB 3W97D 5AVBB 2JSSA 3C1CD 3X1VA 1P3IB 1HQ3D 4Z5TD 1P3FB 5DNNB 1EQZA 2PYOC 2XD5A 5KDMA 3REIA 1KU5A 2Y2LA 5AV6C 5AV5C 1M18B 4R8PD 1P34B 3WTPB 5GSUD 5GXQA 4KGCD 4YM6A 3UT9A 5B40C 3AZLD 1ULYA 3REHD 3A1KA 2F8NK 3W97B 1P3MC 3AZIC 1HQ3B 4Z5TB 5AY8C 3VH5W 5AV9A 5B24D 4ZUXD 4YS3A 2CV5D 1ID3C 1P3OA 3IP4C 5B0ZD 5B2JC 1P3KD 5CPKA 4R8PB 5B32A 4HGAB 5GSUB 1P3IC 1P3FC 3AZHA 1F66D 2DQNC 3AZLB 2Y2PA 3REHB 4EO5B 3LZ0C 1TZYD 2FJ7B 5B24B 4ZUXB 3WTPE 4J8UD 3C1BD 2BYKA 2CV5B 3W98A 1P34C 2NZDA 5B0ZB 3LZ1B 1P3KB 2F8NA 1KX3D 4X23A 4XZQD 3C1CC 5B1LA 5JRGC 1HQ3C 1F66B 2Y2KA 3WAAA 4WNNB 1TZYB 1AOID 3W96A 1N1JB 5B31G 4J8UB 1P3PA 3A1IA 4DRBA 3X1TA 5CPJD 1KX4C 3C1BB 4J8VB 2XD1A 3RELD 5CP6D 5AV8D 4KGCC 2HUEB 4Z66A 4H9SC 3REHC 1Q9CA 4EO5C 1KX3B 4XZQB 1JFIB 5GT3D 4NE3A 4ZUXC 3AZNB 3AZGA 2CV5C 3MGQB 5AVBA 4Z2MH 3MGSD 4G91B 5B0ZC 1AOIB 1P3KC 4LD9A 1P3BC 5CPJB 3RELB 2Y2NA 5F99D 5AV8B 2UWXA 1F66C 4ZBJC 1U35A 1M18A 5GT3B 3X1VD 1TAFB 4J8WA 4J8UC 2LY8A 3MGSB 2HUEC 1P3AD 2BYMB 1KX3C 3KUYD 3AV2D 4XZQC 1M19D 5BNVA 4WU9D 3B6GA 5B2ID 3LJAA 4J8XA 5CPJC 5B1MD 3REJA 5CP6C 4H9NB 5AV8C 2FJ7A 1ZLAD 1P3AB 5B33A 5AV6D 5AV5D 3KUYB 3AZJD 1KX5D 3AV2B 1M19B 2NQBA 5GT3C 3AYWD 5CPIA 4XUJD 3LZ1A 5B40D 2AROA 4KUDA 3B0DC 5B2IB 1M1AD 5FUGB 3B0BA 3B0CT 1P3GA 3AZKA 3A6NA 3O62A 3NQJB 3WA9D 1ID3D 3VH6W 5F99C 3MVDD 2F8ND 2YFWB 3LELD 5AV6B 5AV5B 3FDDA 3AZJB 1KX5B 4QLCD 5G49B 3X1VC 4G92C 5B1LD 3AYWB 2DF4C 4XUJB 1WWSA 5B40B 5B0YA 3X1SD 3LZ0D 3AZIB 3AN2A 1M1AB 3W99A 5AY8B 5GT0A 4H9OA 1P3AC 5AVCA 3KUYC 3WA9B 3AV2C 3MNND 3MGQA 1ID3B 3NQUA 4WU9C 3X1UA 3LELB 3UT9C 5B2IC 3V9RA 4QLCB 4DQYB 3F6TA 5JRGD 1P3LD 4WV4B 5AV9C 4YS3C 3X1SB 5B1MC 3LZ0B 5B31D 2G5IC 4WU8A 1ZLAC 1KX4D 5CPKC 3AZJC 1KX5C 3MNNB 3AYWC 4XUJC 5B32G 2RIQA 1P3LB 1M1AC 3C1CB 5JRGB 1BFMA 5JA4A 3UTAA 3MGPA 3WA9C 3W98C 5B31B 3EPLA 1BH8B 3MVDC 3AZED 2NZDC 3B6FD 1P3BD 3LELC 3KWQA 1KX4B 4X23C 2JE5A 4QLCC 3AZFD 3KXBA 2F8NG 1B6WA 5B1LC 3AZMD 5DNMA 4KGCB 1S32A 5BNXB 4NE5A 3MGRD 3X1SC 2Y2QA 3H0MC 1P3PC 5E5AA 4JJNA 3MNNC 3REJD 3REKA 3B6FB 1P3BB 2PYOA 3AFAA 4Z66C 2HIOD 3UTBD 1P3LC 3AZFB 3AZMB 1BH9B 4ZBJB 3MGRB 3TU4A 5B31C 2Y2GA 1B67A 3WKJA 1P3MA 5AY8A 4UUZA 4KHAB 4AWLC 3UTBB 2IO5C 5BO0A 5B2JA 1W2EA 3AV1D 1P3IA 1P3FA 1F1EA 3AZEC 5DNNA 3B6FC 2F2AC 4CSRB 3AZFC 5CP6B 3AZMC 2ZM5A 3R45B 4CAYB 3MGRC 1P34A 3VH6A 3WTPA 4E44A 5C3IC 1EQZD 3LJAC 4J8XC 3REID 2L5AA 3W97A 3B0DB 3REJC 3C1CA 2FFFB 1HQ3A 4Z5TA 2VQRA 5B33C 2HIOC 3UTBC 2NQBC 4H9PB 5F99B 5GXQD 4YM6D 3UT9D 1R4VA 2AROC 4R8PA 3X1VB 4H9RB 5GSUA 4G92B 4KGCA 5AV9D 1EQZB 3AZLA 1P3GC 3REIB 5KDMB 4YS3D 3REHA 1P3OD 5B24A 4ZUXA 5CPKD 4NFTA 1A7WA 2CV5A 5B32D 4WU9B 2Y2HA 5B0ZA 3AZHD 1P3KA 4YM6B 3UT9B 3EPHA 5BT1D 3AV1C 3AN2C 5AV9B 1F66A 2RVQD 5AVCC 4YS3B 4WNNA 5B1MB 1TZYA 3W98D 2YFVB 1P3OB 1HTAA 2NZDD 1ZLAB 1N1JA 4J8UA 5CPKB 3AFAD 4X23D 3C1BA 4J8VA 5B32B 1EQZC 3REIC 1KX3A 4XZQA 1JFIA 3TU4D 3WAAD 4WU8C 3W96D 4UPKA 1H3OB 1P3PD 3X1TD 3AZNA 3AL0C 3W98B 2BYKB 2CWEA 2ZY5A 5GXQC 3MVDB 1AOIA 2F8NB 2NZDB 2F8NH 4YM6C 4Z66D 2ZY2A 4X23B 5CPJA 3RELA 5CP6A 5B1LB 5AV8A 4H9QB 3B0CW 1T3UA 3MGPC 3AZGD 3WAAB 5GT3A 5AVBD 1P3OC 1TAFA 4WJ3C 3W96B 4LD9D 3KWQC 1P3PB 3X1TB 3VH5T 5B32C 2ZY4A 3KXBC 3MGSA 3AZHC 2BYMA 5BS7A 4Z66B 2J8PA 1U35D 1M18D 5BT1C 5F99A 4J8WD 2RVQC 3KFUG 4JJNC 3H0LC 4H9RA 3REKC 4LD9B 3AFAC 4H9NA 4E45A 1P3AA 3B6GD 3KUYA 3AV2A 1U35B 3WAAC 4AWLB 3TU4C 2IO5B 1M19A 4WU9A 4J8WB 3W96C 3LJAD 4J8XD 3WKJC 3X1TC 5B2IA 5FUGA 3AZEB 2FJ7D 5B33D 3NQJA 2NQBD 5B1MA 2YFVA 5BNVB 5CPID 3LZ1D 2YFWA 1ZLAA 3B6GB 2AROD 5AV5A 5AV6A 3AZJA 1KX5A 4KUDD 5G49A 3AZGC 5AVBC 3AYWA 4XUJA 4LD9C 5DNNC 5B40A 5C3IB 4NE6A 3LJAB 4J8XB 3AZKD 3A6ND 1P3GD 3O62D 3REJB 3AZIA 2Y2JA 1M1AA 1H3OA 5B33B 2G5HC 2HIOB 3WA9A 1U35C 1M18C 1ID3A 2NQBB 4J8VD 3WTPC 5CPIB 2Y2IA 3MVDA 4J8WC 2JCHA 3LELA 2AROB 4KUDB 5B0YD 4QLCA 3W97C 3AN2D 3W99D 4Z5TC 5GT0D 4H9QA 1P3GB 5AVCD 3AZKB 3A6NB 3X1SA 3O62B 3LZ0A 3AZND 3MGQD 3X1UD 3B6GC 4R8PC 3MNNA 2BG1A 4HGAC 5GSUC 3AZLC 5B0YB 3AV1B 1P3LA 5JRGA 2Y2MA 3AN2B 3W99B 2FJ7C 5GT0B 4WU8D 4H9OB 5B24C 5AVCB 3EPKA 5B31A 1BH8A 3NQUB 5CPIC 4M6BA 3LZ1C 3X1UB 1KX4A 4KUDC 3V9RB 5BNXA 4H9SA 3UTAD 3AZKC 3A6NC 3MGPD 3O62C 1TZYC 3H0RC 1WWIA 4WU8B 3KWQD 3EG5B 3C1BC 1PZRA 4J8VC 3KXBD 5GXQB 3AZEA 5DNMD 3KSYA 3B6FA 2ZY3A 1S32D 1P3BA 3VH6T 5B0YC 3AZFA 3AZMA 3W99C 1BH9A 5GT0C 5JA4B 3UTAB 3MGRA 3MGPB 3AZNC 5E5AD 4JJND 3MGQC 4DRAA 1AOIC 4G91C 3REKD 3X1UC 2PYOD 4Z2MG 3KWQB 3RELC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXB B;  3AZH B;  5DNM B;  1S32 B;  4KHA A;  2HIO A;  3UTB A;  3WKJ D;  5E5A B;  4JJN B;  1P3M D;  3AZI D;  5AY8 D;  3MGS C;  3REK B;  2PYO B;  3AFA B;  5BS7 C;  4WZS B;  4CSR A;  3VH5 A;  3R45 A;  5B2J D;  4CAY A;  3UTA C;  3TU4 B;  1P3I D;  5CHL B;  1P3F D;  5DNN D;  3WKJ B;  3AV1 A;  1P3M B;  5DNM C;  1S32 C;  4UUZ B;  1M19 C;  1P34 D;  4H9P A;  3WTP D;  5BO0 B;  5B2J B;  5E5A C;  3AZG B;  3W97 D;  5AVB B;  2JSS A;  3C1C D;  3X1V A;  1P3I B;  1HQ3 D;  4Z5T D;  1P3F B;  5DNN B;  1EQZ A;  2PYO C;  3REI A;  5KDM A;  1KU5 A;  5AV6 C;  5AV5 C;  1M18 B;  4R8P D;  1P34 B;  3WTP B;  5GSU D;  5GXQ A;  4KGC D;  4YM6 A;  3UT9 A;  5B40 C;  3AZL D;  1ULY A;  3REH D;  2F8N K;  3W97 B;  1P3M C;  3AZI C;  1HQ3 B;  4Z5T B;  5AY8 C;  3VH5 W;  5AV9 A;  5B24 D;  4ZUX D;  4YS3 A;  2CV5 D;  1ID3 C;  1P3O A;  5B0Z D;  5B2J C;  1P3K D;  5CPK A;  4R8P B;  5B32 A;  4HGA B;  5GSU B;  1P3I C;  1P3F C;  3AZH A;  1F66 D;  3AZL B;  3REH B;  4EO5 B;  3LZ0 C;  1TZY D;  2FJ7 B;  5B24 B;  4ZUX B;  3WTP E;  4J8U D;  3C1B D;  2BYK A;  2CV5 B;  3W98 A;  1P34 C;  2NZD A;  5B0Z B;  3LZ1 B;  1P3K B;  2F8N A;  1KX3 D;  4X23 A;  4XZQ D;  3C1C C;  5B1L A;  5JRG C;  1HQ3 C;  1F66 B;  3WAA A;  4WNN B;  1TZY B;  1AOI D;  3W96 A;  1N1J B;  5B31 G;  4J8U B;  1P3P A;  3X1T A;  4DRB A;  1KX4 C;  5CPJ D;  3C1B B;  4J8V B;  3REL D;  5CP6 D;  5AV8 D;  4KGC C;  2HUE B;  4Z66 A;  4H9S C;  3REH C;  1Q9C A;  4EO5 C;  1KX3 B;  4XZQ B;  1JFI B;  5GT3 D;  4NE3 A;  4ZUX C;  3AZN B;  3AZG A;  2CV5 C;  3MGQ B;  5AVB A;  4Z2M H;  3MGS D;  4G91 B;  5B0Z C;  1AOI B;  1P3K C;  4LD9 A;  1P3B C;  5CPJ B;  3REL B;  5F99 D;  5AV8 B;  1F66 C;  4ZBJ C;  1U35 A;  1M18 A;  5GT3 B;  3X1V D;  1TAF B;  4J8W A;  4J8U C;  2LY8 A;  3MGS B;  2HUE C;  1P3A D;  2BYM B;  1KX3 C;  3KUY D;  3AV2 D;  4XZQ C;  1M19 D;  5BNV A;  4WU9 D;  3B6G A;  5B2I D;  3LJA A;  4J8X A;  5CPJ C;  5B1M D;  3REJ A;  5CP6 C;  4H9N B;  5AV8 C;  2FJ7 A;  1ZLA D;  1P3A B;  5B33 A;  5AV6 D;  5AV5 D;  3KUY B;  3AZJ D;  1KX5 D;  3AV2 B;  1M19 B;  2NQB A;  5GT3 C;  3AYW D;  5CPI A;  4XUJ D;  3LZ1 A;  5B40 D;  2ARO A;  4KUD A;  3B0D C;  5B2I B;  1M1A D;  5FUG B;  3B0B A;  3B0C T;  1P3G A;  3AZK A;  3A6N A;  3O62 A;  3NQJ B;  3WA9 D;  1ID3 D;  3VH6 W;  5F99 C;  3MVD D;  2F8N D;  2YFW B;  3LEL D;  5AV6 B;  5AV5 B;  3AZJ B;  1KX5 B;  4QLC D;  5G49 B;  3X1V C;  4G92 C;  5B1L D;  3AYW B;  4XUJ B;  1WWS A;  5B40 B;  5B0Y A;  3X1S D;  3LZ0 D;  3AZI B;  3AN2 A;  1M1A B;  3W99 A;  5AY8 B;  5GT0 A;  4H9O A;  1P3A C;  5AVC A;  3KUY C;  3WA9 B;  3AV2 C;  3MNN D;  3MGQ A;  1ID3 B;  3NQU A;  4WU9 C;  3X1U A;  3LEL B;  3UT9 C;  5B2I C;  3V9R A;  4QLC B;  1P3L D;  5JRG D;  4WV4 B;  5AV9 C;  4YS3 C;  3X1S B;  5B1M C;  3LZ0 B;  5B31 D;  4WU8 A;  1ZLA C;  1KX4 D;  5CPK C;  3AZJ C;  1KX5 C;  3MNN B;  3AYW C;  4XUJ C;  5B32 G;  1P3L B;  1M1A C;  3C1C B;  5JRG B;  1BFM A;  5JA4 A;  3UTA A;  3MGP A;  3WA9 C;  3W98 C;  5B31 B;  1BH8 B;  3MVD C;  3AZE D;  2NZD C;  3B6F D;  1P3B D;  3LEL C;  3KWQ A;  1KX4 B;  4X23 C;  4QLC C;  3AZF D;  3KXB A;  2F8N G;  1B6W A;  5B1L C;  3AZM D;  5DNM A;  4KGC B;  1S32 A;  5BNX B;  4NE5 A;  3MGR D;  3X1S C;  1P3P C;  5E5A A;  4JJN A;  3MNN C;  3REJ D;  3REK A;  3B6F B;  1P3B B;  2PYO A;  3AFA A;  4Z66 C;  2HIO D;  3UTB D;  1P3L C;  3AZF B;  3AZM B;  1BH9 B;  4ZBJ B;  3MGR B;  3TU4 A;  5B31 C;  1B67 A;  3WKJ A;  1P3M A;  5AY8 A;  4UUZ A;  4KHA B;  4AWL C;  3UTB B;  2IO5 C;  5BO0 A;  5B2J A;  3AV1 D;  1P3I A;  1P3F A;  1F1E A;  3AZE C;  5DNN A;  3B6F C;  4CSR B;  3AZF C;  5CP6 B;  3AZM C;  3R45 B;  4CAY B;  3MGR C;  1P34 A;  3VH6 A;  3WTP A;  4E44 A;  5C3I C;  1EQZ D;  3LJA C;  4J8X C;  3REI D;  2L5A A;  3W97 A;  3B0D B;  3REJ C;  3C1C A;  1HQ3 A;  4Z5T A;  5B33 C;  2HIO C;  3UTB C;  2NQB C;  4H9P B;  5F99 B;  5GXQ D;  4YM6 D;  3UT9 D;  1R4V A;  2ARO C;  4R8P A;  3X1V B;  4H9R B;  5GSU A;  4G92 B;  4KGC A;  5AV9 D;  1EQZ B;  3AZL A;  1P3G C;  3REI B;  5KDM B;  4YS3 D;  3REH A;  1P3O D;  5B24 A;  4ZUX A;  5CPK D;  4NFT A;  1A7W A;  2CV5 A;  5B32 D;  4WU9 B;  5B0Z A;  3AZH D;  1P3K A;  4YM6 B;  3UT9 B;  5BT1 D;  3AV1 C;  3AN2 C;  5AV9 B;  1F66 A;  2RVQ D;  5AVC C;  4YS3 B;  4WNN A;  5B1M B;  1TZY A;  3W98 D;  2YFV B;  1P3O B;  1HTA A;  2NZD D;  1ZLA B;  1N1J A;  4J8U A;  5CPK B;  3AFA D;  4X23 D;  3C1B A;  4J8V A;  5B32 B;  1EQZ C;  3REI C;  1KX3 A;  4XZQ A;  1JFI A;  3TU4 D;  3WAA D;  4WU8 C;  3W96 D;  1H3O B;  1P3P D;  3X1T D;  3AZN A;  3W98 B;  2BYK B;  2CWE A;  5GXQ C;  3MVD B;  1AOI A;  2NZD B;  2F8N B;  2F8N H;  4YM6 C;  4Z66 D;  4X23 B;  5CPJ A;  3REL A;  5CP6 A;  5B1L B;  5AV8 A;  4H9Q B;  3B0C W;  3MGP C;  3AZG D;  3WAA B;  5GT3 A;  5AVB D;  1P3O C;  1TAF A;  3W96 B;  4LD9 D;  3KWQ C;  1P3P B;  3X1T B;  3VH5 T;  5B32 C;  3KXB C;  3MGS A;  3AZH C;  2BYM A;  5BS7 A;  4Z66 B;  1U35 D;  1M18 D;  5BT1 C;  5F99 A;  4J8W D;  2RVQ C;  4JJN C;  4H9R A;  3REK C;  4LD9 B;  3AFA C;  4H9N A;  4E45 A;  1P3A A;  3B6G D;  3KUY A;  3AV2 A;  1U35 B;  3WAA C;  4AWL B;  3TU4 C;  2IO5 B;  1M19 A;  4WU9 A;  4J8W B;  3W96 C;  3LJA D;  4J8X D;  3WKJ C;  3X1T C;  5B2I A;  5FUG A;  3AZE B;  2FJ7 D;  5B33 D;  3NQJ A;  2NQB D;  5B1M A;  2YFV A;  5BNV B;  5CPI D;  3LZ1 D;  2YFW A;  1ZLA A;  3B6G B;  2ARO D;  5AV5 A;  5AV6 A;  3AZJ A;  1KX5 A;  4KUD D;  5G49 A;  3AZG C;  5AVB C;  3AYW A;  4XUJ A;  4LD9 C;  5DNN C;  5B40 A;  5C3I B;  4NE6 A;  3LJA B;  4J8X B;  3AZK D;  3A6N D;  1P3G D;  3O62 D;  3REJ B;  3AZI A;  1M1A A;  1H3O A;  5B33 B;  2HIO B;  3WA9 A;  1U35 C;  1M18 C;  1ID3 A;  2NQB B;  4J8V D;  3WTP C;  5CPI B;  4J8W C;  3MVD A;  3LEL A;  2ARO B;  4KUD B;  5B0Y D;  4QLC A;  3W97 C;  3AN2 D;  3W99 D;  4Z5T C;  5GT0 D;  4H9Q A;  1P3G B;  5AVC D;  3AZK B;  3A6N B;  3X1S A;  3O62 B;  3LZ0 A;  3AZN D;  3MGQ D;  3X1U D;  3B6G C;  4R8P C;  3MNN A;  4HGA C;  5GSU C;  3AZL C;  5B0Y B;  3AV1 B;  1P3L A;  5JRG A;  3AN2 B;  3W99 B;  2FJ7 C;  5GT0 B;  4WU8 D;  4H9O B;  5B24 C;  5AVC B;  5B31 A;  1BH8 A;  3NQU B;  5CPI C;  4M6B A;  3LZ1 C;  3X1U B;  1KX4 A;  4KUD C;  3V9R B;  5BNX A;  4H9S A;  3UTA D;  3AZK C;  3A6N C;  3MGP D;  3O62 C;  1TZY C;  1WWI A;  4WU8 B;  3KWQ D;  3C1B C;  4J8V C;  3KXB D;  5GXQ B;  3AZE A;  5DNM D;  3KSY A;  3B6F A;  1S32 D;  1P3B A;  3VH6 T;  5B0Y C;  3AZF A;  3AZM A;  3W99 C;  1BH9 A;  5GT0 C;  5JA4 B;  3UTA B;  3MGR A;  3MGP B;  3AZN C;  5E5A D;  4JJN D;  3MGQ C;  4DRA A;  1AOI C;  4G91 C;  3REK D;  3X1U C;  2PYO D;  4Z2M G;  3KWQ B;  3REL C; 
#chains in the Genus database with same CATH topology
 3KXB B;  3AZH B;  5DNM B;  1S32 B;  4KHA A;  2Y2O A;  3P5J B;  2HIO A;  3UTB A;  2W8S A;  3WKJ D;  5E5A B;  4JJN B;  1P3M D;  3AZI D;  5AY8 D;  3MGS C;  3REK B;  2PYO B;  3AFA B;  5BS7 C;  4WZS B;  4CSR A;  3VH5 A;  3R45 A;  5B2J D;  4CAY A;  3UTA C;  3TU4 B;  1P3I D;  5CHL B;  1P3F D;  5DNN D;  3WKJ B;  3AV1 A;  1P3M B;  5DNM C;  1S32 C;  4UUZ B;  3EPJ A;  1M19 C;  1Z2C B;  1P34 D;  4H9P A;  3WTP D;  5BO0 B;  5B2J B;  5E5A C;  3AZG B;  3W97 D;  5AVB B;  2JSS A;  3C1C D;  3X1V A;  1P3I B;  1HQ3 D;  4Z5T D;  1P3F B;  5DNN B;  1EQZ A;  2PYO C;  2XD5 A;  5KDM A;  3REI A;  1KU5 A;  2Y2L A;  5AV6 C;  5AV5 C;  1M18 B;  4R8P D;  1P34 B;  3WTP B;  5GSU D;  5GXQ A;  4KGC D;  4YM6 A;  3UT9 A;  5B40 C;  3AZL D;  1ULY A;  3REH D;  3A1K A;  2F8N K;  3W97 B;  1P3M C;  3AZI C;  1HQ3 B;  4Z5T B;  5AY8 C;  3VH5 W;  5AV9 A;  5B24 D;  4ZUX D;  4YS3 A;  2CV5 D;  1ID3 C;  1P3O A;  3IP4 C;  5B0Z D;  5B2J C;  1P3K D;  5CPK A;  4R8P B;  5B32 A;  4HGA B;  5GSU B;  1P3I C;  1P3F C;  3AZH A;  1F66 D;  2DQN C;  3AZL B;  2Y2P A;  3REH B;  4EO5 B;  3LZ0 C;  1TZY D;  2FJ7 B;  5B24 B;  4ZUX B;  3WTP E;  4J8U D;  3C1B D;  2BYK A;  2CV5 B;  3W98 A;  1P34 C;  2NZD A;  5B0Z B;  3LZ1 B;  1P3K B;  2F8N A;  1KX3 D;  4X23 A;  4XZQ D;  3C1C C;  5B1L A;  5JRG C;  1HQ3 C;  1F66 B;  2Y2K A;  3WAA A;  4WNN B;  1TZY B;  1AOI D;  3W96 A;  1N1J B;  5B31 G;  4J8U B;  1P3P A;  3A1I A;  4DRB A;  3X1T A;  5CPJ D;  1KX4 C;  3C1B B;  4J8V B;  2XD1 A;  3REL D;  5CP6 D;  5AV8 D;  4KGC C;  2HUE B;  4Z66 A;  4H9S C;  3REH C;  1Q9C A;  4EO5 C;  1KX3 B;  4XZQ B;  1JFI B;  5GT3 D;  4NE3 A;  4ZUX C;  3AZN B;  3AZG A;  2CV5 C;  3MGQ B;  5AVB A;  4Z2M H;  3MGS D;  4G91 B;  5B0Z C;  1AOI B;  1P3K C;  4LD9 A;  1P3B C;  5CPJ B;  3REL B;  2Y2N A;  5F99 D;  5AV8 B;  2UWX A;  1F66 C;  4ZBJ C;  1U35 A;  1M18 A;  5GT3 B;  3X1V D;  1TAF B;  4J8W A;  4J8U C;  2LY8 A;  3MGS B;  2HUE C;  1P3A D;  2BYM B;  1KX3 C;  3KUY D;  3AV2 D;  4XZQ C;  1M19 D;  5BNV A;  4WU9 D;  3B6G A;  5B2I D;  3LJA A;  4J8X A;  5CPJ C;  5B1M D;  3REJ A;  5CP6 C;  4H9N B;  5AV8 C;  2FJ7 A;  1ZLA D;  1P3A B;  5B33 A;  5AV6 D;  5AV5 D;  3KUY B;  3AZJ D;  1KX5 D;  3AV2 B;  1M19 B;  2NQB A;  5GT3 C;  3AYW D;  5CPI A;  4XUJ D;  3LZ1 A;  5B40 D;  2ARO A;  4KUD A;  3B0D C;  5B2I B;  1M1A D;  5FUG B;  3B0B A;  3B0C T;  1P3G A;  3AZK A;  3A6N A;  3O62 A;  3NQJ B;  3WA9 D;  1ID3 D;  3VH6 W;  5F99 C;  3MVD D;  2F8N D;  2YFW B;  3LEL D;  5AV6 B;  5AV5 B;  3FDD A;  3AZJ B;  1KX5 B;  4QLC D;  5G49 B;  3X1V C;  4G92 C;  5B1L D;  3AYW B;  2DF4 C;  4XUJ B;  1WWS A;  5B40 B;  5B0Y A;  3X1S D;  3LZ0 D;  3AZI B;  3AN2 A;  1M1A B;  3W99 A;  5AY8 B;  5GT0 A;  4H9O A;  1P3A C;  5AVC A;  3KUY C;  3WA9 B;  3AV2 C;  3MNN D;  3MGQ A;  1ID3 B;  3NQU A;  4WU9 C;  3X1U A;  3LEL B;  3UT9 C;  5B2I C;  3V9R A;  4QLC B;  4DQY B;  3F6T A;  5JRG D;  1P3L D;  4WV4 B;  5AV9 C;  4YS3 C;  3X1S B;  5B1M C;  3LZ0 B;  5B31 D;  2G5I C;  4WU8 A;  1ZLA C;  1KX4 D;  5CPK C;  3AZJ C;  1KX5 C;  3MNN B;  3AYW C;  4XUJ C;  5B32 G;  2RIQ A;  1P3L B;  1M1A C;  3C1C B;  5JRG B;  1BFM A;  5JA4 A;  3UTA A;  3MGP A;  3WA9 C;  3W98 C;  5B31 B;  3EPL A;  1BH8 B;  3MVD C;  3AZE D;  2NZD C;  3B6F D;  1P3B D;  3LEL C;  3KWQ A;  1KX4 B;  4X23 C;  2JE5 A;  4QLC C;  3AZF D;  3KXB A;  2F8N G;  1B6W A;  5B1L C;  3AZM D;  5DNM A;  4KGC B;  1S32 A;  5BNX B;  4NE5 A;  3MGR D;  3X1S C;  2Y2Q A;  3H0M C;  1P3P C;  5E5A A;  4JJN A;  3MNN C;  3REJ D;  3REK A;  3B6F B;  1P3B B;  2PYO A;  3AFA A;  4Z66 C;  2HIO D;  3UTB D;  1P3L C;  3AZF B;  3AZM B;  1BH9 B;  4ZBJ B;  3MGR B;  3TU4 A;  5B31 C;  2Y2G A;  1B67 A;  3WKJ A;  1P3M A;  5AY8 A;  4UUZ A;  4KHA B;  4AWL C;  3UTB B;  2IO5 C;  5BO0 A;  5B2J A;  1W2E A;  3AV1 D;  1P3I A;  1P3F A;  1F1E A;  3AZE C;  5DNN A;  3B6F C;  2F2A C;  4CSR B;  3AZF C;  5CP6 B;  3AZM C;  2ZM5 A;  3R45 B;  4CAY B;  3MGR C;  1P34 A;  3VH6 A;  3WTP A;  4E44 A;  5C3I C;  1EQZ D;  3LJA C;  4J8X C;  3REI D;  2L5A A;  3W97 A;  3B0D B;  3REJ C;  3C1C A;  2FFF B;  1HQ3 A;  4Z5T A;  2VQR A;  5B33 C;  2HIO C;  3UTB C;  2NQB C;  4H9P B;  5F99 B;  5GXQ D;  4YM6 D;  3UT9 D;  1R4V A;  2ARO C;  4R8P A;  3X1V B;  4H9R B;  5GSU A;  4G92 B;  4KGC A;  5AV9 D;  1EQZ B;  3AZL A;  1P3G C;  3REI B;  5KDM B;  4YS3 D;  3REH A;  1P3O D;  5B24 A;  4ZUX A;  5CPK D;  4NFT A;  1A7W A;  2CV5 A;  5B32 D;  4WU9 B;  2Y2H A;  5B0Z A;  3AZH D;  1P3K A;  4YM6 B;  3UT9 B;  3EPH A;  5BT1 D;  3AV1 C;  3AN2 C;  5AV9 B;  1F66 A;  2RVQ D;  5AVC C;  4YS3 B;  4WNN A;  5B1M B;  1TZY A;  3W98 D;  2YFV B;  1P3O B;  1HTA A;  2NZD D;  1ZLA B;  1N1J A;  4J8U A;  5CPK B;  3AFA D;  4X23 D;  3C1B A;  4J8V A;  5B32 B;  1EQZ C;  3REI C;  1KX3 A;  4XZQ A;  1JFI A;  3TU4 D;  3WAA D;  4WU8 C;  3W96 D;  4UPK A;  1H3O B;  1P3P D;  3X1T D;  3AZN A;  3AL0 C;  3W98 B;  2BYK B;  2CWE A;  2ZY5 A;  5GXQ C;  3MVD B;  1AOI A;  2F8N B;  2NZD B;  2F8N H;  4YM6 C;  4Z66 D;  2ZY2 A;  4X23 B;  5CPJ A;  3REL A;  5CP6 A;  5B1L B;  5AV8 A;  4H9Q B;  3B0C W;  1T3U A;  3MGP C;  3AZG D;  3WAA B;  5GT3 A;  5AVB D;  1P3O C;  1TAF A;  4WJ3 C;  3W96 B;  4LD9 D;  3KWQ C;  1P3P B;  3X1T B;  3VH5 T;  5B32 C;  2ZY4 A;  3KXB C;  3MGS A;  3AZH C;  2BYM A;  5BS7 A;  4Z66 B;  2J8P A;  1U35 D;  1M18 D;  5BT1 C;  5F99 A;  4J8W D;  2RVQ C;  3KFU G;  4JJN C;  3H0L C;  4H9R A;  3REK C;  4LD9 B;  3AFA C;  4H9N A;  4E45 A;  1P3A A;  3B6G D;  3KUY A;  3AV2 A;  1U35 B;  3WAA C;  4AWL B;  3TU4 C;  2IO5 B;  1M19 A;  4WU9 A;  4J8W B;  3W96 C;  3LJA D;  4J8X D;  3WKJ C;  3X1T C;  5B2I A;  5FUG A;  3AZE B;  2FJ7 D;  5B33 D;  3NQJ A;  2NQB D;  5B1M A;  2YFV A;  5BNV B;  5CPI D;  3LZ1 D;  2YFW A;  1ZLA A;  3B6G B;  2ARO D;  5AV5 A;  5AV6 A;  3AZJ A;  1KX5 A;  4KUD D;  5G49 A;  3AZG C;  5AVB C;  3AYW A;  4XUJ A;  4LD9 C;  5DNN C;  5B40 A;  5C3I B;  4NE6 A;  3LJA B;  4J8X B;  3AZK D;  3A6N D;  1P3G D;  3O62 D;  3REJ B;  3AZI A;  2Y2J A;  1M1A A;  1H3O A;  5B33 B;  2G5H C;  2HIO B;  3WA9 A;  1U35 C;  1M18 C;  1ID3 A;  2NQB B;  4J8V D;  3WTP C;  5CPI B;  2Y2I A;  3MVD A;  4J8W C;  2JCH A;  3LEL A;  2ARO B;  4KUD B;  5B0Y D;  4QLC A;  3W97 C;  3AN2 D;  3W99 D;  4Z5T C;  5GT0 D;  4H9Q A;  1P3G B;  5AVC D;  3AZK B;  3A6N B;  3X1S A;  3O62 B;  3LZ0 A;  3AZN D;  3MGQ D;  3X1U D;  3B6G C;  4R8P C;  3MNN A;  2BG1 A;  4HGA C;  5GSU C;  3AZL C;  5B0Y B;  3AV1 B;  1P3L A;  5JRG A;  2Y2M A;  3AN2 B;  3W99 B;  2FJ7 C;  5GT0 B;  4WU8 D;  4H9O B;  5B24 C;  5AVC B;  3EPK A;  5B31 A;  1BH8 A;  3NQU B;  5CPI C;  4M6B A;  3LZ1 C;  3X1U B;  1KX4 A;  4KUD C;  3V9R B;  5BNX A;  4H9S A;  3UTA D;  3AZK C;  3A6N C;  3MGP D;  3O62 C;  1TZY C;  3H0R C;  1WWI A;  4WU8 B;  3KWQ D;  3EG5 B;  3C1B C;  1PZR A;  4J8V C;  3KXB D;  5GXQ B;  3AZE A;  5DNM D;  3KSY A;  3B6F A;  2ZY3 A;  1S32 D;  1P3B A;  3VH6 T;  5B0Y C;  3AZF A;  3AZM A;  3W99 C;  1BH9 A;  5GT0 C;  5JA4 B;  3UTA B;  3MGR A;  3MGP B;  3AZN C;  5E5A D;  4JJN D;  3MGQ C;  4DRA A;  1AOI C;  4G91 C;  3REK D;  3X1U C;  2PYO D;  4Z2M G;  3KWQ B;  3REL C; 
#chains in the Genus database with same CATH homology
 3KXB B;  3AZH B;  5DNM B;  1S32 B;  4KHA A;  2Y2O A;  3P5J B;  2HIO A;  3UTB A;  2W8S A;  3WKJ D;  5E5A B;  4JJN B;  1P3M D;  3AZI D;  5AY8 D;  3MGS C;  3REK B;  2PYO B;  3AFA B;  5BS7 C;  4WZS B;  4CSR A;  3VH5 A;  3R45 A;  5B2J D;  4CAY A;  3UTA C;  3TU4 B;  1P3I D;  5CHL B;  1P3F D;  5DNN D;  3WKJ B;  3AV1 A;  1P3M B;  5DNM C;  1S32 C;  4UUZ B;  3EPJ A;  1M19 C;  1Z2C B;  1P34 D;  4H9P A;  3WTP D;  5BO0 B;  5B2J B;  5E5A C;  3AZG B;  3W97 D;  5AVB B;  2JSS A;  3C1C D;  3X1V A;  1P3I B;  1HQ3 D;  4Z5T D;  1P3F B;  5DNN B;  1EQZ A;  2PYO C;  2XD5 A;  5KDM A;  3REI A;  1KU5 A;  2Y2L A;  5AV6 C;  5AV5 C;  1M18 B;  4R8P D;  1P34 B;  3WTP B;  5GSU D;  5GXQ A;  4KGC D;  4YM6 A;  3UT9 A;  5B40 C;  3AZL D;  1ULY A;  3REH D;  3A1K A;  2F8N K;  3W97 B;  1P3M C;  3AZI C;  1HQ3 B;  4Z5T B;  5AY8 C;  3VH5 W;  5AV9 A;  5B24 D;  4ZUX D;  4YS3 A;  2CV5 D;  1ID3 C;  1P3O A;  3IP4 C;  5B0Z D;  5B2J C;  1P3K D;  5CPK A;  4R8P B;  5B32 A;  4HGA B;  5GSU B;  1P3I C;  1P3F C;  3AZH A;  1F66 D;  2DQN C;  3AZL B;  2Y2P A;  3REH B;  4EO5 B;  3LZ0 C;  1TZY D;  2FJ7 B;  5B24 B;  4ZUX B;  3WTP E;  4J8U D;  3C1B D;  2BYK A;  2CV5 B;  3W98 A;  1P34 C;  2NZD A;  5B0Z B;  3LZ1 B;  1P3K B;  2F8N A;  1KX3 D;  4X23 A;  4XZQ D;  3C1C C;  5B1L A;  5JRG C;  1HQ3 C;  1F66 B;  2Y2K A;  3WAA A;  4WNN B;  1TZY B;  1AOI D;  3W96 A;  1N1J B;  5B31 G;  4J8U B;  1P3P A;  3A1I A;  4DRB A;  3X1T A;  5CPJ D;  1KX4 C;  3C1B B;  4J8V B;  2XD1 A;  3REL D;  5CP6 D;  5AV8 D;  4KGC C;  2HUE B;  4Z66 A;  4H9S C;  3REH C;  1Q9C A;  4EO5 C;  1KX3 B;  4XZQ B;  1JFI B;  5GT3 D;  4NE3 A;  4ZUX C;  3AZN B;  3AZG A;  2CV5 C;  3MGQ B;  5AVB A;  4Z2M H;  3MGS D;  4G91 B;  5B0Z C;  1AOI B;  1P3K C;  4LD9 A;  1P3B C;  5CPJ B;  3REL B;  2Y2N A;  5F99 D;  5AV8 B;  2UWX A;  1F66 C;  4ZBJ C;  1U35 A;  1M18 A;  5GT3 B;  3X1V D;  1TAF B;  4J8W A;  4J8U C;  2LY8 A;  3MGS B;  2HUE C;  1P3A D;  2BYM B;  1KX3 C;  3KUY D;  3AV2 D;  4XZQ C;  1M19 D;  5BNV A;  4WU9 D;  3B6G A;  5B2I D;  3LJA A;  4J8X A;  5CPJ C;  5B1M D;  3REJ A;  5CP6 C;  4H9N B;  5AV8 C;  2FJ7 A;  1ZLA D;  1P3A B;  5B33 A;  5AV6 D;  5AV5 D;  3KUY B;  3AZJ D;  1KX5 D;  3AV2 B;  1M19 B;  2NQB A;  5GT3 C;  3AYW D;  5CPI A;  4XUJ D;  3LZ1 A;  5B40 D;  2ARO A;  4KUD A;  3B0D C;  5B2I B;  1M1A D;  5FUG B;  3B0B A;  3B0C T;  1P3G A;  3AZK A;  3A6N A;  3O62 A;  3NQJ B;  3WA9 D;  1ID3 D;  3VH6 W;  5F99 C;  3MVD D;  2F8N D;  2YFW B;  3LEL D;  5AV6 B;  5AV5 B;  3FDD A;  3AZJ B;  1KX5 B;  4QLC D;  5G49 B;  3X1V C;  4G92 C;  5B1L D;  3AYW B;  2DF4 C;  4XUJ B;  1WWS A;  5B40 B;  5B0Y A;  3X1S D;  3LZ0 D;  3AZI B;  3AN2 A;  1M1A B;  3W99 A;  5AY8 B;  5GT0 A;  4H9O A;  1P3A C;  5AVC A;  3KUY C;  3WA9 B;  3AV2 C;  3MNN D;  3MGQ A;  1ID3 B;  3NQU A;  4WU9 C;  3X1U A;  3LEL B;  3UT9 C;  5B2I C;  3V9R A;  4QLC B;  4DQY B;  3F6T A;  5JRG D;  1P3L D;  4WV4 B;  5AV9 C;  4YS3 C;  3X1S B;  5B1M C;  3LZ0 B;  5B31 D;  2G5I C;  4WU8 A;  1ZLA C;  1KX4 D;  5CPK C;  3AZJ C;  1KX5 C;  3MNN B;  3AYW C;  4XUJ C;  5B32 G;  2RIQ A;  1P3L B;  1M1A C;  3C1C B;  5JRG B;  1BFM A;  5JA4 A;  3UTA A;  3MGP A;  3WA9 C;  3W98 C;  5B31 B;  3EPL A;  1BH8 B;  3MVD C;  3AZE D;  2NZD C;  3B6F D;  1P3B D;  3LEL C;  3KWQ A;  1KX4 B;  4X23 C;  2JE5 A;  4QLC C;  3AZF D;  3KXB A;  2F8N G;  1B6W A;  5B1L C;  3AZM D;  5DNM A;  4KGC B;  1S32 A;  5BNX B;  4NE5 A;  3MGR D;  3X1S C;  2Y2Q A;  3H0M C;  1P3P C;  5E5A A;  4JJN A;  3MNN C;  3REJ D;  3REK A;  3B6F B;  1P3B B;  2PYO A;  3AFA A;  4Z66 C;  2HIO D;  3UTB D;  1P3L C;  3AZF B;  3AZM B;  1BH9 B;  4ZBJ B;  3MGR B;  3TU4 A;  5B31 C;  2Y2G A;  1B67 A;  3WKJ A;  1P3M A;  5AY8 A;  4UUZ A;  4KHA B;  4AWL C;  3UTB B;  2IO5 C;  5BO0 A;  5B2J A;  1W2E A;  3AV1 D;  1P3I A;  1P3F A;  1F1E A;  3AZE C;  5DNN A;  3B6F C;  2F2A C;  4CSR B;  3AZF C;  5CP6 B;  3AZM C;  2ZM5 A;  3R45 B;  4CAY B;  3MGR C;  1P34 A;  3VH6 A;  3WTP A;  4E44 A;  5C3I C;  1EQZ D;  3LJA C;  4J8X C;  3REI D;  2L5A A;  3W97 A;  3B0D B;  3REJ C;  3C1C A;  2FFF B;  1HQ3 A;  4Z5T A;  2VQR A;  5B33 C;  2HIO C;  3UTB C;  2NQB C;  4H9P B;  5F99 B;  5GXQ D;  4YM6 D;  3UT9 D;  1R4V A;  2ARO C;  4R8P A;  3X1V B;  4H9R B;  5GSU A;  4G92 B;  4KGC A;  5AV9 D;  1EQZ B;  3AZL A;  1P3G C;  3REI B;  5KDM B;  4YS3 D;  3REH A;  1P3O D;  5B24 A;  4ZUX A;  5CPK D;  4NFT A;  1A7W A;  2CV5 A;  5B32 D;  4WU9 B;  2Y2H A;  5B0Z A;  3AZH D;  1P3K A;  4YM6 B;  3UT9 B;  3EPH A;  5BT1 D;  3AV1 C;  3AN2 C;  5AV9 B;  1F66 A;  2RVQ D;  5AVC C;  4YS3 B;  4WNN A;  5B1M B;  1TZY A;  3W98 D;  2YFV B;  1P3O B;  1HTA A;  2NZD D;  1ZLA B;  1N1J A;  4J8U A;  5CPK B;  3AFA D;  4X23 D;  3C1B A;  4J8V A;  5B32 B;  1EQZ C;  3REI C;  1KX3 A;  4XZQ A;  1JFI A;  3TU4 D;  3WAA D;  4WU8 C;  3W96 D;  4UPK A;  1H3O B;  1P3P D;  3X1T D;  3AZN A;  3AL0 C;  3W98 B;  2BYK B;  2CWE A;  2ZY5 A;  5GXQ C;  3MVD B;  1AOI A;  2F8N B;  2NZD B;  2F8N H;  4YM6 C;  4Z66 D;  2ZY2 A;  4X23 B;  5CPJ A;  3REL A;  5CP6 A;  5B1L B;  5AV8 A;  4H9Q B;  3B0C W;  1T3U A;  3MGP C;  3AZG D;  3WAA B;  5GT3 A;  5AVB D;  1P3O C;  1TAF A;  4WJ3 C;  3W96 B;  4LD9 D;  3KWQ C;  1P3P B;  3X1T B;  3VH5 T;  5B32 C;  2ZY4 A;  3KXB C;  3MGS A;  3AZH C;  2BYM A;  5BS7 A;  4Z66 B;  2J8P A;  1U35 D;  1M18 D;  5BT1 C;  5F99 A;  4J8W D;  2RVQ C;  3KFU G;  4JJN C;  3H0L C;  4H9R A;  3REK C;  4LD9 B;  3AFA C;  4H9N A;  4E45 A;  1P3A A;  3B6G D;  3KUY A;  3AV2 A;  1U35 B;  3WAA C;  4AWL B;  3TU4 C;  2IO5 B;  1M19 A;  4WU9 A;  4J8W B;  3W96 C;  3LJA D;  4J8X D;  3WKJ C;  3X1T C;  5B2I A;  5FUG A;  3AZE B;  2FJ7 D;  5B33 D;  3NQJ A;  2NQB D;  5B1M A;  2YFV A;  5BNV B;  5CPI D;  3LZ1 D;  2YFW A;  1ZLA A;  3B6G B;  2ARO D;  5AV5 A;  5AV6 A;  3AZJ A;  1KX5 A;  4KUD D;  5G49 A;  3AZG C;  5AVB C;  3AYW A;  4XUJ A;  4LD9 C;  5DNN C;  5B40 A;  5C3I B;  4NE6 A;  3LJA B;  4J8X B;  3AZK D;  3A6N D;  1P3G D;  3O62 D;  3REJ B;  3AZI A;  2Y2J A;  1M1A A;  1H3O A;  5B33 B;  2G5H C;  2HIO B;  3WA9 A;  1U35 C;  1M18 C;  1ID3 A;  2NQB B;  4J8V D;  3WTP C;  5CPI B;  2Y2I A;  3MVD A;  4J8W C;  2JCH A;  3LEL A;  2ARO B;  4KUD B;  5B0Y D;  4QLC A;  3W97 C;  3AN2 D;  3W99 D;  4Z5T C;  5GT0 D;  4H9Q A;  1P3G B;  5AVC D;  3AZK B;  3A6N B;  3X1S A;  3O62 B;  3LZ0 A;  3AZN D;  3MGQ D;  3X1U D;  3B6G C;  4R8P C;  3MNN A;  2BG1 A;  4HGA C;  5GSU C;  3AZL C;  5B0Y B;  3AV1 B;  1P3L A;  5JRG A;  2Y2M A;  3AN2 B;  3W99 B;  2FJ7 C;  5GT0 B;  4WU8 D;  4H9O B;  5B24 C;  5AVC B;  3EPK A;  5B31 A;  1BH8 A;  3NQU B;  5CPI C;  4M6B A;  3LZ1 C;  3X1U B;  1KX4 A;  4KUD C;  3V9R B;  5BNX A;  4H9S A;  3UTA D;  3AZK C;  3A6N C;  3MGP D;  3O62 C;  1TZY C;  3H0R C;  1WWI A;  4WU8 B;  3KWQ D;  3EG5 B;  3C1B C;  1PZR A;  4J8V C;  3KXB D;  5GXQ B;  3AZE A;  5DNM D;  3KSY A;  3B6F A;  2ZY3 A;  1S32 D;  1P3B A;  3VH6 T;  5B0Y C;  3AZF A;  3AZM A;  3W99 C;  1BH9 A;  5GT0 C;  5JA4 B;  3UTA B;  3MGR A;  3MGP B;  3AZN C;  5E5A D;  4JJN D;  3MGQ C;  4DRA A;  1AOI C;  4G91 C;  3REK D;  3X1U C;  2PYO D;  4Z2M G;  3KWQ B;  3REL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...