3WA9A

The nucleosome containing human h2a.z.1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9A00
3X1UC 3REJD 1WWSA 4J8WA 5GT0C 3MVDD 3X1TC 3AZNB 1KX4B 4WV4B 4H9RB 2PYOD 4QLCC 3W99D 1KX5A 1F1EA 3MGSD 5JRGC 2BYKB 2HIOB 4WU8A 2F8NK 5AV6A 3MGPD 5GXQD 5AV9C 5B1MD 4E45A 5JA4B 4NFTA 5GT3D 1P3GC 3AFAC 1M1AC 5CPJC 1EQZC 3AV2D 3X1UA 3AZFB 5FUGB 2AROB 5CPIB 3X1TA 5AV8B 1HTAA 3X1SD 4H9SC 3C1BC 2NZDB 4J8UC 5B40D 3WKJD 4YM6B 5AV9A 5B1LD 3VH6W 5C3IB 4XZQD 1P3GA 3A6NB 3AFAA 1EQZA 1KX3A 1P3IC 4UUZB 2FJ7D 3KXBB 3B6GA 1F66C 3C1BA 4J8UA 5GSUD 3LELB 3B6FD 4DRBA 1P3FB 5B0YA 3MNNB 2NQBB 2HUEB 4H9NB 3UTAD 3AV1D 5B0ZD 1P34D 1ZLAC 3W97D 4KGCB 2YFWB 1F66A 3WAAB 2F8NB 5B32D 3O62D 3AZNA 1KX4A 3AZHD 5AV5B 4H9RA 3W98B 2BYKA 2HIOA 3REID 4X23D 3WA9D 1HQ3B 5C3IC 1P3MC 5JA4A 3AZIB 5BNXB 5F99C 2L5AA 3AZEB 3W96D 3RELC 2LY8A 5FUGA 5DNNC 2AROA 2CWEA 4YS3D 1P3KD 3VH6A 1P3BD 1AOIB 4R8PC 3KXBC 5AV8A 4J8VC 4G91B 4DRAA 5DNMC 3LJAD 3KUYD 1ID3B 3UT9D 3KWQD 3C1CB 1P3OD 3AZJC 3LZ1B 5B2IC 3LZ0C 3WTPB 4WZSB 5F99A 3A6NA 5KDMB 2NQBC 5DNNA 4UUZA 3UTBD 3AN2D 4R8PA 3AZGD 3KXBA 4J8VA 1KX5D 5AV6D 5BNVB 3TU4B 2F8NG 3REHB 1P3LD 5CHLB 3X1VB 5B33B 3LELA 3REKD 5AV5C 5CPKC 1P3FA 4KHAB 2NQBA 4H9NA 5GT0D 3NQUB 1M19C 4Z66C 3X1TD 5B24B 3B0DC 1H3OB 4QLCD 3AZIC 5AVCB 4J8WC 4KGCA 2YFWA 5JRGD 3WAAA 2F8NA 4KUDB 2CV5B 1P3PB 1AOIC 4G92B 4WU8C 1P3GD 3AFAD 1M1AD 5AV5A 4G91C 5CPJD 1EQZD 3W98A 1A7WA 3MGQB 3C1CC 4NE3A 4J8XB 3LZ1C 2RVQC 3AZIA 4J8UD 5BNXA 3REJB 5E5AD 1Q9CA 3VH6T 3MVDB 3AZEA 4JJND 4AWLB 2PYOB 1AOIA 3W99B 4ZUXB 5CP6B 3MGPB 1BH8B 5B1MB 3AZKB 1P3ID 1U35C 3MGRD 3C1CA 4LD9D 3LZ1A 5B33C 2BYMB 3AV2B 1TZYC 3WTPA 1KX3C 4CAYB 4H9QB 5KDMA 4H9PB 3B6GC 3X1SB 3V9RB 2IO5C 5B40B 5AY8B 3WKJB 5AVCC 5BNVA 3TU4A 1U35A 3REHA 4XZQB 5B0YC 3X1VA 5B33A 1ZLAD 4E44A 1TZYA 5BS7A 5B31D 3VH5A 3R45B 1B67A 4KHAA 2FJ7B 3MGQC 4Z2MG 3NQUA 5B24A 1S32D 1H3OA 4EO5B 1R4VA 5AVCA 5AVBB 3B0CT 5GSUB 1BFMA 5BO0B 3AZNC 1KX4C 3B6FB 2CV5A 4AWLC 1P3MD 1P3PA 2HIOC 5F99D 4ZUXC 3UTAB 3AV1B 5B2JD 1M18B 5CP6C 5BT1C 3RELD 5B1MC 3AZKC 5B0ZB 5DNND 1P34B 3MGQA 3W97B 4R8PD 4J8XA 3KXBD 4J8VD 3AZFC 2AROC 5DNMD 3REJA 5CPIC 3AZJD 5AV8C 3O62B 5B2ID 3LZ0D 3AZHB 1JFIB 2NZDC 3W99A 4YM6C 5B40C 5AY8C 4ZUXA 3B0CW 5G49B 5CP6A 3REIB 1BH8A 5B1MA 3AZKA 3WA9B 3A6NC 4WU9D 2BYMA 3AZFA 3AV2A 3W96B 1KU5A 3AZMD 4NE6A 4YS3B 5CPIA 4H9QA 1P3BB 1P3KB 4WNNB 4H9PA 3X1SA 2NZDA 3V9RA 4XUJD 3LJAB 4YM6A 5B40A 5AY8A 3KUYB 5CPKD 3NQJB 4EO5C 1P3AB 5AVBC 3WKJA 1P3OB 4ZBJB 3LELC 1M19D 4Z66D 1BH9B 1P3FC 4XZQA 4Z5TB 3MNNC 2HUEC 3B0BA 3AZID 4J8WD 1M18C 3UTBB 3AYWB 3AN2B 1P34C 3AZGB 4KGCC 1KX5B 4WU8D 2F8NH 3WAAC 5AV6B 5AVBA 1P3LB 5GSUA 5BO0A 3C1CD 3B6FA 3LZ1D 3REKB 3X1UD 3MNNA 3W98C 2RVQD 2YFVB 5GT0B 1M18A 3REIC 1HQ3C 2JSSA 1P34A 3VH5W 4QLCB 3W97A 3AZEC 5JRGB 5AV9D 1U35D 1P3BC 4HGAB 3O62A 1P3GB 3AFAB 3AZLB 3AZHA 5CPJB 1M1AB 1ULYA 1JFIA 1TZYD 1KX3D 1ID3C 4NE5A 5G49A 1P3AC 3REIA 1HQ3A 4ZBJC 3B6GD 3WTPC 3C1BD 4Z5TC 5E5AB 5AVCD 3W96A 4JJNB 4YS3A 3AYWC 1P3BA 4WNNA 3MGSB 5B0YD 3AZGC 5GXQB 1ID3A 3KUYA 3TU4C 1P3IB 3REHC 3NQJA 1P3AA 3MGRB 4CSRB 3X1VC 5GT3B 1P3LC 4LD9B 1TAFB 5BS7C 1F66D 1BH9A 3REKC 4Z5TA 5B24C 1B6WA 3AZND 1KX4D 3UTBA 3AYWA 3AN2A 3AZGA 5B1LB 2HIOD 4ZUXD 4KUDC 5CP6D 5BT1D 2CV5C 3AZKD 1P3LA 1P3PC 4G92C 1ZLAB 4HGAC 5B31B 3AZLC 3REKA 3AZFD 4Z2MH 2AROD 2YFVA 5CPID 5GT0A 4J8XC 1S32B 5AV8D 1N1JB 2NZDD 4QLCA 3REJC 4YM6D 5AY8D 5JRGA 3MVDC 4KUDA 5E5AC 4JJNC 2PYOC 1P3MB 3W99C 3A6ND 3MGSC 5F99B 3WTPE 3MGPC 5B2JB 5GXQC 3AZLA 5CPJA 1M1AA 3RELB 5DNNB 3MGRC 5GT3C 4R8PB 4M6BA 4LD9C 3AV2C 5B32B 4J8VB 4H9SA 5DNMB 3MVDA 5E5AA 5AVBD 3AZJB 3X1SC 3LELD 4JJNA 2PYOA 4H9OB 5B2IB 3LZ0B 3WKJC 3MGSA 1P3FD 3MNND 2NQBD 4X23B 3MGPA 5GXQA 5B1LC 1M18D 1P3IA 4XZQC 4CSRA 5GT3A 3MGRA 4WU9B 4LD9A 1TAFA 4KGCD 4CAYA 5B31C 5B31G 2F8ND 3WAAD 3AZMB 2FJ7C 1S32C 5AV5D 4XUJB 3UT9B 3W98D 3KWQB 5CPKB 5B1LA 5GSUC 1M19B 3B6FC 4Z66B 1HQ3D 3B0DB 3VH5T 1ZLAA 1WWIA 4J8WB 3UTAC 3AV1C 3R45A 5B31A 3AZED 5B2JC 2FJ7A 3KSYA 5B0ZC 1AOID 3W97C 4WU8B 1S32A 1N1JA 5B32C 5B32G 1ID3D 1P3AD 3O62C 3AZHC 3X1UB 3WTPD 1P3MA 3UTAA 3AV1A 4Z5TD 4X23C 5B2JA 3X1TB 3WA9C 5B0ZA 3RELA 3AYWD 4WU9C 1F66B 3W96C 5B32A 5AV9B 5DNMA 4YS3C 3TU4D 3AZMC 1P3KC 3REHD 1U35B 3X1VD 3AZJA 5B33D 1EQZB 4H9OA 5B2IA 3LZ0A 3LJAC 1TZYB 3KUYC 1KX3B 4XUJC 3UT9C 3KWQC 4X23A 1P3OC 3WA9A 5B24D 3B6GB 3C1BB 4J8UB 2IO5B 4WU9A 4KUDD 3UTBC 3AZMA 1P3KA 3AN2C 2CV5D 5B0YB 1P3PD 1KX5C 3LJAA 4XUJA 5AV6C 3UT9A 3KWQA 3AZLD 5CPKA 1P3OA 3MGQD 1M19A 4J8XD 4Z66A
chains in the Genus database with same CATH superfamily
2G5HC 3X1UC 3REJD 1WWSA 4J8WA 5GT0C 3MVDD 3X1TC 3AZNB 1KX4B 4WV4B 4H9RB 2PYOD 4QLCC 3W99D 1KX5A 2Y2QA 1F1EA 3MGSD 5JRGC 2BYKB 2HIOB 4WU8A 2F8NK 5AV6A 3MGPD 5GXQD 5AV9C 5B1MD 2Y2IA 2G5IC 4E45A 5JA4B 4NFTA 5GT3D 1P3GC 3AFAC 1M1AC 5CPJC 1EQZC 3AV2D 3X1UA 3AZFB 5FUGB 2AROB 5CPIB 3X1TA 5AV8B 1HTAA 3X1SD 4H9SC 3EPJA 3C1BC 2NZDB 4J8UC 5B40D 2XD5A 3WKJD 4YM6B 5AV9A 5B1LD 3VH6W 5C3IB 4XZQD 1P3GA 3A6NB 3AFAA 1EQZA 1KX3A 1P3IC 4UUZB 2FJ7D 2Y2MA 3KXBB 3B6GA 2JE5A 3C1BA 1F66C 4J8UA 5GSUD 3LELB 3B6FD 4DRBA 1P3FB 2Y2HA 5B0YA 3MNNB 2NQBB 2HUEB 4H9NB 3UTAD 3AV1D 5B0ZD 1P34D 1ZLAC 3W97D 4KGCB 2YFWB 1F66A 3WAAB 2F8NB 5B32D 3O62D 3AZNA 1KX4A 3AZHD 5AV5B 4H9RA 3W98B 2BYKA 2HIOA 3REID 4X23D 3WA9D 3EPKA 1HQ3B 5C3IC 1P3MC 5JA4A 3AZIB 5BNXB 5F99C 2ZM5A 2L5AA 3AZEB 3W96D 3RELC 2LY8A 5FUGA 5DNNC 2AROA 2CWEA 4YS3D 1P3KD 3VH6A 1P3BD 1AOIB 4R8PC 3KXBC 5AV8A 4J8VC 4G91B 4DRAA 5DNMC 3LJAD 3KUYD 1ID3B 3UT9D 3KWQD 3C1CB 1P3OD 3AZJC 3LZ1B 5B2IC 3LZ0C 3WTPB 4WZSB 5F99A 3A6NA 5KDMB 2NQBC 5DNNA 4UUZA 3UTBD 2Y2KA 3AN2D 4R8PA 3AZGD 3KXBA 4J8VA 1KX5D 5AV6D 5BNVB 3TU4B 2F8NG 3REHB 1P3LD 5CHLB 3X1VB 5B33B 3LELA 2Y2LA 3REKD 5AV5C 5CPKC 1P3FA 4KHAB 2NQBA 4H9NA 5GT0D 3NQUB 1M19C 4Z66C 3X1TD 3B0DC 5B24B 1H3OB 2XD1A 4QLCD 3AZIC 5AVCB 4J8WC 4KGCA 2YFWA 5JRGD 3WAAA 2F8NA 4KUDB 2CV5B 1P3PB 1AOIC 4G92B 4WU8C 1P3GD 3AFAD 1M1AD 5AV5A 4G91C 5CPJD 1EQZD 3W98A 1A7WA 2W8SA 3MGQB 3C1CC 4NE3A 4J8XB 3LZ1C 2RVQC 3AZIA 4J8UD 5BNXA 3A1KA 3REJB 5E5AD 1Q9CA 3VH6T 3MVDB 3AZEA 4JJND 4AWLB 2PYOB 1AOIA 3W99B 4ZUXB 5CP6B 3MGPB 1BH8B 1PZRA 2F2AC 5B1MB 3AZKB 1P3ID 1U35C 3MGRD 3C1CA 4LD9D 3LZ1A 5B33C 2BYMB 3AV2B 2BG1A 1TZYC 3WTPA 1KX3C 4CAYB 3AL0C 4H9QB 5KDMA 4H9PB 2ZY3A 3B6GC 3X1SB 3V9RB 2IO5C 5B40B 5AY8B 3WKJB 5AVCC 2Y2JA 2DQNC 5BNVA 3TU4A 1U35A 3REHA 4XZQB 5B0YC 3X1VA 5B33A 1ZLAD 4E44A 1TZYA 5BS7A 5B31D 3VH5A 3R45B 1B67A 4KHAA 2FJ7B 3MGQC 4Z2MG 3NQUA 5B24A 1S32D 3P5JB 1H3OA 2JCHA 4EO5B 1R4VA 5AVCA 5AVBB 3B0CT 5GSUB 1BFMA 5BO0B 3AZNC 1KX4C 3B6FB 2CV5A 4AWLC 1P3MD 2Y2OA 1P3PA 2HIOC 5F99D 4ZUXC 3UTAB 3AV1B 5B2JD 1M18B 5CP6C 5BT1C 3RELD 5B1MC 3AZKC 5B0ZB 5DNND 1P34B 3MGQA 3W97B 4R8PD 4J8XA 3KXBD 4J8VD 3AZFC 2AROC 5DNMD 3REJA 5CPIC 3AZJD 5AV8C 3O62B 5B2ID 3LZ0D 3AZHB 1JFIB 2NZDC 3W99A 4YM6C 5B40C 5AY8C 4ZUXA 3B0CW 5G49B 5CP6A 3REIB 1BH8A 5B1MA 3AZKA 3WA9B 3A6NC 4WU9D 2BYMA 3AZFA 3AV2A 3W96B 1KU5A 3AZMD 4NE6A 4YS3B 5CPIA 4H9QA 1P3BB 1P3KB 4WNNB 4H9PA 3X1SA 2NZDA 3V9RA 4XUJD 3LJAB 4YM6A 5B40A 5AY8A 3KUYB 5CPKD 3NQJB 4EO5C 1P3AB 5AVBC 3WKJA 4WJ3C 1P3OB 4ZBJB 3LELC 1M19D 4Z66D 1BH9B 1P3FC 4XZQA 4Z5TB 3MNNC 2HUEC 1W2EA 3B0BA 3AZID 4J8WD 1M18C 3UTBB 3AYWB 3AN2B 1P34C 3AZGB 4KGCC 1KX5B 4WU8D 2F8NH 3WAAC 5AV6B 5AVBA 1P3LB 5GSUA 5BO0A 3C1CD 3B6FA 3LZ1D 3REKB 3X1UD 3MNNA 3W98C 2RVQD 2YFVB 5GT0B 1M18A 3REIC 1HQ3C 4UPKA 2JSSA 1P34A 3VH5W 4QLCB 3W97A 3AZEC 5JRGB 5AV9D 2Y2NA 2VQRA 1U35D 1P3BC 4HGAB 3O62A 1P3GB 3AFAB 3AZLB 3AZHA 5CPJB 1M1AB 1ULYA 1JFIA 1TZYD 1KX3D 1ID3C 4NE5A 5G49A 2UWXA 1P3AC 3REIA 1HQ3A 4ZBJC 3B6GD 3WTPC 3C1BD 4Z5TC 5E5AB 5AVCD 3W96A 4JJNB 4YS3A 3AYWC 2Y2GA 1P3BA 4WNNA 3MGSB 5B0YD 3AZGC 5GXQB 1ID3A 3KUYA 3TU4C 1P3IB 3REHC 3NQJA 1P3AA 3MGRB 3F6TA 4CSRB 5GT3B 3X1VC 1P3LC 3EPHA 4LD9B 1TAFB 5BS7C 1F66D 1BH9A 3REKC 4Z5TA 1Z2CB 5B24C 1B6WA 3AZND 1KX4D 3UTBA 3AYWA 3AN2A 3AZGA 5B1LB 2HIOD 4ZUXD 4KUDC 5CP6D 5BT1D 2CV5C 3AZKD 1P3LA 1P3PC 4G92C 3H0MC 2ZY4A 1ZLAB 4HGAC 5B31B 3AZLC 3REKA 3AZFD 4Z2MH 2AROD 2YFVA 1T3UA 3A1IA 5GT0A 5CPID 4J8XC 4DQYB 1S32B 5AV8D 1N1JB 2NZDD 4QLCA 3REJC 4YM6D 5AY8D 5JRGA 3MVDC 4KUDA 5E5AC 4JJNC 2PYOC 1P3MB 3W99C 3A6ND 3MGSC 5F99B 3WTPE 3MGPC 5B2JB 5GXQC 3AZLA 5CPJA 1M1AA 3H0LC 3RELB 5DNNB 3MGRC 5GT3C 4R8PB 4M6BA 4LD9C 3AV2C 5B32B 4J8VB 4H9SA 5DNMB 3MVDA 5E5AA 5AVBD 3AZJB 3X1SC 3LELD 4JJNA 2PYOA 4H9OB 5B2IB 3LZ0B 3FDDA 3WKJC 3MGSA 1P3FD 3MNND 2NQBD 4X23B 3MGPA 5GXQA 5B1LC 3EPLA 2ZY2A 1P3IA 1M18D 4XZQC 4CSRA 5GT3A 3MGRA 4WU9B 4LD9A 1TAFA 4KGCD 4CAYA 3IP4C 2J8PA 5B31C 5B31G 2F8ND 3WAAD 3AZMB 2FJ7C 1S32C 5AV5D 4XUJB 3UT9B 3W98D 3KWQB 5CPKB 5B1LA 5GSUC 1M19B 3B6FC 4Z66B 1HQ3D 2FFFB 3B0DB 3VH5T 3H0RC 2DF4C 1ZLAA 1WWIA 4J8WB 3UTAC 3AV1C 3R45A 5B31A 3AZED 5B2JC 2FJ7A 3KSYA 5B0ZC 1AOID 3W97C 3EG5B 4WU8B 1S32A 1N1JA 5B32C 5B32G 1ID3D 3KFUG 1P3AD 2RIQA 3O62C 3AZHC 3X1UB 3WTPD 1P3MA 3UTAA 3AV1A 4Z5TD 4X23C 5B2JA 3X1TB 3WA9C 5B0ZA 3RELA 3AYWD 4WU9C 1F66B 3W96C 5B32A 5AV9B 5DNMA 4YS3C 3TU4D 3AZMC 1P3KC 3REHD 1U35B 3X1VD 2Y2PA 3AZJA 5B33D 1EQZB 4H9OA 5B2IA 3LZ0A 3LJAC 1TZYB 3KUYC 1KX3B 4XUJC 3UT9C 3KWQC 4X23A 1P3OC 3WA9A 5B24D 3B6GB 3C1BB 4J8UB 2IO5B 4WU9A 4KUDD 3UTBC 3AZMA 1P3KA 3AN2C 2CV5D 5B0YB 1P3PD 1KX5C 3LJAA 4XUJA 5AV6C 3UT9A 3KWQA 3AZLD 5CPKA 1P3OA 2ZY5A 3MGQD 1M19A 4J8XD 4Z66A
chains in the Genus database with same CATH topology
2G5HC 3X1UC 3REJD 1WWSA 4J8WA 5GT0C 3MVDD 3X1TC 3AZNB 1KX4B 4WV4B 4H9RB 2PYOD 4QLCC 3W99D 1KX5A 2Y2QA 1F1EA 3MGSD 5JRGC 2BYKB 2HIOB 4WU8A 2F8NK 5AV6A 3MGPD 5GXQD 5AV9C 5B1MD 2Y2IA 2G5IC 4E45A 5JA4B 4NFTA 5GT3D 1P3GC 3AFAC 1M1AC 5CPJC 1EQZC 3AV2D 3X1UA 3AZFB 5FUGB 2AROB 5CPIB 3X1TA 5AV8B 1HTAA 3X1SD 4H9SC 3EPJA 3C1BC 2NZDB 4J8UC 5B40D 2XD5A 3WKJD 4YM6B 5AV9A 5B1LD 3VH6W 5C3IB 4XZQD 1P3GA 3A6NB 3AFAA 1EQZA 1KX3A 1P3IC 4UUZB 2FJ7D 2Y2MA 3KXBB 3B6GA 2JE5A 3C1BA 1F66C 4J8UA 5GSUD 3LELB 3B6FD 4DRBA 1P3FB 2Y2HA 5B0YA 3MNNB 2NQBB 2HUEB 4H9NB 3UTAD 3AV1D 5B0ZD 1P34D 1ZLAC 3W97D 4KGCB 2YFWB 1F66A 3WAAB 2F8NB 5B32D 3O62D 3AZNA 1KX4A 3AZHD 5AV5B 4H9RA 3W98B 2BYKA 2HIOA 3REID 4X23D 3WA9D 3EPKA 1HQ3B 5C3IC 1P3MC 5JA4A 3AZIB 5BNXB 5F99C 2ZM5A 2L5AA 3AZEB 3W96D 3RELC 2LY8A 5FUGA 5DNNC 2AROA 2CWEA 4YS3D 1P3KD 3VH6A 1P3BD 1AOIB 4R8PC 3KXBC 5AV8A 4J8VC 4G91B 4DRAA 5DNMC 3LJAD 3KUYD 1ID3B 3UT9D 3KWQD 3C1CB 1P3OD 3AZJC 3LZ1B 5B2IC 3LZ0C 3WTPB 4WZSB 5F99A 3A6NA 5KDMB 2NQBC 5DNNA 4UUZA 3UTBD 2Y2KA 3AN2D 4R8PA 3AZGD 3KXBA 4J8VA 1KX5D 5AV6D 5BNVB 3TU4B 2F8NG 3REHB 1P3LD 5CHLB 3X1VB 5B33B 3LELA 2Y2LA 3REKD 5AV5C 5CPKC 1P3FA 4KHAB 2NQBA 4H9NA 5GT0D 3NQUB 1M19C 4Z66C 3X1TD 3B0DC 5B24B 1H3OB 2XD1A 4QLCD 3AZIC 5AVCB 4J8WC 4KGCA 2YFWA 5JRGD 3WAAA 2F8NA 4KUDB 2CV5B 1P3PB 1AOIC 4G92B 4WU8C 1P3GD 3AFAD 1M1AD 5AV5A 4G91C 5CPJD 1EQZD 3W98A 1A7WA 2W8SA 3MGQB 3C1CC 4NE3A 4J8XB 3LZ1C 2RVQC 3AZIA 4J8UD 5BNXA 3A1KA 3REJB 5E5AD 1Q9CA 3VH6T 3MVDB 3AZEA 4JJND 4AWLB 2PYOB 1AOIA 3W99B 4ZUXB 5CP6B 3MGPB 1BH8B 1PZRA 2F2AC 5B1MB 3AZKB 1P3ID 1U35C 3MGRD 3C1CA 4LD9D 3LZ1A 5B33C 2BYMB 3AV2B 2BG1A 1TZYC 3WTPA 1KX3C 4CAYB 3AL0C 4H9QB 5KDMA 4H9PB 2ZY3A 3B6GC 3X1SB 3V9RB 2IO5C 5B40B 5AY8B 3WKJB 5AVCC 2Y2JA 2DQNC 5BNVA 3TU4A 1U35A 3REHA 4XZQB 5B0YC 3X1VA 5B33A 1ZLAD 4E44A 1TZYA 5BS7A 5B31D 3VH5A 3R45B 1B67A 4KHAA 2FJ7B 3MGQC 4Z2MG 3NQUA 5B24A 1S32D 3P5JB 1H3OA 2JCHA 4EO5B 1R4VA 5AVCA 5AVBB 3B0CT 5GSUB 1BFMA 5BO0B 3AZNC 1KX4C 3B6FB 2CV5A 4AWLC 1P3MD 2Y2OA 1P3PA 2HIOC 5F99D 4ZUXC 3UTAB 3AV1B 5B2JD 1M18B 5CP6C 5BT1C 3RELD 5B1MC 3AZKC 5B0ZB 5DNND 1P34B 3MGQA 3W97B 4R8PD 4J8XA 3KXBD 4J8VD 3AZFC 2AROC 5DNMD 3REJA 5CPIC 3AZJD 5AV8C 3O62B 5B2ID 3LZ0D 3AZHB 1JFIB 2NZDC 3W99A 4YM6C 5B40C 5AY8C 4ZUXA 3B0CW 5G49B 5CP6A 3REIB 1BH8A 5B1MA 3AZKA 3WA9B 3A6NC 4WU9D 2BYMA 3AZFA 3AV2A 3W96B 1KU5A 3AZMD 4NE6A 4YS3B 5CPIA 4H9QA 1P3BB 1P3KB 4WNNB 4H9PA 3X1SA 2NZDA 3V9RA 4XUJD 3LJAB 4YM6A 5B40A 5AY8A 3KUYB 5CPKD 3NQJB 4EO5C 1P3AB 5AVBC 3WKJA 4WJ3C 1P3OB 4ZBJB 3LELC 1M19D 4Z66D 1BH9B 1P3FC 4XZQA 4Z5TB 3MNNC 2HUEC 1W2EA 3B0BA 3AZID 4J8WD 1M18C 3UTBB 3AYWB 3AN2B 1P34C 3AZGB 4KGCC 1KX5B 4WU8D 2F8NH 3WAAC 5AV6B 5AVBA 1P3LB 5GSUA 5BO0A 3C1CD 3B6FA 3LZ1D 3REKB 3X1UD 3MNNA 3W98C 2RVQD 2YFVB 5GT0B 1M18A 3REIC 1HQ3C 4UPKA 2JSSA 1P34A 3VH5W 4QLCB 3W97A 3AZEC 5JRGB 5AV9D 2Y2NA 2VQRA 1U35D 1P3BC 4HGAB 3O62A 1P3GB 3AFAB 3AZLB 3AZHA 5CPJB 1M1AB 1ULYA 1JFIA 1TZYD 1KX3D 1ID3C 4NE5A 5G49A 2UWXA 1P3AC 3REIA 1HQ3A 4ZBJC 3B6GD 3WTPC 3C1BD 4Z5TC 5E5AB 5AVCD 3W96A 4JJNB 4YS3A 3AYWC 2Y2GA 1P3BA 4WNNA 3MGSB 5B0YD 3AZGC 5GXQB 1ID3A 3KUYA 3TU4C 1P3IB 3REHC 3NQJA 1P3AA 3MGRB 3F6TA 4CSRB 5GT3B 3X1VC 1P3LC 3EPHA 4LD9B 1TAFB 5BS7C 1F66D 1BH9A 3REKC 4Z5TA 1Z2CB 5B24C 1B6WA 3AZND 1KX4D 3UTBA 3AYWA 3AN2A 3AZGA 5B1LB 2HIOD 4ZUXD 4KUDC 5CP6D 5BT1D 2CV5C 3AZKD 1P3LA 1P3PC 4G92C 3H0MC 2ZY4A 1ZLAB 4HGAC 5B31B 3AZLC 3REKA 3AZFD 4Z2MH 2AROD 2YFVA 1T3UA 3A1IA 5GT0A 5CPID 4J8XC 4DQYB 1S32B 5AV8D 1N1JB 2NZDD 4QLCA 3REJC 4YM6D 5AY8D 5JRGA 3MVDC 4KUDA 5E5AC 4JJNC 2PYOC 1P3MB 3W99C 3A6ND 3MGSC 5F99B 3WTPE 3MGPC 5B2JB 5GXQC 3AZLA 5CPJA 1M1AA 3H0LC 3RELB 5DNNB 3MGRC 5GT3C 4R8PB 4M6BA 4LD9C 3AV2C 5B32B 4J8VB 4H9SA 5DNMB 3MVDA 5E5AA 5AVBD 3AZJB 3X1SC 3LELD 4JJNA 2PYOA 4H9OB 5B2IB 3LZ0B 3FDDA 3WKJC 3MGSA 1P3FD 3MNND 2NQBD 4X23B 3MGPA 5GXQA 5B1LC 3EPLA 2ZY2A 1P3IA 1M18D 4XZQC 4CSRA 5GT3A 3MGRA 4WU9B 4LD9A 1TAFA 4KGCD 4CAYA 3IP4C 2J8PA 5B31C 5B31G 2F8ND 3WAAD 3AZMB 2FJ7C 1S32C 5AV5D 4XUJB 3UT9B 3W98D 3KWQB 5CPKB 5B1LA 5GSUC 1M19B 3B6FC 4Z66B 1HQ3D 2FFFB 3B0DB 3VH5T 3H0RC 2DF4C 1ZLAA 1WWIA 4J8WB 3UTAC 3AV1C 3R45A 5B31A 3AZED 5B2JC 2FJ7A 3KSYA 5B0ZC 1AOID 3W97C 3EG5B 4WU8B 1S32A 1N1JA 5B32C 5B32G 1ID3D 3KFUG 1P3AD 2RIQA 3O62C 3AZHC 3X1UB 3WTPD 1P3MA 3UTAA 3AV1A 4Z5TD 4X23C 5B2JA 3X1TB 3WA9C 5B0ZA 3RELA 3AYWD 4WU9C 1F66B 3W96C 5B32A 5AV9B 5DNMA 4YS3C 3TU4D 3AZMC 1P3KC 3REHD 1U35B 3X1VD 2Y2PA 3AZJA 5B33D 1EQZB 4H9OA 5B2IA 3LZ0A 3LJAC 1TZYB 3KUYC 1KX3B 4XUJC 3UT9C 3KWQC 4X23A 1P3OC 3WA9A 5B24D 3B6GB 3C1BB 4J8UB 2IO5B 4WU9A 4KUDD 3UTBC 3AZMA 1P3KA 3AN2C 2CV5D 5B0YB 1P3PD 1KX5C 3LJAA 4XUJA 5AV6C 3UT9A 3KWQA 3AZLD 5CPKA 1P3OA 2ZY5A 3MGQD 1M19A 4J8XD 4Z66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U C;  3REJ D;  1WWS A;  4J8W A;  5GT0 C;  3MVD D;  3X1T C;  3AZN B;  1KX4 B;  4WV4 B;  4H9R B;  2PYO D;  4QLC C;  3W99 D;  1KX5 A;  1F1E A;  3MGS D;  5JRG C;  2BYK B;  2HIO B;  4WU8 A;  2F8N K;  5AV6 A;  3MGP D;  5GXQ D;  5AV9 C;  5B1M D;  4E45 A;  5JA4 B;  4NFT A;  5GT3 D;  1P3G C;  3AFA C;  1M1A C;  5CPJ C;  1EQZ C;  3AV2 D;  3X1U A;  3AZF B;  5FUG B;  2ARO B;  5CPI B;  3X1T A;  5AV8 B;  1HTA A;  3X1S D;  4H9S C;  3C1B C;  2NZD B;  4J8U C;  5B40 D;  3WKJ D;  4YM6 B;  5AV9 A;  5B1L D;  3VH6 W;  5C3I B;  4XZQ D;  1P3G A;  3A6N B;  3AFA A;  1EQZ A;  1KX3 A;  1P3I C;  4UUZ B;  2FJ7 D;  3KXB B;  3B6G A;  1F66 C;  3C1B A;  4J8U A;  5GSU D;  3LEL B;  3B6F D;  4DRB A;  1P3F B;  5B0Y A;  3MNN B;  2NQB B;  2HUE B;  4H9N B;  3UTA D;  3AV1 D;  5B0Z D;  1P34 D;  1ZLA C;  3W97 D;  4KGC B;  2YFW B;  1F66 A;  3WAA B;  2F8N B;  5B32 D;  3O62 D;  3AZN A;  1KX4 A;  3AZH D;  5AV5 B;  4H9R A;  3W98 B;  2BYK A;  2HIO A;  3REI D;  4X23 D;  3WA9 D;  1HQ3 B;  5C3I C;  1P3M C;  5JA4 A;  3AZI B;  5BNX B;  5F99 C;  2L5A A;  3AZE B;  3W96 D;  3REL C;  2LY8 A;  5FUG A;  5DNN C;  2ARO A;  2CWE A;  4YS3 D;  1P3K D;  3VH6 A;  1P3B D;  1AOI B;  4R8P C;  3KXB C;  5AV8 A;  4J8V C;  4G91 B;  4DRA A;  5DNM C;  3LJA D;  3KUY D;  1ID3 B;  3UT9 D;  3KWQ D;  3C1C B;  1P3O D;  3AZJ C;  3LZ1 B;  5B2I C;  3LZ0 C;  3WTP B;  4WZS B;  5F99 A;  3A6N A;  5KDM B;  2NQB C;  5DNN A;  4UUZ A;  3UTB D;  3AN2 D;  4R8P A;  3AZG D;  3KXB A;  4J8V A;  1KX5 D;  5AV6 D;  5BNV B;  3TU4 B;  2F8N G;  3REH B;  1P3L D;  5CHL B;  3X1V B;  5B33 B;  3LEL A;  3REK D;  5AV5 C;  5CPK C;  1P3F A;  4KHA B;  2NQB A;  4H9N A;  5GT0 D;  3NQU B;  1M19 C;  4Z66 C;  3X1T D;  5B24 B;  3B0D C;  1H3O B;  4QLC D;  3AZI C;  5AVC B;  4J8W C;  4KGC A;  2YFW A;  5JRG D;  3WAA A;  2F8N A;  4KUD B;  2CV5 B;  1P3P B;  1AOI C;  4G92 B;  4WU8 C;  1P3G D;  3AFA D;  1M1A D;  5AV5 A;  4G91 C;  5CPJ D;  1EQZ D;  3W98 A;  1A7W A;  3MGQ B;  3C1C C;  4NE3 A;  4J8X B;  3LZ1 C;  2RVQ C;  3AZI A;  4J8U D;  5BNX A;  3REJ B;  5E5A D;  1Q9C A;  3VH6 T;  3MVD B;  3AZE A;  4JJN D;  4AWL B;  2PYO B;  1AOI A;  3W99 B;  4ZUX B;  5CP6 B;  3MGP B;  1BH8 B;  5B1M B;  3AZK B;  1P3I D;  1U35 C;  3MGR D;  3C1C A;  4LD9 D;  3LZ1 A;  5B33 C;  2BYM B;  3AV2 B;  1TZY C;  3WTP A;  1KX3 C;  4CAY B;  4H9Q B;  5KDM A;  4H9P B;  3B6G C;  3X1S B;  3V9R B;  2IO5 C;  5B40 B;  5AY8 B;  3WKJ B;  5AVC C;  5BNV A;  3TU4 A;  1U35 A;  3REH A;  4XZQ B;  5B0Y C;  3X1V A;  5B33 A;  1ZLA D;  4E44 A;  1TZY A;  5BS7 A;  5B31 D;  3VH5 A;  3R45 B;  1B67 A;  4KHA A;  2FJ7 B;  3MGQ C;  4Z2M G;  3NQU A;  5B24 A;  1S32 D;  1H3O A;  4EO5 B;  1R4V A;  5AVC A;  5AVB B;  3B0C T;  5GSU B;  1BFM A;  5BO0 B;  3AZN C;  1KX4 C;  3B6F B;  2CV5 A;  4AWL C;  1P3M D;  1P3P A;  2HIO C;  5F99 D;  4ZUX C;  3UTA B;  3AV1 B;  5B2J D;  1M18 B;  5CP6 C;  5BT1 C;  3REL D;  5B1M C;  3AZK C;  5B0Z B;  5DNN D;  1P34 B;  3MGQ A;  3W97 B;  4R8P D;  4J8X A;  3KXB D;  4J8V D;  3AZF C;  2ARO C;  5DNM D;  3REJ A;  5CPI C;  3AZJ D;  5AV8 C;  3O62 B;  5B2I D;  3LZ0 D;  3AZH B;  1JFI B;  2NZD C;  3W99 A;  4YM6 C;  5B40 C;  5AY8 C;  4ZUX A;  3B0C W;  5G49 B;  5CP6 A;  3REI B;  1BH8 A;  5B1M A;  3AZK A;  3WA9 B;  3A6N C;  4WU9 D;  2BYM A;  3AZF A;  3AV2 A;  3W96 B;  1KU5 A;  3AZM D;  4NE6 A;  4YS3 B;  5CPI A;  4H9Q A;  1P3B B;  1P3K B;  4WNN B;  4H9P A;  3X1S A;  2NZD A;  3V9R A;  4XUJ D;  3LJA B;  4YM6 A;  5B40 A;  5AY8 A;  3KUY B;  5CPK D;  3NQJ B;  4EO5 C;  1P3A B;  5AVB C;  3WKJ A;  1P3O B;  4ZBJ B;  3LEL C;  1M19 D;  4Z66 D;  1BH9 B;  1P3F C;  4XZQ A;  4Z5T B;  3MNN C;  2HUE C;  3B0B A;  3AZI D;  4J8W D;  1M18 C;  3UTB B;  3AYW B;  3AN2 B;  1P34 C;  3AZG B;  4KGC C;  1KX5 B;  4WU8 D;  2F8N H;  3WAA C;  5AV6 B;  5AVB A;  1P3L B;  5GSU A;  5BO0 A;  3C1C D;  3B6F A;  3LZ1 D;  3REK B;  3X1U D;  3MNN A;  3W98 C;  2RVQ D;  2YFV B;  5GT0 B;  1M18 A;  3REI C;  1HQ3 C;  2JSS A;  1P34 A;  3VH5 W;  4QLC B;  3W97 A;  3AZE C;  5JRG B;  5AV9 D;  1U35 D;  1P3B C;  4HGA B;  3O62 A;  1P3G B;  3AFA B;  3AZL B;  3AZH A;  5CPJ B;  1M1A B;  1ULY A;  1JFI A;  1TZY D;  1KX3 D;  1ID3 C;  4NE5 A;  5G49 A;  1P3A C;  3REI A;  1HQ3 A;  4ZBJ C;  3B6G D;  3WTP C;  3C1B D;  4Z5T C;  5E5A B;  5AVC D;  3W96 A;  4JJN B;  4YS3 A;  3AYW C;  1P3B A;  4WNN A;  3MGS B;  5B0Y D;  3AZG C;  5GXQ B;  1ID3 A;  3KUY A;  3TU4 C;  1P3I B;  3REH C;  3NQJ A;  1P3A A;  3MGR B;  4CSR B;  3X1V C;  5GT3 B;  1P3L C;  4LD9 B;  1TAF B;  5BS7 C;  1F66 D;  1BH9 A;  3REK C;  4Z5T A;  5B24 C;  1B6W A;  3AZN D;  1KX4 D;  3UTB A;  3AYW A;  3AN2 A;  3AZG A;  5B1L B;  2HIO D;  4ZUX D;  4KUD C;  5CP6 D;  5BT1 D;  2CV5 C;  3AZK D;  1P3L A;  1P3P C;  4G92 C;  1ZLA B;  4HGA C;  5B31 B;  3AZL C;  3REK A;  3AZF D;  4Z2M H;  2ARO D;  2YFV A;  5CPI D;  5GT0 A;  4J8X C;  1S32 B;  5AV8 D;  1N1J B;  2NZD D;  4QLC A;  3REJ C;  4YM6 D;  5AY8 D;  5JRG A;  3MVD C;  4KUD A;  5E5A C;  4JJN C;  2PYO C;  1P3M B;  3W99 C;  3A6N D;  3MGS C;  5F99 B;  3WTP E;  3MGP C;  5B2J B;  5GXQ C;  3AZL A;  5CPJ A;  1M1A A;  3REL B;  5DNN B;  3MGR C;  5GT3 C;  4R8P B;  4M6B A;  4LD9 C;  3AV2 C;  5B32 B;  4J8V B;  4H9S A;  5DNM B;  3MVD A;  5E5A A;  5AVB D;  3AZJ B;  3X1S C;  3LEL D;  4JJN A;  2PYO A;  4H9O B;  5B2I B;  3LZ0 B;  3WKJ C;  3MGS A;  1P3F D;  3MNN D;  2NQB D;  4X23 B;  3MGP A;  5GXQ A;  5B1L C;  1M18 D;  1P3I A;  4XZQ C;  4CSR A;  5GT3 A;  3MGR A;  4WU9 B;  4LD9 A;  1TAF A;  4KGC D;  4CAY A;  5B31 C;  5B31 G;  2F8N D;  3WAA D;  3AZM B;  2FJ7 C;  1S32 C;  5AV5 D;  4XUJ B;  3UT9 B;  3W98 D;  3KWQ B;  5CPK B;  5B1L A;  5GSU C;  1M19 B;  3B6F C;  4Z66 B;  1HQ3 D;  3B0D B;  3VH5 T;  1ZLA A;  1WWI A;  4J8W B;  3UTA C;  3AV1 C;  3R45 A;  5B31 A;  3AZE D;  5B2J C;  2FJ7 A;  3KSY A;  5B0Z C;  1AOI D;  3W97 C;  4WU8 B;  1S32 A;  1N1J A;  5B32 C;  5B32 G;  1ID3 D;  1P3A D;  3O62 C;  3AZH C;  3X1U B;  3WTP D;  1P3M A;  3UTA A;  3AV1 A;  4Z5T D;  4X23 C;  5B2J A;  3X1T B;  3WA9 C;  5B0Z A;  3REL A;  3AYW D;  4WU9 C;  1F66 B;  3W96 C;  5B32 A;  5AV9 B;  5DNM A;  4YS3 C;  3TU4 D;  3AZM C;  1P3K C;  3REH D;  1U35 B;  3X1V D;  3AZJ A;  5B33 D;  1EQZ B;  4H9O A;  5B2I A;  3LZ0 A;  3LJA C;  1TZY B;  3KUY C;  1KX3 B;  4XUJ C;  3UT9 C;  3KWQ C;  4X23 A;  1P3O C;  3WA9 A;  5B24 D;  3B6G B;  3C1B B;  4J8U B;  2IO5 B;  4WU9 A;  4KUD D;  3UTB C;  3AZM A;  1P3K A;  3AN2 C;  2CV5 D;  5B0Y B;  1P3P D;  1KX5 C;  3LJA A;  4XUJ A;  5AV6 C;  3UT9 A;  3KWQ A;  3AZL D;  5CPK A;  1P3O A;  3MGQ D;  1M19 A;  4J8X D;  4Z66 A; 
#chains in the Genus database with same CATH topology
 2G5H C;  3X1U C;  3REJ D;  1WWS A;  4J8W A;  5GT0 C;  3MVD D;  3X1T C;  3AZN B;  1KX4 B;  4WV4 B;  4H9R B;  2PYO D;  4QLC C;  3W99 D;  1KX5 A;  2Y2Q A;  1F1E A;  3MGS D;  5JRG C;  2BYK B;  2HIO B;  4WU8 A;  2F8N K;  5AV6 A;  3MGP D;  5GXQ D;  5AV9 C;  5B1M D;  2Y2I A;  2G5I C;  4E45 A;  5JA4 B;  4NFT A;  5GT3 D;  1P3G C;  3AFA C;  1M1A C;  5CPJ C;  1EQZ C;  3AV2 D;  3X1U A;  3AZF B;  5FUG B;  2ARO B;  5CPI B;  3X1T A;  5AV8 B;  1HTA A;  3X1S D;  4H9S C;  3EPJ A;  3C1B C;  2NZD B;  4J8U C;  5B40 D;  2XD5 A;  3WKJ D;  4YM6 B;  5AV9 A;  5B1L D;  3VH6 W;  5C3I B;  4XZQ D;  1P3G A;  3A6N B;  3AFA A;  1EQZ A;  1KX3 A;  1P3I C;  4UUZ B;  2FJ7 D;  2Y2M A;  3KXB B;  3B6G A;  2JE5 A;  3C1B A;  1F66 C;  4J8U A;  5GSU D;  3LEL B;  3B6F D;  4DRB A;  1P3F B;  2Y2H A;  5B0Y A;  3MNN B;  2NQB B;  2HUE B;  4H9N B;  3UTA D;  3AV1 D;  5B0Z D;  1P34 D;  1ZLA C;  3W97 D;  4KGC B;  2YFW B;  1F66 A;  3WAA B;  2F8N B;  5B32 D;  3O62 D;  3AZN A;  1KX4 A;  3AZH D;  5AV5 B;  4H9R A;  3W98 B;  2BYK A;  2HIO A;  3REI D;  4X23 D;  3WA9 D;  3EPK A;  1HQ3 B;  5C3I C;  1P3M C;  5JA4 A;  3AZI B;  5BNX B;  5F99 C;  2ZM5 A;  2L5A A;  3AZE B;  3W96 D;  3REL C;  2LY8 A;  5FUG A;  5DNN C;  2ARO A;  2CWE A;  4YS3 D;  1P3K D;  3VH6 A;  1P3B D;  1AOI B;  4R8P C;  3KXB C;  5AV8 A;  4J8V C;  4G91 B;  4DRA A;  5DNM C;  3LJA D;  3KUY D;  1ID3 B;  3UT9 D;  3KWQ D;  3C1C B;  1P3O D;  3AZJ C;  3LZ1 B;  5B2I C;  3LZ0 C;  3WTP B;  4WZS B;  5F99 A;  3A6N A;  5KDM B;  2NQB C;  5DNN A;  4UUZ A;  3UTB D;  2Y2K A;  3AN2 D;  4R8P A;  3AZG D;  3KXB A;  4J8V A;  1KX5 D;  5AV6 D;  5BNV B;  3TU4 B;  2F8N G;  3REH B;  1P3L D;  5CHL B;  3X1V B;  5B33 B;  3LEL A;  2Y2L A;  3REK D;  5AV5 C;  5CPK C;  1P3F A;  4KHA B;  2NQB A;  4H9N A;  5GT0 D;  3NQU B;  1M19 C;  4Z66 C;  3X1T D;  3B0D C;  5B24 B;  1H3O B;  2XD1 A;  4QLC D;  3AZI C;  5AVC B;  4J8W C;  4KGC A;  2YFW A;  5JRG D;  3WAA A;  2F8N A;  4KUD B;  2CV5 B;  1P3P B;  1AOI C;  4G92 B;  4WU8 C;  1P3G D;  3AFA D;  1M1A D;  5AV5 A;  4G91 C;  5CPJ D;  1EQZ D;  3W98 A;  1A7W A;  2W8S A;  3MGQ B;  3C1C C;  4NE3 A;  4J8X B;  3LZ1 C;  2RVQ C;  3AZI A;  4J8U D;  5BNX A;  3A1K A;  3REJ B;  5E5A D;  1Q9C A;  3VH6 T;  3MVD B;  3AZE A;  4JJN D;  4AWL B;  2PYO B;  1AOI A;  3W99 B;  4ZUX B;  5CP6 B;  3MGP B;  1BH8 B;  1PZR A;  2F2A C;  5B1M B;  3AZK B;  1P3I D;  1U35 C;  3MGR D;  3C1C A;  4LD9 D;  3LZ1 A;  5B33 C;  2BYM B;  3AV2 B;  2BG1 A;  1TZY C;  3WTP A;  1KX3 C;  4CAY B;  3AL0 C;  4H9Q B;  5KDM A;  4H9P B;  2ZY3 A;  3B6G C;  3X1S B;  3V9R B;  2IO5 C;  5B40 B;  5AY8 B;  3WKJ B;  5AVC C;  2Y2J A;  2DQN C;  5BNV A;  3TU4 A;  1U35 A;  3REH A;  4XZQ B;  5B0Y C;  3X1V A;  5B33 A;  1ZLA D;  4E44 A;  1TZY A;  5BS7 A;  5B31 D;  3VH5 A;  3R45 B;  1B67 A;  4KHA A;  2FJ7 B;  3MGQ C;  4Z2M G;  3NQU A;  5B24 A;  1S32 D;  3P5J B;  1H3O A;  2JCH A;  4EO5 B;  1R4V A;  5AVC A;  5AVB B;  3B0C T;  5GSU B;  1BFM A;  5BO0 B;  3AZN C;  1KX4 C;  3B6F B;  2CV5 A;  4AWL C;  1P3M D;  2Y2O A;  1P3P A;  2HIO C;  5F99 D;  4ZUX C;  3UTA B;  3AV1 B;  5B2J D;  1M18 B;  5CP6 C;  5BT1 C;  3REL D;  5B1M C;  3AZK C;  5B0Z B;  5DNN D;  1P34 B;  3MGQ A;  3W97 B;  4R8P D;  4J8X A;  3KXB D;  4J8V D;  3AZF C;  2ARO C;  5DNM D;  3REJ A;  5CPI C;  3AZJ D;  5AV8 C;  3O62 B;  5B2I D;  3LZ0 D;  3AZH B;  1JFI B;  2NZD C;  3W99 A;  4YM6 C;  5B40 C;  5AY8 C;  4ZUX A;  3B0C W;  5G49 B;  5CP6 A;  3REI B;  1BH8 A;  5B1M A;  3AZK A;  3WA9 B;  3A6N C;  4WU9 D;  2BYM A;  3AZF A;  3AV2 A;  3W96 B;  1KU5 A;  3AZM D;  4NE6 A;  4YS3 B;  5CPI A;  4H9Q A;  1P3B B;  1P3K B;  4WNN B;  4H9P A;  3X1S A;  2NZD A;  3V9R A;  4XUJ D;  3LJA B;  4YM6 A;  5B40 A;  5AY8 A;  3KUY B;  5CPK D;  3NQJ B;  4EO5 C;  1P3A B;  5AVB C;  3WKJ A;  4WJ3 C;  1P3O B;  4ZBJ B;  3LEL C;  1M19 D;  4Z66 D;  1BH9 B;  1P3F C;  4XZQ A;  4Z5T B;  3MNN C;  2HUE C;  1W2E A;  3B0B A;  3AZI D;  4J8W D;  1M18 C;  3UTB B;  3AYW B;  3AN2 B;  1P34 C;  3AZG B;  4KGC C;  1KX5 B;  4WU8 D;  2F8N H;  3WAA C;  5AV6 B;  5AVB A;  1P3L B;  5GSU A;  5BO0 A;  3C1C D;  3B6F A;  3LZ1 D;  3REK B;  3X1U D;  3MNN A;  3W98 C;  2RVQ D;  2YFV B;  5GT0 B;  1M18 A;  3REI C;  1HQ3 C;  4UPK A;  2JSS A;  1P34 A;  3VH5 W;  4QLC B;  3W97 A;  3AZE C;  5JRG B;  5AV9 D;  2Y2N A;  2VQR A;  1U35 D;  1P3B C;  4HGA B;  3O62 A;  1P3G B;  3AFA B;  3AZL B;  3AZH A;  5CPJ B;  1M1A B;  1ULY A;  1JFI A;  1TZY D;  1KX3 D;  1ID3 C;  4NE5 A;  5G49 A;  2UWX A;  1P3A C;  3REI A;  1HQ3 A;  4ZBJ C;  3B6G D;  3WTP C;  3C1B D;  4Z5T C;  5E5A B;  5AVC D;  3W96 A;  4JJN B;  4YS3 A;  3AYW C;  2Y2G A;  1P3B A;  4WNN A;  3MGS B;  5B0Y D;  3AZG C;  5GXQ B;  1ID3 A;  3KUY A;  3TU4 C;  1P3I B;  3REH C;  3NQJ A;  1P3A A;  3MGR B;  3F6T A;  4CSR B;  5GT3 B;  3X1V C;  1P3L C;  3EPH A;  4LD9 B;  1TAF B;  5BS7 C;  1F66 D;  1BH9 A;  3REK C;  4Z5T A;  1Z2C B;  5B24 C;  1B6W A;  3AZN D;  1KX4 D;  3UTB A;  3AYW A;  3AN2 A;  3AZG A;  5B1L B;  2HIO D;  4ZUX D;  4KUD C;  5CP6 D;  5BT1 D;  2CV5 C;  3AZK D;  1P3L A;  1P3P C;  4G92 C;  3H0M C;  2ZY4 A;  1ZLA B;  4HGA C;  5B31 B;  3AZL C;  3REK A;  3AZF D;  4Z2M H;  2ARO D;  2YFV A;  1T3U A;  3A1I A;  5GT0 A;  5CPI D;  4J8X C;  4DQY B;  1S32 B;  5AV8 D;  1N1J B;  2NZD D;  4QLC A;  3REJ C;  4YM6 D;  5AY8 D;  5JRG A;  3MVD C;  4KUD A;  5E5A C;  4JJN C;  2PYO C;  1P3M B;  3W99 C;  3A6N D;  3MGS C;  5F99 B;  3WTP E;  3MGP C;  5B2J B;  5GXQ C;  3AZL A;  5CPJ A;  1M1A A;  3H0L C;  3REL B;  5DNN B;  3MGR C;  5GT3 C;  4R8P B;  4M6B A;  4LD9 C;  3AV2 C;  5B32 B;  4J8V B;  4H9S A;  5DNM B;  3MVD A;  5E5A A;  5AVB D;  3AZJ B;  3X1S C;  3LEL D;  4JJN A;  2PYO A;  4H9O B;  5B2I B;  3LZ0 B;  3FDD A;  3WKJ C;  3MGS A;  1P3F D;  3MNN D;  2NQB D;  4X23 B;  3MGP A;  5GXQ A;  5B1L C;  3EPL A;  2ZY2 A;  1P3I A;  1M18 D;  4XZQ C;  4CSR A;  5GT3 A;  3MGR A;  4WU9 B;  4LD9 A;  1TAF A;  4KGC D;  4CAY A;  3IP4 C;  2J8P A;  5B31 C;  5B31 G;  2F8N D;  3WAA D;  3AZM B;  2FJ7 C;  1S32 C;  5AV5 D;  4XUJ B;  3UT9 B;  3W98 D;  3KWQ B;  5CPK B;  5B1L A;  5GSU C;  1M19 B;  3B6F C;  4Z66 B;  1HQ3 D;  2FFF B;  3B0D B;  3VH5 T;  3H0R C;  2DF4 C;  1ZLA A;  1WWI A;  4J8W B;  3UTA C;  3AV1 C;  3R45 A;  5B31 A;  3AZE D;  5B2J C;  2FJ7 A;  3KSY A;  5B0Z C;  1AOI D;  3W97 C;  3EG5 B;  4WU8 B;  1S32 A;  1N1J A;  5B32 C;  5B32 G;  1ID3 D;  3KFU G;  1P3A D;  2RIQ A;  3O62 C;  3AZH C;  3X1U B;  3WTP D;  1P3M A;  3UTA A;  3AV1 A;  4Z5T D;  4X23 C;  5B2J A;  3X1T B;  3WA9 C;  5B0Z A;  3REL A;  3AYW D;  4WU9 C;  1F66 B;  3W96 C;  5B32 A;  5AV9 B;  5DNM A;  4YS3 C;  3TU4 D;  3AZM C;  1P3K C;  3REH D;  1U35 B;  3X1V D;  2Y2P A;  3AZJ A;  5B33 D;  1EQZ B;  4H9O A;  5B2I A;  3LZ0 A;  3LJA C;  1TZY B;  3KUY C;  1KX3 B;  4XUJ C;  3UT9 C;  3KWQ C;  4X23 A;  1P3O C;  3WA9 A;  5B24 D;  3B6G B;  3C1B B;  4J8U B;  2IO5 B;  4WU9 A;  4KUD D;  3UTB C;  3AZM A;  1P3K A;  3AN2 C;  2CV5 D;  5B0Y B;  1P3P D;  1KX5 C;  3LJA A;  4XUJ A;  5AV6 C;  3UT9 A;  3KWQ A;  3AZL D;  5CPK A;  1P3O A;  2ZY5 A;  3MGQ D;  1M19 A;  4J8X D;  4Z66 A; 
#chains in the Genus database with same CATH homology
 2G5H C;  3X1U C;  3REJ D;  1WWS A;  4J8W A;  5GT0 C;  3MVD D;  3X1T C;  3AZN B;  1KX4 B;  4WV4 B;  4H9R B;  2PYO D;  4QLC C;  3W99 D;  1KX5 A;  2Y2Q A;  1F1E A;  3MGS D;  5JRG C;  2BYK B;  2HIO B;  4WU8 A;  2F8N K;  5AV6 A;  3MGP D;  5GXQ D;  5AV9 C;  5B1M D;  2Y2I A;  2G5I C;  4E45 A;  5JA4 B;  4NFT A;  5GT3 D;  1P3G C;  3AFA C;  1M1A C;  5CPJ C;  1EQZ C;  3AV2 D;  3X1U A;  3AZF B;  5FUG B;  2ARO B;  5CPI B;  3X1T A;  5AV8 B;  1HTA A;  3X1S D;  4H9S C;  3EPJ A;  3C1B C;  2NZD B;  4J8U C;  5B40 D;  2XD5 A;  3WKJ D;  4YM6 B;  5AV9 A;  5B1L D;  3VH6 W;  5C3I B;  4XZQ D;  1P3G A;  3A6N B;  3AFA A;  1EQZ A;  1KX3 A;  1P3I C;  4UUZ B;  2FJ7 D;  2Y2M A;  3KXB B;  3B6G A;  2JE5 A;  3C1B A;  1F66 C;  4J8U A;  5GSU D;  3LEL B;  3B6F D;  4DRB A;  1P3F B;  2Y2H A;  5B0Y A;  3MNN B;  2NQB B;  2HUE B;  4H9N B;  3UTA D;  3AV1 D;  5B0Z D;  1P34 D;  1ZLA C;  3W97 D;  4KGC B;  2YFW B;  1F66 A;  3WAA B;  2F8N B;  5B32 D;  3O62 D;  3AZN A;  1KX4 A;  3AZH D;  5AV5 B;  4H9R A;  3W98 B;  2BYK A;  2HIO A;  3REI D;  4X23 D;  3WA9 D;  3EPK A;  1HQ3 B;  5C3I C;  1P3M C;  5JA4 A;  3AZI B;  5BNX B;  5F99 C;  2ZM5 A;  2L5A A;  3AZE B;  3W96 D;  3REL C;  2LY8 A;  5FUG A;  5DNN C;  2ARO A;  2CWE A;  4YS3 D;  1P3K D;  3VH6 A;  1P3B D;  1AOI B;  4R8P C;  3KXB C;  5AV8 A;  4J8V C;  4G91 B;  4DRA A;  5DNM C;  3LJA D;  3KUY D;  1ID3 B;  3UT9 D;  3KWQ D;  3C1C B;  1P3O D;  3AZJ C;  3LZ1 B;  5B2I C;  3LZ0 C;  3WTP B;  4WZS B;  5F99 A;  3A6N A;  5KDM B;  2NQB C;  5DNN A;  4UUZ A;  3UTB D;  2Y2K A;  3AN2 D;  4R8P A;  3AZG D;  3KXB A;  4J8V A;  1KX5 D;  5AV6 D;  5BNV B;  3TU4 B;  2F8N G;  3REH B;  1P3L D;  5CHL B;  3X1V B;  5B33 B;  3LEL A;  2Y2L A;  3REK D;  5AV5 C;  5CPK C;  1P3F A;  4KHA B;  2NQB A;  4H9N A;  5GT0 D;  3NQU B;  1M19 C;  4Z66 C;  3X1T D;  3B0D C;  5B24 B;  1H3O B;  2XD1 A;  4QLC D;  3AZI C;  5AVC B;  4J8W C;  4KGC A;  2YFW A;  5JRG D;  3WAA A;  2F8N A;  4KUD B;  2CV5 B;  1P3P B;  1AOI C;  4G92 B;  4WU8 C;  1P3G D;  3AFA D;  1M1A D;  5AV5 A;  4G91 C;  5CPJ D;  1EQZ D;  3W98 A;  1A7W A;  2W8S A;  3MGQ B;  3C1C C;  4NE3 A;  4J8X B;  3LZ1 C;  2RVQ C;  3AZI A;  4J8U D;  5BNX A;  3A1K A;  3REJ B;  5E5A D;  1Q9C A;  3VH6 T;  3MVD B;  3AZE A;  4JJN D;  4AWL B;  2PYO B;  1AOI A;  3W99 B;  4ZUX B;  5CP6 B;  3MGP B;  1BH8 B;  1PZR A;  2F2A C;  5B1M B;  3AZK B;  1P3I D;  1U35 C;  3MGR D;  3C1C A;  4LD9 D;  3LZ1 A;  5B33 C;  2BYM B;  3AV2 B;  2BG1 A;  1TZY C;  3WTP A;  1KX3 C;  4CAY B;  3AL0 C;  4H9Q B;  5KDM A;  4H9P B;  2ZY3 A;  3B6G C;  3X1S B;  3V9R B;  2IO5 C;  5B40 B;  5AY8 B;  3WKJ B;  5AVC C;  2Y2J A;  2DQN C;  5BNV A;  3TU4 A;  1U35 A;  3REH A;  4XZQ B;  5B0Y C;  3X1V A;  5B33 A;  1ZLA D;  4E44 A;  1TZY A;  5BS7 A;  5B31 D;  3VH5 A;  3R45 B;  1B67 A;  4KHA A;  2FJ7 B;  3MGQ C;  4Z2M G;  3NQU A;  5B24 A;  1S32 D;  3P5J B;  1H3O A;  2JCH A;  4EO5 B;  1R4V A;  5AVC A;  5AVB B;  3B0C T;  5GSU B;  1BFM A;  5BO0 B;  3AZN C;  1KX4 C;  3B6F B;  2CV5 A;  4AWL C;  1P3M D;  2Y2O A;  1P3P A;  2HIO C;  5F99 D;  4ZUX C;  3UTA B;  3AV1 B;  5B2J D;  1M18 B;  5CP6 C;  5BT1 C;  3REL D;  5B1M C;  3AZK C;  5B0Z B;  5DNN D;  1P34 B;  3MGQ A;  3W97 B;  4R8P D;  4J8X A;  3KXB D;  4J8V D;  3AZF C;  2ARO C;  5DNM D;  3REJ A;  5CPI C;  3AZJ D;  5AV8 C;  3O62 B;  5B2I D;  3LZ0 D;  3AZH B;  1JFI B;  2NZD C;  3W99 A;  4YM6 C;  5B40 C;  5AY8 C;  4ZUX A;  3B0C W;  5G49 B;  5CP6 A;  3REI B;  1BH8 A;  5B1M A;  3AZK A;  3WA9 B;  3A6N C;  4WU9 D;  2BYM A;  3AZF A;  3AV2 A;  3W96 B;  1KU5 A;  3AZM D;  4NE6 A;  4YS3 B;  5CPI A;  4H9Q A;  1P3B B;  1P3K B;  4WNN B;  4H9P A;  3X1S A;  2NZD A;  3V9R A;  4XUJ D;  3LJA B;  4YM6 A;  5B40 A;  5AY8 A;  3KUY B;  5CPK D;  3NQJ B;  4EO5 C;  1P3A B;  5AVB C;  3WKJ A;  4WJ3 C;  1P3O B;  4ZBJ B;  3LEL C;  1M19 D;  4Z66 D;  1BH9 B;  1P3F C;  4XZQ A;  4Z5T B;  3MNN C;  2HUE C;  1W2E A;  3B0B A;  3AZI D;  4J8W D;  1M18 C;  3UTB B;  3AYW B;  3AN2 B;  1P34 C;  3AZG B;  4KGC C;  1KX5 B;  4WU8 D;  2F8N H;  3WAA C;  5AV6 B;  5AVB A;  1P3L B;  5GSU A;  5BO0 A;  3C1C D;  3B6F A;  3LZ1 D;  3REK B;  3X1U D;  3MNN A;  3W98 C;  2RVQ D;  2YFV B;  5GT0 B;  1M18 A;  3REI C;  1HQ3 C;  4UPK A;  2JSS A;  1P34 A;  3VH5 W;  4QLC B;  3W97 A;  3AZE C;  5JRG B;  5AV9 D;  2Y2N A;  2VQR A;  1U35 D;  1P3B C;  4HGA B;  3O62 A;  1P3G B;  3AFA B;  3AZL B;  3AZH A;  5CPJ B;  1M1A B;  1ULY A;  1JFI A;  1TZY D;  1KX3 D;  1ID3 C;  4NE5 A;  5G49 A;  2UWX A;  1P3A C;  3REI A;  1HQ3 A;  4ZBJ C;  3B6G D;  3WTP C;  3C1B D;  4Z5T C;  5E5A B;  5AVC D;  3W96 A;  4JJN B;  4YS3 A;  3AYW C;  2Y2G A;  1P3B A;  4WNN A;  3MGS B;  5B0Y D;  3AZG C;  5GXQ B;  1ID3 A;  3KUY A;  3TU4 C;  1P3I B;  3REH C;  3NQJ A;  1P3A A;  3MGR B;  3F6T A;  4CSR B;  5GT3 B;  3X1V C;  1P3L C;  3EPH A;  4LD9 B;  1TAF B;  5BS7 C;  1F66 D;  1BH9 A;  3REK C;  4Z5T A;  1Z2C B;  5B24 C;  1B6W A;  3AZN D;  1KX4 D;  3UTB A;  3AYW A;  3AN2 A;  3AZG A;  5B1L B;  2HIO D;  4ZUX D;  4KUD C;  5CP6 D;  5BT1 D;  2CV5 C;  3AZK D;  1P3L A;  1P3P C;  4G92 C;  3H0M C;  2ZY4 A;  1ZLA B;  4HGA C;  5B31 B;  3AZL C;  3REK A;  3AZF D;  4Z2M H;  2ARO D;  2YFV A;  1T3U A;  3A1I A;  5GT0 A;  5CPI D;  4J8X C;  4DQY B;  1S32 B;  5AV8 D;  1N1J B;  2NZD D;  4QLC A;  3REJ C;  4YM6 D;  5AY8 D;  5JRG A;  3MVD C;  4KUD A;  5E5A C;  4JJN C;  2PYO C;  1P3M B;  3W99 C;  3A6N D;  3MGS C;  5F99 B;  3WTP E;  3MGP C;  5B2J B;  5GXQ C;  3AZL A;  5CPJ A;  1M1A A;  3H0L C;  3REL B;  5DNN B;  3MGR C;  5GT3 C;  4R8P B;  4M6B A;  4LD9 C;  3AV2 C;  5B32 B;  4J8V B;  4H9S A;  5DNM B;  3MVD A;  5E5A A;  5AVB D;  3AZJ B;  3X1S C;  3LEL D;  4JJN A;  2PYO A;  4H9O B;  5B2I B;  3LZ0 B;  3FDD A;  3WKJ C;  3MGS A;  1P3F D;  3MNN D;  2NQB D;  4X23 B;  3MGP A;  5GXQ A;  5B1L C;  3EPL A;  2ZY2 A;  1P3I A;  1M18 D;  4XZQ C;  4CSR A;  5GT3 A;  3MGR A;  4WU9 B;  4LD9 A;  1TAF A;  4KGC D;  4CAY A;  3IP4 C;  2J8P A;  5B31 C;  5B31 G;  2F8N D;  3WAA D;  3AZM B;  2FJ7 C;  1S32 C;  5AV5 D;  4XUJ B;  3UT9 B;  3W98 D;  3KWQ B;  5CPK B;  5B1L A;  5GSU C;  1M19 B;  3B6F C;  4Z66 B;  1HQ3 D;  2FFF B;  3B0D B;  3VH5 T;  3H0R C;  2DF4 C;  1ZLA A;  1WWI A;  4J8W B;  3UTA C;  3AV1 C;  3R45 A;  5B31 A;  3AZE D;  5B2J C;  2FJ7 A;  3KSY A;  5B0Z C;  1AOI D;  3W97 C;  3EG5 B;  4WU8 B;  1S32 A;  1N1J A;  5B32 C;  5B32 G;  1ID3 D;  3KFU G;  1P3A D;  2RIQ A;  3O62 C;  3AZH C;  3X1U B;  3WTP D;  1P3M A;  3UTA A;  3AV1 A;  4Z5T D;  4X23 C;  5B2J A;  3X1T B;  3WA9 C;  5B0Z A;  3REL A;  3AYW D;  4WU9 C;  1F66 B;  3W96 C;  5B32 A;  5AV9 B;  5DNM A;  4YS3 C;  3TU4 D;  3AZM C;  1P3K C;  3REH D;  1U35 B;  3X1V D;  2Y2P A;  3AZJ A;  5B33 D;  1EQZ B;  4H9O A;  5B2I A;  3LZ0 A;  3LJA C;  1TZY B;  3KUY C;  1KX3 B;  4XUJ C;  3UT9 C;  3KWQ C;  4X23 A;  1P3O C;  3WA9 A;  5B24 D;  3B6G B;  3C1B B;  4J8U B;  2IO5 B;  4WU9 A;  4KUD D;  3UTB C;  3AZM A;  1P3K A;  3AN2 C;  2CV5 D;  5B0Y B;  1P3P D;  1KX5 C;  3LJA A;  4XUJ A;  5AV6 C;  3UT9 A;  3KWQ A;  3AZL D;  5CPK A;  1P3O A;  2ZY5 A;  3MGQ D;  1M19 A;  4J8X D;  4Z66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...