3WA9B

The nucleosome containing human h2a.z.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9B00
3C1BB 4XZQA 5B0YA 3REKB 5JA4A 2BYKB 2FJ7B 3X1SB 4WU9C 4KUDA 4NFTA 4J8WA 1ULYA 1P3FC 4CSRA 1AOIA 4H9PB 5AVBA 3AZJB 2HIOC 3UTBB 4EO5B 3W99A 4H9SC 1P3GB 2HIOD 4QLCC 1P3OA 5E5AB 4X23C 3LELA 5B2IC 3X1TC 4J8VC 3AV2A 5BT1C 4X23D 3C1BA 4AWLB 3REKA 5B2ID 2BYKA 2FJ7A 5BT1D 5GT0C 3UTBA 5GT0D 5BS7C 3O62C 1P3GA 3REIA 2NQBA 3AZMC 1M1AC 3O62D 4R8PC 4G91B 5E5AA 3AZMD 3WAAC 1M1AD 4R8PD 1WWIA 3B0DC 5B0YD 3X1VC 3AV1C 3X1VD 4WU8B 3RELA 1KX3B 1ZLAD 3B6FC 5KDMB 4HGAC 3MGRC 3AZIC 4KGCD 3B6FD 5GXQB 3AZFC 3MGRD 3AZID 3AZKC 3WKJB 5B1MB 5CPIC 5GSUC 2YFWA 5C3IC 5B40B 3KSYA 3AZHD 5CPID 5GSUD 3AV2D 5G49B 2IO5B 5JRGB 3LZ1D 4LD9C 3REJC 2AROC 3X1SD 1P3KC 4UUZA 5B32B 3A6NB 3REJD 3AZLC 4LD9D 5CPKC 2AROD 3MGQC 4WU8A 1P3KD 5KDMA 3AZLD 3AZJD 5B31A 3MGQD 4JJNC 5GXQA 4WU9B 4Z5TC 3REHC 2JSSA 1P3FB 3WKJA 5B1MA 4JJND 1HQ3C 3REHD 1S32C 5B40A 1TZYC 2HIOB 3UTAA 3AZGC 5G49A 4YM6C 5JRGA 1S32D 1TZYD 4Z66D 3TU4C 5CPJA 4XUJC 4YM6D 5B32A 3A6NA 4XUJD 5BO0B 4X23B 5B2IB 1A7WA 3X1TB 4WNNB 1JFIB 4WU9A 5B2JC 5GT0B 1KX4C 3C1CC 2HIOA 3AYWD 3O62B 1KX4D 3W98C 5B24C 4J8XC 4H9SA 2LY8A 1F66C 3AZMB 1M1AB 1KX5C 4R8PB 3W98D 5B24D 1KX3D 3WAAB 4X23A 1KX5D 4KHAB 5B2IA 3B0DB 4H9NB 4WNNA 3VH5W 3X1VB 1B67A 5GXQD 3AV1B 1P3PC 1JFIA 2PYOC 3B6FB 5DNMC 4HGAB 5GT0A 5B31G 2PYOD 1ID3C 3MGRB 3AZIB 1M19C 5B33C 3AN2D 5DNMD 5BS7A 3O62A 3AZFB 1ID3D 3AZKB 1M19D 3WA9C 5CPIB 5GSUB 5AV8D 3AZMA 1M1AA 3AZEC 4R8PA 5C3IB 3WA9D 5AV5C 3AZED 4KHAA 4H9NA 3X1VA 3REJB 4LD9B 2AROB 4WU9D 1ZLAA 4NE6A 1P3KB 1P3FD 3AZLB 5CPKB 3MGQB 4KGCA 3B6FA 3MGRA 1H3OA 3AZIA 4JJNB 2CV5C 4Z5TB 3REHB 3NQUB 3AZHA 5CPIA 1HQ3B 5GSUA 4QLCD 3LZ1A 1S32B 1TZYB 4Z66B 3MGSC 3X1TD 4J8VD 3X1SA 3AZGB 4YM6B 4H9PA 3MGSD 3REJA 5AV9C 4XUJB 4LD9A 2AROA 1P3KA 3AZLA 3AZJA 3MGQA 4YS3C 5AV6C 4YS3D 2BYMB 4JJNA 3REHA 5B2JB 5CHLB 1HQ3A 1WWSA 3V9RB 3AYWB 1KX4B 4H9RB 4ZBJC 4NE5A 3VH5T 4Z2MH 3C1CB 1TZYA 4Z66A 1S32A 3WAAD 3AZGA 3W98B 5B24B 4YM6A 4J8XB 1F66B 3MNNC 3AV1D 5BNXB 4XUJA 1KX5B 3KXBC 3B6GC 3MNND 3VH5A 3WTPC 3KXBD 3AZFD 2BYMA 3WTPD 3AZKD 5F99C 2F8ND 2PYOB 3AN2B 5DNMB 3AYWA 1KX4A 4H9RA 5B1LC 1ID3B 3B0BA 1M19B 3W96C 5AV8B 2CWEA 5B1LD 5B24A 3W98A 3WA9B 3MGPC 1KX3A 3W96D 5BNXA 1KX5A 3AZEB 3KWQC 5AV5B 5CPKD 3KWQD 3AZNC 4Z5TD 4J8UC 3AZND 2PYOA 5FUGB 5BNVB 1HQ3D 3AN2A 5DNMA 4J8UD 1ID3A 1M19A 5B0ZC 3AZGD 5AV8A 2CV5B 4QLCB 3TU4D 3WA9A 5B0ZD 4J8VB 3AZEA 1P34C 3REIC 4M6BA 4DRAA 2NQBC 3MGSB 4Z2MG 4G92C 1P34D 5E5AC 1P3FA 5AV9B 5B2JD 5FUGA 5BNVA 3LJAC 4YS3B 3C1CD 5AV6B 3LJAD 3RELC 4QLCA 4J8XD 1F66D 1KU5A 5BO0A 3X1TA 3R45B 4J8VA 1BH8B 4ZBJB 3MGSA 3W97C 1U35C 1Q9CA 3KUYC 1M18C 3MNNB 1P3PD 3W97D 3B0CT 1U35D 3KXBB 1M18D 3B6GB 4YS3A 3A6ND 3WTPB 2F8NB 5B33D 5CP6C 5AY8C 5F99B 5B31C 5CP6D 5AY8D 3WAAA 3LZ0C 3R45A 1EQZC 1BH8A 5B1LB 5AV5D 5B32G 3AV1A 3UT9C 3LZ0D 3W96B 1EQZD 3MGPB 3MNNA 3UT9D 1TAFB 3UTAC 2F8NH 1BFMA 3KWQB 3KXBA 5CPJC 1HTAA 2F8NK 1P3LC 3AZFA 3WTPA 3AZKA 3AZNB 2F8NA 3VH6W 1P3LD 2CV5D 2NZDC 1R4VA 4WZSB 4J8UB 1F1EA 4CAYB 4DRBA 2NZDD 5B1LA 3TU4B 5B0ZB 1P3BC 3W96A 2HUEC 5AV9D 3MGPA 5CPKA 1P3BD 4NE3A 1TAFA 3X1UC 1P34B 3KWQA 3MVDC 3REIB 1P3IC 2NQBB 1P3AC 3X1UD 4G92B 4Z5TA 5AV6D 3MVDD 3NQUA 3AZNA 1P3ID 1P3AD 5DNNC 3AFAC 4J8UA 4CAYA 3LJAB 5DNND 3AFAD 4ZUXC 1B6WA 3TU4A 5GT3C 3RELB 5B0ZA 4ZUXD 5GT3D 2L5AA 4WV4B 3B6GD 1P34A 1P3MC 5AVCC 1P3PB 3W97B 2YFWB 1U35B 5B2JA 3KUYB 1P3MD 4XZQC 5B0YC 1M18B 4KUDC 4H9OB 5AVCD 3V9RA 3B0CW 5F99D 4J8WC 1AOIC 3C1CA 4H9QB 4XZQD 5B33B 4KUDD 3LJAA 1ZLAC 2F8NG 4UUZB 5AVBC 4J8WD 1AOID 4J8XA 1F66A 4KGCC 5CP6B 5AY8B 5AVBD 3W99C 3MGPD 5B31B 3W99D 3LZ0B 1P3OC 1EQZB 3AZHC 3LELC 3UT9B 3VH6T 1P3PA 3AV2C 2RVQC 1P3OD 3W97A 3LZ1C 1U35A 3KUYA 3C1BC 1M18A 3LELD 3REKC 3UTAB 2FJ7C 4H9OA 3X1SC 2RVQD 5CPJB 3C1BD 4H9QA 5B33A 3REKD 2FJ7D 1P3LB 3VH6A 3AZJC 3UTBC 5CP6A 5AY8A 2NZDB 4EO5C 1P3GC 5AV5A 3UTBD 2YFVB 3LZ0A 1EQZA 1P3GD 3REID 2NQBD 1P3BB 3UT9A 2HUEB 5E5AD 4Z66C 4AWLC 3X1UB 3MVDB 1P3IB 1P3AB 1P3LA 2CV5A 3RELD 2NZDA 5DNNB 3AFAB 1N1JB 2YFVA 4G91C 4ZUXB 5GT3B 5AV9A 3WTPE 3AYWC 1P3BA 3KUYD 1BH9B 3NQJB 3X1UA 5AV6A 3MVDA 1P3IA 1P3MB 4E45A 4WU8C 1KX3C 5AVCB 1P3AA 4XZQB 5B0YB 4WU8D 5JA4B 4KUDB 5GXQC 4J8WB 5DNNA 3AFAA 1N1JA 4CSRB 1AOIB 5B31D 3WKJC 5B1MC 1ZLAB 5AVBB 4ZUXA 5B40C 3WKJD 5B1MD 5GT3A 3AN2C 4KGCB 3W99B 2IO5C 5JRGC 5B40D 1H3OB 3B6GA 3UTAD 1BH9A 5AV8C 1P3OB 5JRGD 4E44A 5B32C 3NQJA 5CPJD 3A6NC 1P3MA 3AZHB 3LELB 5AVCA 3AV2B 5B32D 5F99A 3LZ1B
chains in the Genus database with same CATH superfamily
3C1BB 4XZQA 5B0YA 3REKB 5JA4A 2BYKB 2FJ7B 3X1SB 4WU9C 4KUDA 4NFTA 4J8WA 1ULYA 1P3FC 4CSRA 1AOIA 4H9PB 5AVBA 3AZJB 2HIOC 3UTBB 4EO5B 3W99A 4H9SC 1P3GB 4WJ3C 2HIOD 4QLCC 1P3OA 5E5AB 4X23C 3LELA 5B2IC 3X1TC 4J8VC 3AV2A 5BT1C 4X23D 3C1BA 4AWLB 3REKA 5B2ID 2BYKA 2RIQA 2FJ7A 5BT1D 5GT0C 3UTBA 5GT0D 5BS7C 3O62C 3F6TA 1P3GA 3REIA 2NQBA 3AZMC 1M1AC 3O62D 4R8PC 4G91B 3FDDA 5E5AA 3AZMD 3WAAC 1M1AD 4R8PD 1WWIA 3B0DC 5B0YD 3X1VC 3AV1C 3X1VD 4WU8B 3RELA 1KX3B 1ZLAD 3B6FC 5KDMB 4HGAC 3MGRC 3AZIC 4KGCD 3B6FD 5GXQB 3AZFC 3MGRD 3AZID 3AZKC 3WKJB 5B1MB 5CPIC 5GSUC 2Y2MA 2YFWA 5C3IC 5B40B 3KSYA 3AZHD 5CPID 5GSUD 3AV2D 5G49B 2IO5B 5JRGB 3LZ1D 4LD9C 3REJC 2AROC 3X1SD 1P3KC 4UUZA 5B32B 3A6NB 3REJD 3AZLC 4LD9D 5CPKC 2AROD 3MGQC 4WU8A 1P3KD 5KDMA 3AZLD 3AZJD 5B31A 3MGQD 2ZY2A 4JJNC 5GXQA 4WU9B 4Z5TC 3REHC 2JSSA 1P3FB 3WKJA 5B1MA 4JJND 1HQ3C 3REHD 1S32C 5B40A 1TZYC 2HIOB 3UTAA 3AZGC 5G49A 4YM6C 5JRGA 1S32D 1TZYD 4Z66D 3TU4C 5CPJA 1Z2CB 4XUJC 4YM6D 5B32A 1PZRA 3A6NA 4XUJD 5BO0B 4X23B 5B2IB 1A7WA 3X1TB 4WNNB 2F2AC 2Y2KA 1JFIB 4WU9A 5B2JC 5GT0B 2ZY4A 1KX4C 3C1CC 2HIOA 3AYWD 3O62B 1KX4D 3W98C 5B24C 4J8XC 4H9SA 2LY8A 1F66C 3AZMB 1M1AB 1KX5C 4R8PB 3W98D 5B24D 1KX3D 3WAAB 4X23A 1KX5D 4KHAB 5B2IA 3B0DB 4H9NB 4WNNA 3VH5W 3X1VB 1B67A 5GXQD 3AV1B 1P3PC 1JFIA 2DF4C 2PYOC 2Y2IA 3B6FB 5DNMC 3P5JB 4HGAB 5GT0A 5B31G 2PYOD 1ID3C 3MGRB 3AZIB 1M19C 5B33C 3AN2D 5DNMD 5BS7A 3O62A 3AZFB 1ID3D 3AZKB 1M19D 3WA9C 5CPIB 5GSUB 5AV8D 3AZMA 1M1AA 3AZEC 4R8PA 5C3IB 3H0MC 3WA9D 5AV5C 3AZED 4KHAA 4H9NA 3X1VA 3REJB 4LD9B 2AROB 4WU9D 1ZLAA 4NE6A 1P3KB 1P3FD 3AZLB 5CPKB 3MGQB 4KGCA 1W2EA 3B6FA 3MGRA 1H3OA 3AZIA 4JJNB 2CV5C 4Z5TB 3REHB 3NQUB 3AZHA 5CPIA 1HQ3B 5GSUA 4QLCD 3LZ1A 1S32B 1TZYB 4Z66B 3MGSC 3X1TD 4J8VD 3X1SA 3AZGB 4YM6B 4DQYB 4H9PA 3MGSD 3REJA 5AV9C 4XUJB 4LD9A 2AROA 3KFUG 1P3KA 3AZLA 3AZJA 3MGQA 4YS3C 5AV6C 4YS3D 2BYMB 4JJNA 3REHA 5B2JB 5CHLB 1HQ3A 1WWSA 3V9RB 3AYWB 1KX4B 4H9RB 4ZBJC 4NE5A 3VH5T 4Z2MH 3C1CB 1TZYA 4Z66A 1S32A 3WAAD 3AZGA 3W98B 5B24B 4YM6A 4J8XB 1F66B 3MNNC 3AV1D 5BNXB 4XUJA 1KX5B 3KXBC 3B6GC 3MNND 3VH5A 3WTPC 3KXBD 3AZFD 2BYMA 3EPJA 3WTPD 3AZKD 5F99C 2F8ND 2PYOB 2Y2PA 3AN2B 5DNMB 3AYWA 3IP4C 1KX4A 4H9RA 5B1LC 1ID3B 3B0BA 1M19B 3W96C 5AV8B 2CWEA 5B1LD 5B24A 3W98A 3WA9B 3MGPC 1KX3A 3W96D 5BNXA 1KX5A 3AZEB 3KWQC 5AV5B 5CPKD 3KWQD 3AZNC 4Z5TD 4J8UC 3AZND 2PYOA 5FUGB 5BNVB 1HQ3D 3AN2A 5DNMA 4J8UD 2VQRA 1ID3A 1M19A 5B0ZC 3AZGD 5AV8A 2CV5B 4QLCB 3TU4D 3WA9A 5B0ZD 4J8VB 3AZEA 1P34C 3REIC 4M6BA 4DRAA 2NQBC 3MGSB 4Z2MG 4G92C 1P34D 5E5AC 1P3FA 5AV9B 5B2JD 5FUGA 5BNVA 3LJAC 4YS3B 3C1CD 5AV6B 3LJAD 3RELC 4QLCA 3EPLA 4J8XD 1F66D 1KU5A 5BO0A 3X1TA 3R45B 4J8VA 1BH8B 4ZBJB 2W8SA 3MGSA 3W97C 1U35C 1Q9CA 3KUYC 1M18C 3MNNB 1P3PD 3W97D 3AL0C 3B0CT 1U35D 3KXBB 1M18D 2JCHA 3B6GB 2FFFB 3A1IA 4YS3A 3A6ND 3WTPB 3EG5B 2F8NB 5B33D 5CP6C 5AY8C 5F99B 5B31C 5CP6D 5AY8D 3WAAA 3LZ0C 3R45A 1EQZC 1BH8A 5B1LB 5AV5D 5B32G 3AV1A 3UT9C 3LZ0D 3W96B 1EQZD 2G5HC 2Y2GA 3MGPB 3MNNA 3UT9D 1TAFB 3UTAC 2F8NH 1BFMA 3KWQB 3KXBA 2Y2QA 1HTAA 5CPJC 2F8NK 1P3LC 3AZFA 3WTPA 3AZKA 3AZNB 2F8NA 3VH6W 1P3LD 2CV5D 2NZDC 1R4VA 2J8PA 4WZSB 4J8UB 1F1EA 4CAYB 3A1KA 4DRBA 2NZDD 5B1LA 3TU4B 5B0ZB 1P3BC 3W96A 2HUEC 5AV9D 3MGPA 5CPKA 1P3BD 4NE3A 1TAFA 3X1UC 1P34B 3KWQA 3MVDC 3REIB 1P3IC 2NQBB 2BG1A 1P3AC 3X1UD 4G92B 4Z5TA 5AV6D 3MVDD 3NQUA 3AZNA 1P3ID 1P3AD 5DNNC 3AFAC 4J8UA 4CAYA 3LJAB 5DNND 3AFAD 4ZUXC 1B6WA 2XD1A 3TU4A 5GT3C 3RELB 5B0ZA 4ZUXD 5GT3D 2L5AA 4WV4B 3B6GD 1P34A 1P3MC 2UWXA 5AVCC 1P3PB 3W97B 2YFWB 3H0RC 1U35B 5B2JA 3KUYB 1P3MD 4XZQC 2DQNC 5B0YC 1M18B 4KUDC 4H9OB 5AVCD 3V9RA 3B0CW 5F99D 4J8WC 1AOIC 3C1CA 4H9QB 4XZQD 5B33B 4KUDD 3LJAA 1ZLAC 2F8NG 4UUZB 5AVBC 4J8WD 2Y2LA 1AOID 4J8XA 1F66A 4KGCC 5CP6B 5AY8B 5AVBD 3W99C 3EPKA 3MGPD 5B31B 3W99D 3LZ0B 2XD5A 1P3OC 1EQZB 2ZY3A 3AZHC 3LELC 3UT9B 3VH6T 1P3PA 3AV2C 2RVQC 1P3OD 3W97A 3LZ1C 1U35A 3KUYA 3C1BC 1M18A 2Y2JA 3LELD 3REKC 3UTAB 2FJ7C 4H9OA 3X1SC 2RVQD 5CPJB 3C1BD 4H9QA 5B33A 3REKD 2FJ7D 1P3LB 2Y2NA 3VH6A 3AZJC 3UTBC 5CP6A 5AY8A 2Y2OA 4EO5C 2NZDB 1P3GC 5AV5A 3UTBD 2YFVB 3LZ0A 2ZY5A 2JE5A 1P3GD 3REID 1EQZA 2NQBD 1P3BB 3UT9A 2Y2HA 2HUEB 5E5AD 4Z66C 4AWLC 3X1UB 3MVDB 1P3IB 1P3AB 1P3LA 2CV5A 3RELD 2NZDA 5DNNB 3AFAB 1N1JB 2YFVA 4UPKA 4G91C 4ZUXB 2G5IC 5GT3B 5AV9A 3WTPE 3AYWC 1P3BA 1T3UA 3H0LC 3KUYD 1BH9B 3NQJB 3X1UA 2ZM5A 5AV6A 3MVDA 1P3IA 1P3MB 4E45A 4WU8C 1KX3C 5AVCB 1P3AA 4XZQB 5B0YB 4WU8D 5JA4B 4KUDB 5GXQC 4J8WB 5DNNA 3AFAA 1N1JA 4CSRB 1AOIB 5B31D 3WKJC 5B1MC 1ZLAB 5AVBB 4ZUXA 5B40C 3WKJD 5B1MD 5GT3A 3AN2C 4KGCB 3W99B 3EPHA 2IO5C 5JRGC 5B40D 1H3OB 3B6GA 3UTAD 1BH9A 5AV8C 1P3OB 5JRGD 4E44A 5B32C 3NQJA 5CPJD 3A6NC 1P3MA 3AZHB 3LELB 5AVCA 3AV2B 5B32D 5F99A 3LZ1B
chains in the Genus database with same CATH topology
3C1BB 4XZQA 5B0YA 3REKB 5JA4A 2BYKB 2FJ7B 3X1SB 4WU9C 4KUDA 4NFTA 4J8WA 1ULYA 1P3FC 4CSRA 1AOIA 4H9PB 5AVBA 3AZJB 2HIOC 3UTBB 4EO5B 3W99A 4H9SC 1P3GB 4WJ3C 2HIOD 4QLCC 1P3OA 5E5AB 4X23C 3LELA 5B2IC 3X1TC 4J8VC 3AV2A 5BT1C 4X23D 3C1BA 4AWLB 3REKA 5B2ID 2BYKA 2RIQA 2FJ7A 5BT1D 5GT0C 3UTBA 5GT0D 5BS7C 3O62C 3F6TA 1P3GA 3REIA 2NQBA 3AZMC 1M1AC 3O62D 4R8PC 4G91B 3FDDA 5E5AA 3AZMD 3WAAC 1M1AD 4R8PD 1WWIA 3B0DC 5B0YD 3X1VC 3AV1C 3X1VD 4WU8B 3RELA 1KX3B 1ZLAD 3B6FC 5KDMB 4HGAC 3MGRC 3AZIC 4KGCD 3B6FD 5GXQB 3AZFC 3MGRD 3AZID 3AZKC 3WKJB 5B1MB 5CPIC 5GSUC 2Y2MA 2YFWA 5C3IC 5B40B 3KSYA 3AZHD 5CPID 5GSUD 3AV2D 5G49B 2IO5B 5JRGB 3LZ1D 4LD9C 3REJC 2AROC 3X1SD 1P3KC 4UUZA 5B32B 3A6NB 3REJD 3AZLC 4LD9D 5CPKC 2AROD 3MGQC 4WU8A 1P3KD 5KDMA 3AZLD 3AZJD 5B31A 3MGQD 2ZY2A 4JJNC 5GXQA 4WU9B 4Z5TC 3REHC 2JSSA 1P3FB 3WKJA 5B1MA 4JJND 1HQ3C 3REHD 1S32C 5B40A 1TZYC 2HIOB 3UTAA 3AZGC 5G49A 4YM6C 5JRGA 1S32D 1TZYD 4Z66D 3TU4C 5CPJA 1Z2CB 4XUJC 4YM6D 5B32A 1PZRA 3A6NA 4XUJD 5BO0B 4X23B 5B2IB 1A7WA 3X1TB 4WNNB 2F2AC 2Y2KA 1JFIB 4WU9A 5B2JC 5GT0B 2ZY4A 1KX4C 3C1CC 2HIOA 3AYWD 3O62B 1KX4D 3W98C 5B24C 4J8XC 4H9SA 2LY8A 1F66C 3AZMB 1M1AB 1KX5C 4R8PB 3W98D 5B24D 1KX3D 3WAAB 4X23A 1KX5D 4KHAB 5B2IA 3B0DB 4H9NB 4WNNA 3VH5W 3X1VB 1B67A 5GXQD 3AV1B 1P3PC 1JFIA 2DF4C 2PYOC 2Y2IA 3B6FB 5DNMC 3P5JB 4HGAB 5GT0A 5B31G 2PYOD 1ID3C 3MGRB 3AZIB 1M19C 5B33C 3AN2D 5DNMD 5BS7A 3O62A 3AZFB 1ID3D 3AZKB 1M19D 3WA9C 5CPIB 5GSUB 5AV8D 3AZMA 1M1AA 3AZEC 4R8PA 5C3IB 3H0MC 3WA9D 5AV5C 3AZED 4KHAA 4H9NA 3X1VA 3REJB 4LD9B 2AROB 4WU9D 1ZLAA 4NE6A 1P3KB 1P3FD 3AZLB 5CPKB 3MGQB 4KGCA 1W2EA 3B6FA 3MGRA 1H3OA 3AZIA 4JJNB 2CV5C 4Z5TB 3REHB 3NQUB 3AZHA 5CPIA 1HQ3B 5GSUA 4QLCD 3LZ1A 1S32B 1TZYB 4Z66B 3MGSC 3X1TD 4J8VD 3X1SA 3AZGB 4YM6B 4DQYB 4H9PA 3MGSD 3REJA 5AV9C 4XUJB 4LD9A 2AROA 3KFUG 1P3KA 3AZLA 3AZJA 3MGQA 4YS3C 5AV6C 4YS3D 2BYMB 4JJNA 3REHA 5B2JB 5CHLB 1HQ3A 1WWSA 3V9RB 3AYWB 1KX4B 4H9RB 4ZBJC 4NE5A 3VH5T 4Z2MH 3C1CB 1TZYA 4Z66A 1S32A 3WAAD 3AZGA 3W98B 5B24B 4YM6A 4J8XB 1F66B 3MNNC 3AV1D 5BNXB 4XUJA 1KX5B 3KXBC 3B6GC 3MNND 3VH5A 3WTPC 3KXBD 3AZFD 2BYMA 3EPJA 3WTPD 3AZKD 5F99C 2F8ND 2PYOB 2Y2PA 3AN2B 5DNMB 3AYWA 3IP4C 1KX4A 4H9RA 5B1LC 1ID3B 3B0BA 1M19B 3W96C 5AV8B 2CWEA 5B1LD 5B24A 3W98A 3WA9B 3MGPC 1KX3A 3W96D 5BNXA 1KX5A 3AZEB 3KWQC 5AV5B 5CPKD 3KWQD 3AZNC 4Z5TD 4J8UC 3AZND 2PYOA 5FUGB 5BNVB 1HQ3D 3AN2A 5DNMA 4J8UD 2VQRA 1ID3A 1M19A 5B0ZC 3AZGD 5AV8A 2CV5B 4QLCB 3TU4D 3WA9A 5B0ZD 4J8VB 3AZEA 1P34C 3REIC 4M6BA 4DRAA 2NQBC 3MGSB 4Z2MG 4G92C 1P34D 5E5AC 1P3FA 5AV9B 5B2JD 5FUGA 5BNVA 3LJAC 4YS3B 3C1CD 5AV6B 3LJAD 3RELC 4QLCA 3EPLA 4J8XD 1F66D 1KU5A 5BO0A 3X1TA 3R45B 4J8VA 1BH8B 4ZBJB 2W8SA 3MGSA 3W97C 1U35C 1Q9CA 3KUYC 1M18C 3MNNB 1P3PD 3W97D 3AL0C 3B0CT 1U35D 3KXBB 1M18D 2JCHA 3B6GB 2FFFB 3A1IA 4YS3A 3A6ND 3WTPB 3EG5B 2F8NB 5B33D 5CP6C 5AY8C 5F99B 5B31C 5CP6D 5AY8D 3WAAA 3LZ0C 3R45A 1EQZC 1BH8A 5B1LB 5AV5D 5B32G 3AV1A 3UT9C 3LZ0D 3W96B 1EQZD 2G5HC 2Y2GA 3MGPB 3MNNA 3UT9D 1TAFB 3UTAC 2F8NH 1BFMA 3KWQB 3KXBA 2Y2QA 1HTAA 5CPJC 2F8NK 1P3LC 3AZFA 3WTPA 3AZKA 3AZNB 2F8NA 3VH6W 1P3LD 2CV5D 2NZDC 1R4VA 2J8PA 4WZSB 4J8UB 1F1EA 4CAYB 3A1KA 4DRBA 2NZDD 5B1LA 3TU4B 5B0ZB 1P3BC 3W96A 2HUEC 5AV9D 3MGPA 5CPKA 1P3BD 4NE3A 1TAFA 3X1UC 1P34B 3KWQA 3MVDC 3REIB 1P3IC 2NQBB 2BG1A 1P3AC 3X1UD 4G92B 4Z5TA 5AV6D 3MVDD 3NQUA 3AZNA 1P3ID 1P3AD 5DNNC 3AFAC 4J8UA 4CAYA 3LJAB 5DNND 3AFAD 4ZUXC 1B6WA 2XD1A 3TU4A 5GT3C 3RELB 5B0ZA 4ZUXD 5GT3D 2L5AA 4WV4B 3B6GD 1P34A 1P3MC 2UWXA 5AVCC 1P3PB 3W97B 2YFWB 3H0RC 1U35B 5B2JA 3KUYB 1P3MD 4XZQC 2DQNC 5B0YC 1M18B 4KUDC 4H9OB 5AVCD 3V9RA 3B0CW 5F99D 4J8WC 1AOIC 3C1CA 4H9QB 4XZQD 5B33B 4KUDD 3LJAA 1ZLAC 2F8NG 4UUZB 5AVBC 4J8WD 2Y2LA 1AOID 4J8XA 1F66A 4KGCC 5CP6B 5AY8B 5AVBD 3W99C 3EPKA 3MGPD 5B31B 3W99D 3LZ0B 2XD5A 1P3OC 1EQZB 2ZY3A 3AZHC 3LELC 3UT9B 3VH6T 1P3PA 3AV2C 2RVQC 1P3OD 3W97A 3LZ1C 1U35A 3KUYA 3C1BC 1M18A 2Y2JA 3LELD 3REKC 3UTAB 2FJ7C 4H9OA 3X1SC 2RVQD 5CPJB 3C1BD 4H9QA 5B33A 3REKD 2FJ7D 1P3LB 2Y2NA 3VH6A 3AZJC 3UTBC 5CP6A 5AY8A 2Y2OA 4EO5C 2NZDB 1P3GC 5AV5A 3UTBD 2YFVB 3LZ0A 2ZY5A 2JE5A 1P3GD 3REID 1EQZA 2NQBD 1P3BB 3UT9A 2Y2HA 2HUEB 5E5AD 4Z66C 4AWLC 3X1UB 3MVDB 1P3IB 1P3AB 1P3LA 2CV5A 3RELD 2NZDA 5DNNB 3AFAB 1N1JB 2YFVA 4UPKA 4G91C 4ZUXB 2G5IC 5GT3B 5AV9A 3WTPE 3AYWC 1P3BA 1T3UA 3H0LC 3KUYD 1BH9B 3NQJB 3X1UA 2ZM5A 5AV6A 3MVDA 1P3IA 1P3MB 4E45A 4WU8C 1KX3C 5AVCB 1P3AA 4XZQB 5B0YB 4WU8D 5JA4B 4KUDB 5GXQC 4J8WB 5DNNA 3AFAA 1N1JA 4CSRB 1AOIB 5B31D 3WKJC 5B1MC 1ZLAB 5AVBB 4ZUXA 5B40C 3WKJD 5B1MD 5GT3A 3AN2C 4KGCB 3W99B 3EPHA 2IO5C 5JRGC 5B40D 1H3OB 3B6GA 3UTAD 1BH9A 5AV8C 1P3OB 5JRGD 4E44A 5B32C 3NQJA 5CPJD 3A6NC 1P3MA 3AZHB 3LELB 5AVCA 3AV2B 5B32D 5F99A 3LZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B B;  4XZQ A;  5B0Y A;  3REK B;  5JA4 A;  2BYK B;  2FJ7 B;  3X1S B;  4WU9 C;  4KUD A;  4NFT A;  4J8W A;  1ULY A;  1P3F C;  4CSR A;  1AOI A;  4H9P B;  5AVB A;  3AZJ B;  2HIO C;  3UTB B;  4EO5 B;  3W99 A;  4H9S C;  1P3G B;  2HIO D;  4QLC C;  1P3O A;  5E5A B;  4X23 C;  3LEL A;  5B2I C;  3X1T C;  4J8V C;  3AV2 A;  5BT1 C;  4X23 D;  3C1B A;  4AWL B;  3REK A;  5B2I D;  2BYK A;  2FJ7 A;  5BT1 D;  5GT0 C;  3UTB A;  5GT0 D;  5BS7 C;  3O62 C;  1P3G A;  3REI A;  2NQB A;  3AZM C;  1M1A C;  3O62 D;  4R8P C;  4G91 B;  5E5A A;  3AZM D;  3WAA C;  1M1A D;  4R8P D;  1WWI A;  3B0D C;  5B0Y D;  3X1V C;  3AV1 C;  3X1V D;  4WU8 B;  3REL A;  1KX3 B;  1ZLA D;  3B6F C;  5KDM B;  4HGA C;  3MGR C;  3AZI C;  4KGC D;  3B6F D;  5GXQ B;  3AZF C;  3MGR D;  3AZI D;  3AZK C;  3WKJ B;  5B1M B;  5CPI C;  5GSU C;  2YFW A;  5C3I C;  5B40 B;  3KSY A;  3AZH D;  5CPI D;  5GSU D;  3AV2 D;  5G49 B;  2IO5 B;  5JRG B;  3LZ1 D;  4LD9 C;  3REJ C;  2ARO C;  3X1S D;  1P3K C;  4UUZ A;  5B32 B;  3A6N B;  3REJ D;  3AZL C;  4LD9 D;  5CPK C;  2ARO D;  3MGQ C;  4WU8 A;  1P3K D;  5KDM A;  3AZL D;  3AZJ D;  5B31 A;  3MGQ D;  4JJN C;  5GXQ A;  4WU9 B;  4Z5T C;  3REH C;  2JSS A;  1P3F B;  3WKJ A;  5B1M A;  4JJN D;  1HQ3 C;  3REH D;  1S32 C;  5B40 A;  1TZY C;  2HIO B;  3UTA A;  3AZG C;  5G49 A;  4YM6 C;  5JRG A;  1S32 D;  1TZY D;  4Z66 D;  3TU4 C;  5CPJ A;  4XUJ C;  4YM6 D;  5B32 A;  3A6N A;  4XUJ D;  5BO0 B;  4X23 B;  5B2I B;  1A7W A;  3X1T B;  4WNN B;  1JFI B;  4WU9 A;  5B2J C;  5GT0 B;  1KX4 C;  3C1C C;  2HIO A;  3AYW D;  3O62 B;  1KX4 D;  3W98 C;  5B24 C;  4J8X C;  4H9S A;  2LY8 A;  1F66 C;  3AZM B;  1M1A B;  1KX5 C;  4R8P B;  3W98 D;  5B24 D;  1KX3 D;  3WAA B;  4X23 A;  1KX5 D;  4KHA B;  5B2I A;  3B0D B;  4H9N B;  4WNN A;  3VH5 W;  3X1V B;  1B67 A;  5GXQ D;  3AV1 B;  1P3P C;  1JFI A;  2PYO C;  3B6F B;  5DNM C;  4HGA B;  5GT0 A;  5B31 G;  2PYO D;  1ID3 C;  3MGR B;  3AZI B;  1M19 C;  5B33 C;  3AN2 D;  5DNM D;  5BS7 A;  3O62 A;  3AZF B;  1ID3 D;  3AZK B;  1M19 D;  3WA9 C;  5CPI B;  5GSU B;  5AV8 D;  3AZM A;  1M1A A;  3AZE C;  4R8P A;  5C3I B;  3WA9 D;  5AV5 C;  3AZE D;  4KHA A;  4H9N A;  3X1V A;  3REJ B;  4LD9 B;  2ARO B;  4WU9 D;  1ZLA A;  4NE6 A;  1P3K B;  1P3F D;  3AZL B;  5CPK B;  3MGQ B;  4KGC A;  3B6F A;  3MGR A;  1H3O A;  3AZI A;  4JJN B;  2CV5 C;  4Z5T B;  3REH B;  3NQU B;  3AZH A;  5CPI A;  1HQ3 B;  5GSU A;  4QLC D;  3LZ1 A;  1S32 B;  1TZY B;  4Z66 B;  3MGS C;  3X1T D;  4J8V D;  3X1S A;  3AZG B;  4YM6 B;  4H9P A;  3MGS D;  3REJ A;  5AV9 C;  4XUJ B;  4LD9 A;  2ARO A;  1P3K A;  3AZL A;  3AZJ A;  3MGQ A;  4YS3 C;  5AV6 C;  4YS3 D;  2BYM B;  4JJN A;  3REH A;  5B2J B;  5CHL B;  1HQ3 A;  1WWS A;  3V9R B;  3AYW B;  1KX4 B;  4H9R B;  4ZBJ C;  4NE5 A;  3VH5 T;  4Z2M H;  3C1C B;  1TZY A;  4Z66 A;  1S32 A;  3WAA D;  3AZG A;  3W98 B;  5B24 B;  4YM6 A;  4J8X B;  1F66 B;  3MNN C;  3AV1 D;  5BNX B;  4XUJ A;  1KX5 B;  3KXB C;  3B6G C;  3MNN D;  3VH5 A;  3WTP C;  3KXB D;  3AZF D;  2BYM A;  3WTP D;  3AZK D;  5F99 C;  2F8N D;  2PYO B;  3AN2 B;  5DNM B;  3AYW A;  1KX4 A;  4H9R A;  5B1L C;  1ID3 B;  3B0B A;  1M19 B;  3W96 C;  5AV8 B;  2CWE A;  5B1L D;  5B24 A;  3W98 A;  3WA9 B;  3MGP C;  1KX3 A;  3W96 D;  5BNX A;  1KX5 A;  3AZE B;  3KWQ C;  5AV5 B;  5CPK D;  3KWQ D;  3AZN C;  4Z5T D;  4J8U C;  3AZN D;  2PYO A;  5FUG B;  5BNV B;  1HQ3 D;  3AN2 A;  5DNM A;  4J8U D;  1ID3 A;  1M19 A;  5B0Z C;  3AZG D;  5AV8 A;  2CV5 B;  4QLC B;  3TU4 D;  3WA9 A;  5B0Z D;  4J8V B;  3AZE A;  1P34 C;  3REI C;  4M6B A;  4DRA A;  2NQB C;  3MGS B;  4Z2M G;  4G92 C;  1P34 D;  5E5A C;  1P3F A;  5AV9 B;  5B2J D;  5FUG A;  5BNV A;  3LJA C;  4YS3 B;  3C1C D;  5AV6 B;  3LJA D;  3REL C;  4QLC A;  4J8X D;  1F66 D;  1KU5 A;  5BO0 A;  3X1T A;  3R45 B;  4J8V A;  1BH8 B;  4ZBJ B;  3MGS A;  3W97 C;  1U35 C;  1Q9C A;  3KUY C;  1M18 C;  3MNN B;  1P3P D;  3W97 D;  3B0C T;  1U35 D;  3KXB B;  1M18 D;  3B6G B;  4YS3 A;  3A6N D;  3WTP B;  2F8N B;  5B33 D;  5CP6 C;  5AY8 C;  5F99 B;  5B31 C;  5CP6 D;  5AY8 D;  3WAA A;  3LZ0 C;  3R45 A;  1EQZ C;  1BH8 A;  5B1L B;  5AV5 D;  5B32 G;  3AV1 A;  3UT9 C;  3LZ0 D;  3W96 B;  1EQZ D;  3MGP B;  3MNN A;  3UT9 D;  1TAF B;  3UTA C;  2F8N H;  1BFM A;  3KWQ B;  3KXB A;  5CPJ C;  1HTA A;  2F8N K;  1P3L C;  3AZF A;  3WTP A;  3AZK A;  3AZN B;  2F8N A;  3VH6 W;  1P3L D;  2CV5 D;  2NZD C;  1R4V A;  4WZS B;  4J8U B;  1F1E A;  4CAY B;  4DRB A;  2NZD D;  5B1L A;  3TU4 B;  5B0Z B;  1P3B C;  3W96 A;  2HUE C;  5AV9 D;  3MGP A;  5CPK A;  1P3B D;  4NE3 A;  1TAF A;  3X1U C;  1P34 B;  3KWQ A;  3MVD C;  3REI B;  1P3I C;  2NQB B;  1P3A C;  3X1U D;  4G92 B;  4Z5T A;  5AV6 D;  3MVD D;  3NQU A;  3AZN A;  1P3I D;  1P3A D;  5DNN C;  3AFA C;  4J8U A;  4CAY A;  3LJA B;  5DNN D;  3AFA D;  4ZUX C;  1B6W A;  3TU4 A;  5GT3 C;  3REL B;  5B0Z A;  4ZUX D;  5GT3 D;  2L5A A;  4WV4 B;  3B6G D;  1P34 A;  1P3M C;  5AVC C;  1P3P B;  3W97 B;  2YFW B;  1U35 B;  5B2J A;  3KUY B;  1P3M D;  4XZQ C;  5B0Y C;  1M18 B;  4KUD C;  4H9O B;  5AVC D;  3V9R A;  3B0C W;  5F99 D;  4J8W C;  1AOI C;  3C1C A;  4H9Q B;  4XZQ D;  5B33 B;  4KUD D;  3LJA A;  1ZLA C;  2F8N G;  4UUZ B;  5AVB C;  4J8W D;  1AOI D;  4J8X A;  1F66 A;  4KGC C;  5CP6 B;  5AY8 B;  5AVB D;  3W99 C;  3MGP D;  5B31 B;  3W99 D;  3LZ0 B;  1P3O C;  1EQZ B;  3AZH C;  3LEL C;  3UT9 B;  3VH6 T;  1P3P A;  3AV2 C;  2RVQ C;  1P3O D;  3W97 A;  3LZ1 C;  1U35 A;  3KUY A;  3C1B C;  1M18 A;  3LEL D;  3REK C;  3UTA B;  2FJ7 C;  4H9O A;  3X1S C;  2RVQ D;  5CPJ B;  3C1B D;  4H9Q A;  5B33 A;  3REK D;  2FJ7 D;  1P3L B;  3VH6 A;  3AZJ C;  3UTB C;  5CP6 A;  5AY8 A;  2NZD B;  4EO5 C;  1P3G C;  5AV5 A;  3UTB D;  2YFV B;  3LZ0 A;  1EQZ A;  1P3G D;  3REI D;  2NQB D;  1P3B B;  3UT9 A;  2HUE B;  5E5A D;  4Z66 C;  4AWL C;  3X1U B;  3MVD B;  1P3I B;  1P3A B;  1P3L A;  2CV5 A;  3REL D;  2NZD A;  5DNN B;  3AFA B;  1N1J B;  2YFV A;  4G91 C;  4ZUX B;  5GT3 B;  5AV9 A;  3WTP E;  3AYW C;  1P3B A;  3KUY D;  1BH9 B;  3NQJ B;  3X1U A;  5AV6 A;  3MVD A;  1P3I A;  1P3M B;  4E45 A;  4WU8 C;  1KX3 C;  5AVC B;  1P3A A;  4XZQ B;  5B0Y B;  4WU8 D;  5JA4 B;  4KUD B;  5GXQ C;  4J8W B;  5DNN A;  3AFA A;  1N1J A;  4CSR B;  1AOI B;  5B31 D;  3WKJ C;  5B1M C;  1ZLA B;  5AVB B;  4ZUX A;  5B40 C;  3WKJ D;  5B1M D;  5GT3 A;  3AN2 C;  4KGC B;  3W99 B;  2IO5 C;  5JRG C;  5B40 D;  1H3O B;  3B6G A;  3UTA D;  1BH9 A;  5AV8 C;  1P3O B;  5JRG D;  4E44 A;  5B32 C;  3NQJ A;  5CPJ D;  3A6N C;  1P3M A;  3AZH B;  3LEL B;  5AVC A;  3AV2 B;  5B32 D;  5F99 A;  3LZ1 B; 
#chains in the Genus database with same CATH topology
 3C1B B;  4XZQ A;  5B0Y A;  3REK B;  5JA4 A;  2BYK B;  2FJ7 B;  3X1S B;  4WU9 C;  4KUD A;  4NFT A;  4J8W A;  1ULY A;  1P3F C;  4CSR A;  1AOI A;  4H9P B;  5AVB A;  3AZJ B;  2HIO C;  3UTB B;  4EO5 B;  3W99 A;  4H9S C;  1P3G B;  4WJ3 C;  2HIO D;  4QLC C;  1P3O A;  5E5A B;  4X23 C;  3LEL A;  5B2I C;  3X1T C;  4J8V C;  3AV2 A;  5BT1 C;  4X23 D;  3C1B A;  4AWL B;  3REK A;  5B2I D;  2BYK A;  2RIQ A;  2FJ7 A;  5BT1 D;  5GT0 C;  3UTB A;  5GT0 D;  5BS7 C;  3O62 C;  3F6T A;  1P3G A;  3REI A;  2NQB A;  3AZM C;  1M1A C;  3O62 D;  4R8P C;  4G91 B;  3FDD A;  5E5A A;  3AZM D;  3WAA C;  1M1A D;  4R8P D;  1WWI A;  3B0D C;  5B0Y D;  3X1V C;  3AV1 C;  3X1V D;  4WU8 B;  3REL A;  1KX3 B;  1ZLA D;  3B6F C;  5KDM B;  4HGA C;  3MGR C;  3AZI C;  4KGC D;  3B6F D;  5GXQ B;  3AZF C;  3MGR D;  3AZI D;  3AZK C;  3WKJ B;  5B1M B;  5CPI C;  5GSU C;  2Y2M A;  2YFW A;  5C3I C;  5B40 B;  3KSY A;  3AZH D;  5CPI D;  5GSU D;  3AV2 D;  5G49 B;  2IO5 B;  5JRG B;  3LZ1 D;  4LD9 C;  3REJ C;  2ARO C;  3X1S D;  1P3K C;  4UUZ A;  5B32 B;  3A6N B;  3REJ D;  3AZL C;  4LD9 D;  5CPK C;  2ARO D;  3MGQ C;  4WU8 A;  1P3K D;  5KDM A;  3AZL D;  3AZJ D;  5B31 A;  3MGQ D;  2ZY2 A;  4JJN C;  5GXQ A;  4WU9 B;  4Z5T C;  3REH C;  2JSS A;  1P3F B;  3WKJ A;  5B1M A;  4JJN D;  1HQ3 C;  3REH D;  1S32 C;  5B40 A;  1TZY C;  2HIO B;  3UTA A;  3AZG C;  5G49 A;  4YM6 C;  5JRG A;  1S32 D;  1TZY D;  4Z66 D;  3TU4 C;  5CPJ A;  1Z2C B;  4XUJ C;  4YM6 D;  5B32 A;  1PZR A;  3A6N A;  4XUJ D;  5BO0 B;  4X23 B;  5B2I B;  1A7W A;  3X1T B;  4WNN B;  2F2A C;  2Y2K A;  1JFI B;  4WU9 A;  5B2J C;  5GT0 B;  2ZY4 A;  1KX4 C;  3C1C C;  2HIO A;  3AYW D;  3O62 B;  1KX4 D;  3W98 C;  5B24 C;  4J8X C;  4H9S A;  2LY8 A;  1F66 C;  3AZM B;  1M1A B;  1KX5 C;  4R8P B;  3W98 D;  5B24 D;  1KX3 D;  3WAA B;  4X23 A;  1KX5 D;  4KHA B;  5B2I A;  3B0D B;  4H9N B;  4WNN A;  3VH5 W;  3X1V B;  1B67 A;  5GXQ D;  3AV1 B;  1P3P C;  1JFI A;  2DF4 C;  2PYO C;  2Y2I A;  3B6F B;  5DNM C;  3P5J B;  4HGA B;  5GT0 A;  5B31 G;  2PYO D;  1ID3 C;  3MGR B;  3AZI B;  1M19 C;  5B33 C;  3AN2 D;  5DNM D;  5BS7 A;  3O62 A;  3AZF B;  1ID3 D;  3AZK B;  1M19 D;  3WA9 C;  5CPI B;  5GSU B;  5AV8 D;  3AZM A;  1M1A A;  3AZE C;  4R8P A;  5C3I B;  3H0M C;  3WA9 D;  5AV5 C;  3AZE D;  4KHA A;  4H9N A;  3X1V A;  3REJ B;  4LD9 B;  2ARO B;  4WU9 D;  1ZLA A;  4NE6 A;  1P3K B;  1P3F D;  3AZL B;  5CPK B;  3MGQ B;  4KGC A;  1W2E A;  3B6F A;  3MGR A;  1H3O A;  3AZI A;  4JJN B;  2CV5 C;  4Z5T B;  3REH B;  3NQU B;  3AZH A;  5CPI A;  1HQ3 B;  5GSU A;  4QLC D;  3LZ1 A;  1S32 B;  1TZY B;  4Z66 B;  3MGS C;  3X1T D;  4J8V D;  3X1S A;  3AZG B;  4YM6 B;  4DQY B;  4H9P A;  3MGS D;  3REJ A;  5AV9 C;  4XUJ B;  4LD9 A;  2ARO A;  3KFU G;  1P3K A;  3AZL A;  3AZJ A;  3MGQ A;  4YS3 C;  5AV6 C;  4YS3 D;  2BYM B;  4JJN A;  3REH A;  5B2J B;  5CHL B;  1HQ3 A;  1WWS A;  3V9R B;  3AYW B;  1KX4 B;  4H9R B;  4ZBJ C;  4NE5 A;  3VH5 T;  4Z2M H;  3C1C B;  1TZY A;  4Z66 A;  1S32 A;  3WAA D;  3AZG A;  3W98 B;  5B24 B;  4YM6 A;  4J8X B;  1F66 B;  3MNN C;  3AV1 D;  5BNX B;  4XUJ A;  1KX5 B;  3KXB C;  3B6G C;  3MNN D;  3VH5 A;  3WTP C;  3KXB D;  3AZF D;  2BYM A;  3EPJ A;  3WTP D;  3AZK D;  5F99 C;  2F8N D;  2PYO B;  2Y2P A;  3AN2 B;  5DNM B;  3AYW A;  3IP4 C;  1KX4 A;  4H9R A;  5B1L C;  1ID3 B;  3B0B A;  1M19 B;  3W96 C;  5AV8 B;  2CWE A;  5B1L D;  5B24 A;  3W98 A;  3WA9 B;  3MGP C;  1KX3 A;  3W96 D;  5BNX A;  1KX5 A;  3AZE B;  3KWQ C;  5AV5 B;  5CPK D;  3KWQ D;  3AZN C;  4Z5T D;  4J8U C;  3AZN D;  2PYO A;  5FUG B;  5BNV B;  1HQ3 D;  3AN2 A;  5DNM A;  4J8U D;  2VQR A;  1ID3 A;  1M19 A;  5B0Z C;  3AZG D;  5AV8 A;  2CV5 B;  4QLC B;  3TU4 D;  3WA9 A;  5B0Z D;  4J8V B;  3AZE A;  1P34 C;  3REI C;  4M6B A;  4DRA A;  2NQB C;  3MGS B;  4Z2M G;  4G92 C;  1P34 D;  5E5A C;  1P3F A;  5AV9 B;  5B2J D;  5FUG A;  5BNV A;  3LJA C;  4YS3 B;  3C1C D;  5AV6 B;  3LJA D;  3REL C;  4QLC A;  3EPL A;  4J8X D;  1F66 D;  1KU5 A;  5BO0 A;  3X1T A;  3R45 B;  4J8V A;  1BH8 B;  4ZBJ B;  2W8S A;  3MGS A;  3W97 C;  1U35 C;  1Q9C A;  3KUY C;  1M18 C;  3MNN B;  1P3P D;  3W97 D;  3AL0 C;  3B0C T;  1U35 D;  3KXB B;  1M18 D;  2JCH A;  3B6G B;  2FFF B;  3A1I A;  4YS3 A;  3A6N D;  3WTP B;  3EG5 B;  2F8N B;  5B33 D;  5CP6 C;  5AY8 C;  5F99 B;  5B31 C;  5CP6 D;  5AY8 D;  3WAA A;  3LZ0 C;  3R45 A;  1EQZ C;  1BH8 A;  5B1L B;  5AV5 D;  5B32 G;  3AV1 A;  3UT9 C;  3LZ0 D;  3W96 B;  1EQZ D;  2G5H C;  2Y2G A;  3MGP B;  3MNN A;  3UT9 D;  1TAF B;  3UTA C;  2F8N H;  1BFM A;  3KWQ B;  3KXB A;  2Y2Q A;  1HTA A;  5CPJ C;  2F8N K;  1P3L C;  3AZF A;  3WTP A;  3AZK A;  3AZN B;  2F8N A;  3VH6 W;  1P3L D;  2CV5 D;  2NZD C;  1R4V A;  2J8P A;  4WZS B;  4J8U B;  1F1E A;  4CAY B;  3A1K A;  4DRB A;  2NZD D;  5B1L A;  3TU4 B;  5B0Z B;  1P3B C;  3W96 A;  2HUE C;  5AV9 D;  3MGP A;  5CPK A;  1P3B D;  4NE3 A;  1TAF A;  3X1U C;  1P34 B;  3KWQ A;  3MVD C;  3REI B;  1P3I C;  2NQB B;  2BG1 A;  1P3A C;  3X1U D;  4G92 B;  4Z5T A;  5AV6 D;  3MVD D;  3NQU A;  3AZN A;  1P3I D;  1P3A D;  5DNN C;  3AFA C;  4J8U A;  4CAY A;  3LJA B;  5DNN D;  3AFA D;  4ZUX C;  1B6W A;  2XD1 A;  3TU4 A;  5GT3 C;  3REL B;  5B0Z A;  4ZUX D;  5GT3 D;  2L5A A;  4WV4 B;  3B6G D;  1P34 A;  1P3M C;  2UWX A;  5AVC C;  1P3P B;  3W97 B;  2YFW B;  3H0R C;  1U35 B;  5B2J A;  3KUY B;  1P3M D;  4XZQ C;  2DQN C;  5B0Y C;  1M18 B;  4KUD C;  4H9O B;  5AVC D;  3V9R A;  3B0C W;  5F99 D;  4J8W C;  1AOI C;  3C1C A;  4H9Q B;  4XZQ D;  5B33 B;  4KUD D;  3LJA A;  1ZLA C;  2F8N G;  4UUZ B;  5AVB C;  4J8W D;  2Y2L A;  1AOI D;  4J8X A;  1F66 A;  4KGC C;  5CP6 B;  5AY8 B;  5AVB D;  3W99 C;  3EPK A;  3MGP D;  5B31 B;  3W99 D;  3LZ0 B;  2XD5 A;  1P3O C;  1EQZ B;  2ZY3 A;  3AZH C;  3LEL C;  3UT9 B;  3VH6 T;  1P3P A;  3AV2 C;  2RVQ C;  1P3O D;  3W97 A;  3LZ1 C;  1U35 A;  3KUY A;  3C1B C;  1M18 A;  2Y2J A;  3LEL D;  3REK C;  3UTA B;  2FJ7 C;  4H9O A;  3X1S C;  2RVQ D;  5CPJ B;  3C1B D;  4H9Q A;  5B33 A;  3REK D;  2FJ7 D;  1P3L B;  2Y2N A;  3VH6 A;  3AZJ C;  3UTB C;  5CP6 A;  5AY8 A;  2Y2O A;  4EO5 C;  2NZD B;  1P3G C;  5AV5 A;  3UTB D;  2YFV B;  3LZ0 A;  2ZY5 A;  2JE5 A;  1P3G D;  3REI D;  1EQZ A;  2NQB D;  1P3B B;  3UT9 A;  2Y2H A;  2HUE B;  5E5A D;  4Z66 C;  4AWL C;  3X1U B;  3MVD B;  1P3I B;  1P3A B;  1P3L A;  2CV5 A;  3REL D;  2NZD A;  5DNN B;  3AFA B;  1N1J B;  2YFV A;  4UPK A;  4G91 C;  4ZUX B;  2G5I C;  5GT3 B;  5AV9 A;  3WTP E;  3AYW C;  1P3B A;  1T3U A;  3H0L C;  3KUY D;  1BH9 B;  3NQJ B;  3X1U A;  2ZM5 A;  5AV6 A;  3MVD A;  1P3I A;  1P3M B;  4E45 A;  4WU8 C;  1KX3 C;  5AVC B;  1P3A A;  4XZQ B;  5B0Y B;  4WU8 D;  5JA4 B;  4KUD B;  5GXQ C;  4J8W B;  5DNN A;  3AFA A;  1N1J A;  4CSR B;  1AOI B;  5B31 D;  3WKJ C;  5B1M C;  1ZLA B;  5AVB B;  4ZUX A;  5B40 C;  3WKJ D;  5B1M D;  5GT3 A;  3AN2 C;  4KGC B;  3W99 B;  3EPH A;  2IO5 C;  5JRG C;  5B40 D;  1H3O B;  3B6G A;  3UTA D;  1BH9 A;  5AV8 C;  1P3O B;  5JRG D;  4E44 A;  5B32 C;  3NQJ A;  5CPJ D;  3A6N C;  1P3M A;  3AZH B;  3LEL B;  5AVC A;  3AV2 B;  5B32 D;  5F99 A;  3LZ1 B; 
#chains in the Genus database with same CATH homology
 3C1B B;  4XZQ A;  5B0Y A;  3REK B;  5JA4 A;  2BYK B;  2FJ7 B;  3X1S B;  4WU9 C;  4KUD A;  4NFT A;  4J8W A;  1ULY A;  1P3F C;  4CSR A;  1AOI A;  4H9P B;  5AVB A;  3AZJ B;  2HIO C;  3UTB B;  4EO5 B;  3W99 A;  4H9S C;  1P3G B;  4WJ3 C;  2HIO D;  4QLC C;  1P3O A;  5E5A B;  4X23 C;  3LEL A;  5B2I C;  3X1T C;  4J8V C;  3AV2 A;  5BT1 C;  4X23 D;  3C1B A;  4AWL B;  3REK A;  5B2I D;  2BYK A;  2RIQ A;  2FJ7 A;  5BT1 D;  5GT0 C;  3UTB A;  5GT0 D;  5BS7 C;  3O62 C;  3F6T A;  1P3G A;  3REI A;  2NQB A;  3AZM C;  1M1A C;  3O62 D;  4R8P C;  4G91 B;  3FDD A;  5E5A A;  3AZM D;  3WAA C;  1M1A D;  4R8P D;  1WWI A;  3B0D C;  5B0Y D;  3X1V C;  3AV1 C;  3X1V D;  4WU8 B;  3REL A;  1KX3 B;  1ZLA D;  3B6F C;  5KDM B;  4HGA C;  3MGR C;  3AZI C;  4KGC D;  3B6F D;  5GXQ B;  3AZF C;  3MGR D;  3AZI D;  3AZK C;  3WKJ B;  5B1M B;  5CPI C;  5GSU C;  2Y2M A;  2YFW A;  5C3I C;  5B40 B;  3KSY A;  3AZH D;  5CPI D;  5GSU D;  3AV2 D;  5G49 B;  2IO5 B;  5JRG B;  3LZ1 D;  4LD9 C;  3REJ C;  2ARO C;  3X1S D;  1P3K C;  4UUZ A;  5B32 B;  3A6N B;  3REJ D;  3AZL C;  4LD9 D;  5CPK C;  2ARO D;  3MGQ C;  4WU8 A;  1P3K D;  5KDM A;  3AZL D;  3AZJ D;  5B31 A;  3MGQ D;  2ZY2 A;  4JJN C;  5GXQ A;  4WU9 B;  4Z5T C;  3REH C;  2JSS A;  1P3F B;  3WKJ A;  5B1M A;  4JJN D;  1HQ3 C;  3REH D;  1S32 C;  5B40 A;  1TZY C;  2HIO B;  3UTA A;  3AZG C;  5G49 A;  4YM6 C;  5JRG A;  1S32 D;  1TZY D;  4Z66 D;  3TU4 C;  5CPJ A;  1Z2C B;  4XUJ C;  4YM6 D;  5B32 A;  1PZR A;  3A6N A;  4XUJ D;  5BO0 B;  4X23 B;  5B2I B;  1A7W A;  3X1T B;  4WNN B;  2F2A C;  2Y2K A;  1JFI B;  4WU9 A;  5B2J C;  5GT0 B;  2ZY4 A;  1KX4 C;  3C1C C;  2HIO A;  3AYW D;  3O62 B;  1KX4 D;  3W98 C;  5B24 C;  4J8X C;  4H9S A;  2LY8 A;  1F66 C;  3AZM B;  1M1A B;  1KX5 C;  4R8P B;  3W98 D;  5B24 D;  1KX3 D;  3WAA B;  4X23 A;  1KX5 D;  4KHA B;  5B2I A;  3B0D B;  4H9N B;  4WNN A;  3VH5 W;  3X1V B;  1B67 A;  5GXQ D;  3AV1 B;  1P3P C;  1JFI A;  2DF4 C;  2PYO C;  2Y2I A;  3B6F B;  5DNM C;  3P5J B;  4HGA B;  5GT0 A;  5B31 G;  2PYO D;  1ID3 C;  3MGR B;  3AZI B;  1M19 C;  5B33 C;  3AN2 D;  5DNM D;  5BS7 A;  3O62 A;  3AZF B;  1ID3 D;  3AZK B;  1M19 D;  3WA9 C;  5CPI B;  5GSU B;  5AV8 D;  3AZM A;  1M1A A;  3AZE C;  4R8P A;  5C3I B;  3H0M C;  3WA9 D;  5AV5 C;  3AZE D;  4KHA A;  4H9N A;  3X1V A;  3REJ B;  4LD9 B;  2ARO B;  4WU9 D;  1ZLA A;  4NE6 A;  1P3K B;  1P3F D;  3AZL B;  5CPK B;  3MGQ B;  4KGC A;  1W2E A;  3B6F A;  3MGR A;  1H3O A;  3AZI A;  4JJN B;  2CV5 C;  4Z5T B;  3REH B;  3NQU B;  3AZH A;  5CPI A;  1HQ3 B;  5GSU A;  4QLC D;  3LZ1 A;  1S32 B;  1TZY B;  4Z66 B;  3MGS C;  3X1T D;  4J8V D;  3X1S A;  3AZG B;  4YM6 B;  4DQY B;  4H9P A;  3MGS D;  3REJ A;  5AV9 C;  4XUJ B;  4LD9 A;  2ARO A;  3KFU G;  1P3K A;  3AZL A;  3AZJ A;  3MGQ A;  4YS3 C;  5AV6 C;  4YS3 D;  2BYM B;  4JJN A;  3REH A;  5B2J B;  5CHL B;  1HQ3 A;  1WWS A;  3V9R B;  3AYW B;  1KX4 B;  4H9R B;  4ZBJ C;  4NE5 A;  3VH5 T;  4Z2M H;  3C1C B;  1TZY A;  4Z66 A;  1S32 A;  3WAA D;  3AZG A;  3W98 B;  5B24 B;  4YM6 A;  4J8X B;  1F66 B;  3MNN C;  3AV1 D;  5BNX B;  4XUJ A;  1KX5 B;  3KXB C;  3B6G C;  3MNN D;  3VH5 A;  3WTP C;  3KXB D;  3AZF D;  2BYM A;  3EPJ A;  3WTP D;  3AZK D;  5F99 C;  2F8N D;  2PYO B;  2Y2P A;  3AN2 B;  5DNM B;  3AYW A;  3IP4 C;  1KX4 A;  4H9R A;  5B1L C;  1ID3 B;  3B0B A;  1M19 B;  3W96 C;  5AV8 B;  2CWE A;  5B1L D;  5B24 A;  3W98 A;  3WA9 B;  3MGP C;  1KX3 A;  3W96 D;  5BNX A;  1KX5 A;  3AZE B;  3KWQ C;  5AV5 B;  5CPK D;  3KWQ D;  3AZN C;  4Z5T D;  4J8U C;  3AZN D;  2PYO A;  5FUG B;  5BNV B;  1HQ3 D;  3AN2 A;  5DNM A;  4J8U D;  2VQR A;  1ID3 A;  1M19 A;  5B0Z C;  3AZG D;  5AV8 A;  2CV5 B;  4QLC B;  3TU4 D;  3WA9 A;  5B0Z D;  4J8V B;  3AZE A;  1P34 C;  3REI C;  4M6B A;  4DRA A;  2NQB C;  3MGS B;  4Z2M G;  4G92 C;  1P34 D;  5E5A C;  1P3F A;  5AV9 B;  5B2J D;  5FUG A;  5BNV A;  3LJA C;  4YS3 B;  3C1C D;  5AV6 B;  3LJA D;  3REL C;  4QLC A;  3EPL A;  4J8X D;  1F66 D;  1KU5 A;  5BO0 A;  3X1T A;  3R45 B;  4J8V A;  1BH8 B;  4ZBJ B;  2W8S A;  3MGS A;  3W97 C;  1U35 C;  1Q9C A;  3KUY C;  1M18 C;  3MNN B;  1P3P D;  3W97 D;  3AL0 C;  3B0C T;  1U35 D;  3KXB B;  1M18 D;  2JCH A;  3B6G B;  2FFF B;  3A1I A;  4YS3 A;  3A6N D;  3WTP B;  3EG5 B;  2F8N B;  5B33 D;  5CP6 C;  5AY8 C;  5F99 B;  5B31 C;  5CP6 D;  5AY8 D;  3WAA A;  3LZ0 C;  3R45 A;  1EQZ C;  1BH8 A;  5B1L B;  5AV5 D;  5B32 G;  3AV1 A;  3UT9 C;  3LZ0 D;  3W96 B;  1EQZ D;  2G5H C;  2Y2G A;  3MGP B;  3MNN A;  3UT9 D;  1TAF B;  3UTA C;  2F8N H;  1BFM A;  3KWQ B;  3KXB A;  2Y2Q A;  1HTA A;  5CPJ C;  2F8N K;  1P3L C;  3AZF A;  3WTP A;  3AZK A;  3AZN B;  2F8N A;  3VH6 W;  1P3L D;  2CV5 D;  2NZD C;  1R4V A;  2J8P A;  4WZS B;  4J8U B;  1F1E A;  4CAY B;  3A1K A;  4DRB A;  2NZD D;  5B1L A;  3TU4 B;  5B0Z B;  1P3B C;  3W96 A;  2HUE C;  5AV9 D;  3MGP A;  5CPK A;  1P3B D;  4NE3 A;  1TAF A;  3X1U C;  1P34 B;  3KWQ A;  3MVD C;  3REI B;  1P3I C;  2NQB B;  2BG1 A;  1P3A C;  3X1U D;  4G92 B;  4Z5T A;  5AV6 D;  3MVD D;  3NQU A;  3AZN A;  1P3I D;  1P3A D;  5DNN C;  3AFA C;  4J8U A;  4CAY A;  3LJA B;  5DNN D;  3AFA D;  4ZUX C;  1B6W A;  2XD1 A;  3TU4 A;  5GT3 C;  3REL B;  5B0Z A;  4ZUX D;  5GT3 D;  2L5A A;  4WV4 B;  3B6G D;  1P34 A;  1P3M C;  2UWX A;  5AVC C;  1P3P B;  3W97 B;  2YFW B;  3H0R C;  1U35 B;  5B2J A;  3KUY B;  1P3M D;  4XZQ C;  2DQN C;  5B0Y C;  1M18 B;  4KUD C;  4H9O B;  5AVC D;  3V9R A;  3B0C W;  5F99 D;  4J8W C;  1AOI C;  3C1C A;  4H9Q B;  4XZQ D;  5B33 B;  4KUD D;  3LJA A;  1ZLA C;  2F8N G;  4UUZ B;  5AVB C;  4J8W D;  2Y2L A;  1AOI D;  4J8X A;  1F66 A;  4KGC C;  5CP6 B;  5AY8 B;  5AVB D;  3W99 C;  3EPK A;  3MGP D;  5B31 B;  3W99 D;  3LZ0 B;  2XD5 A;  1P3O C;  1EQZ B;  2ZY3 A;  3AZH C;  3LEL C;  3UT9 B;  3VH6 T;  1P3P A;  3AV2 C;  2RVQ C;  1P3O D;  3W97 A;  3LZ1 C;  1U35 A;  3KUY A;  3C1B C;  1M18 A;  2Y2J A;  3LEL D;  3REK C;  3UTA B;  2FJ7 C;  4H9O A;  3X1S C;  2RVQ D;  5CPJ B;  3C1B D;  4H9Q A;  5B33 A;  3REK D;  2FJ7 D;  1P3L B;  2Y2N A;  3VH6 A;  3AZJ C;  3UTB C;  5CP6 A;  5AY8 A;  2Y2O A;  4EO5 C;  2NZD B;  1P3G C;  5AV5 A;  3UTB D;  2YFV B;  3LZ0 A;  2ZY5 A;  2JE5 A;  1P3G D;  3REI D;  1EQZ A;  2NQB D;  1P3B B;  3UT9 A;  2Y2H A;  2HUE B;  5E5A D;  4Z66 C;  4AWL C;  3X1U B;  3MVD B;  1P3I B;  1P3A B;  1P3L A;  2CV5 A;  3REL D;  2NZD A;  5DNN B;  3AFA B;  1N1J B;  2YFV A;  4UPK A;  4G91 C;  4ZUX B;  2G5I C;  5GT3 B;  5AV9 A;  3WTP E;  3AYW C;  1P3B A;  1T3U A;  3H0L C;  3KUY D;  1BH9 B;  3NQJ B;  3X1U A;  2ZM5 A;  5AV6 A;  3MVD A;  1P3I A;  1P3M B;  4E45 A;  4WU8 C;  1KX3 C;  5AVC B;  1P3A A;  4XZQ B;  5B0Y B;  4WU8 D;  5JA4 B;  4KUD B;  5GXQ C;  4J8W B;  5DNN A;  3AFA A;  1N1J A;  4CSR B;  1AOI B;  5B31 D;  3WKJ C;  5B1M C;  1ZLA B;  5AVB B;  4ZUX A;  5B40 C;  3WKJ D;  5B1M D;  5GT3 A;  3AN2 C;  4KGC B;  3W99 B;  3EPH A;  2IO5 C;  5JRG C;  5B40 D;  1H3O B;  3B6G A;  3UTA D;  1BH9 A;  5AV8 C;  1P3O B;  5JRG D;  4E44 A;  5B32 C;  3NQJ A;  5CPJ D;  3A6N C;  1P3M A;  3AZH B;  3LEL B;  5AVC A;  3AV2 B;  5B32 D;  5F99 A;  3LZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...