3WA9C

The nucleosome containing human h2a.z.1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9C00
2CV5C 4J8WB 4LD9B 4WU8A 3LJAA 3TU4C 5DNMA 3LELC 3AZFD 5B0YC 5B24D 4WNNB 1H3OB 5B2IB 1AOIC 2NQBC 3W99B 5CP6D 3LZ1C 1M18D 1S32A 1U35A 4KHAB 4CAYA 5F99B 3REKB 5DNMC 1P3BC 3B6FA 1P3MA 5B1MA 3W97D 2AROD 3W97B 4XZQA 1U35C 2LY8A 3AZID 3X1TA 2PYOB 3O62B 3AZIB 3AYWB 3X1VD 2IO5C 3B6FC 4H9PB 5BNVA 3X1VB 4YM6D 1P3MC 5B1MC 3REJA 1KX3A 3UTBD 3UTBB 4XZQC 3MGPD 3MGSA 2BYKB 5B2JD 3REHA 3X1TC 3KXBA 3REIB 4J8UD 5C3IC 4J8UB 3C1CA 4H9SC 3W96D 2YFWA 4CSRA 3REJC 4Z2MH 1P3GC 5AV8D 3B0CW 5E5AD 4J8XB 5JA4B 3WA9C 5E5AB 3AZMB 3KUYA 3AZJB 3REHC 5AV9C 3KXBC 3UT9A 5GSUA 5JRGB 4H9QA 2CWEA 4DRAA 3KWQB 4LD9C 3C1CC 1N1JB 2BYMB 3WTPE 4J8WC 3C1BA 3AFAB 1P3OD 4WZSB 3VH5T 1P3OB 1KX5D 1P3FB 5B2IC 5AY8D 3W99C 5B31G 5B32A 5AY8B 3UT9C 5GSUC 1P3IB 5GT3B 1EQZD 1JFIB 3LZ0D 2FJ7A 1EQZB 5AV6D 3LZ0B 3C1BC 4Z5TA 5F99C 3REKC 1F66A 5G49A 2CV5D 4H9NB 3TU4D 2CV5B 3LELD 3TU4B 5B0YD 3LELB 5B32C 4QLCB 5BT1C 3X1UB 4Z66A 2F8ND 1AOID 2NQBD 3NQJB 3LZ1D 2FJ7C 2NQBB 3RELA 3VH6T 2PYOC 1M1AD 5B40B 4Z5TC 4G91C 4NE5A 3AYWC 1F66C 1P3KB 1KX3B 3MVDA 3AZLA 3AZHA 5DNMD 1P3BD 4NE6A 5DNMB 3AZKA 3RELC 1U35D 3REIC 1S32B 1KU5A 1U35B 3A6NA 1P3LA 4UUZA 3AZLC 4CAYB 3AZNA 3B6FD 3AZEA 2IO5B 3B6FB 4KGCA 1P3MD 1ZLAA 4J8XC 5B1MD 1P3MB 5B1MB 3WTPA 4XZQD 5JRGC 3AV2C 4XZQB 3X1TD 3A6NC 3WAAA 1P3LC 3KWQC 3X1TB 3AZEC 3UTAC 3REJD 1P3GD 1ID3A 1R4VA 3REJB 1BH8A 1TZYA 4XUJA 3WA9D 3REHD 3MGSB 2HUEB 5GT3C 5AV9D 3KXBD 5CPJA 3AV1A 3REHB 5AV9B 3KXBB 4JJNA 4DRBA 3B0BA 4LD9D 4J8WD 4H9RA 4ZBJB 3C1CB 2HIOA 1ID3C 2YFWB 4CSRB 4QLCC 3X1UC 5B2ID 3W99D 3KUYB 3UT9D 4JJNC 4G92B 5GT0A 3VH5A 3UT9B 5B40C 5GSUB 1P3KC 1KX3C 4H9QB 3NQUA 4ZUXA 3C1BD 5F99D 3REKD 2HIOC 3LJAC 4WU8C 3AZGA 3C1BB 1A7WA 5BT1D 5B32B 5GT0C 1M19A 1P3PA 1S32C 2FJ7D 3MGRA 2PYOD 2FJ7B 3O62D 4Z5TD 4H9OA 3AYWD 1F66D 4Z5TB 4G91B 1F66B 5G49B 4WU9A 4KUDA 3MGQA 3VH6A 1M19C 4Z66B 3RELD 5FUGA 5KDMA 3REID 3RELB 4EO5C 4WU9C 3AZLD 5AVCA 3AZLB 3AZHB 4J8XD 3AZKB 3WKJA 3AZMD 1WWSA 3AZJD 3MGSC 2HUEC 5AV5A 5JRGD 3AV2D 2NZDA 1B67A 3A6ND 3AV2B 4E44A 1P3LD 5AVCC 3KWQD 3A6NB 5CPIA 3AZED 1P3LB 4ZBJC 3AFAD 3AZNB 3AZEB 3UTAD 3AN2A 3WKJC 1ZLAB 3UTAB 4X23A 1P3FD 2YFVA 1HTAA 3WTPB 3KUYC 3R45A 4G92C 1P3ID 5GT3D 1WWIA 3WAAB 5B33A 4WNNA 3AZFA 3AN2C 5B24A 1Q9CA 5CP6A 1M18A 4QLCD 1ID3B 5B1LA 3X1UD 1BH8B 5AVBA 4XUJB 4AWLB 1P3AA 5CPJB 4JJND 4R8PA 3AV1B 5B40D 4JJNB 5B33C 1P3KD 3V9RA 1KX3D 5B24C 4Z2MG 2HIOD 4H9RB 3LJAD 4WU8D 5CP6C 2HIOB 4WU8B 3LJAB 1M18C 5B1LC 3MNNA 2AROA 5AVBC 1BFMA 5B31A 4Z66C 1P3AC 4R8PC 1S32D 5GT0B 2RVQC 4YM6A 3NQUB 3MVDC 4ZUXB 3AZHC 3AZGB 1KX4A 3MNNC 3MGPA 3AZKC 5B31C 5B2JA 5BS7A 1M19D 3X1SA 1M19B 1P3PB 3MGRB 1BH9A 3W96A 5B0ZA 4H9OB 4J8VA 4YS3A 4EO5B 5AV8A 3AZNC 4NFTA 1KX4C 4WU9B 5BNVB 4KUDB 4KGCC 1ZLAC 3MGQB 2F8NG 5BO0A 3WTPC 2F8NK 5GXQA 3X1SC 1P34A 4NE3A 3MGSD 3WAAC 5FUGB 5B0ZC 5KDMB 4J8VC 4YS3C 5AV8C 5AVCD 5AVCB 1KX5A 3C1CD 3VH5W 3B0CT 3WKJD 5GXQC 1TZYC 4XUJC 4AWLC 1P34C 3WKJB 1HQ3A 3KUYD 5CPJC 5AV6A 3B6GA 3AV1C 5AV5B 5GSUD 2NZDB 5DNNA 5CPIB 5B0YA 3KSYA 5CPKA 3AN2B 2F8NA 1AOIA 3W98A 4X23B 3LZ1A 1HQ3C 2YFVB 5B32D 1M1AA 3B6GC 3VH6W 3R45B 1P3BA 5B33D 5DNNC 4ZUXC 5B33B 3AZGC 5CPKC 3AZFB 5B24B 3W98C 5B1LD 5CP6B 1M18B 5AVBD 1M1AC 5B1LB 4Z66D 1P3AD 5AVBB 1P3PC 1P3AB 4R8PD 3MGRC 1F1EA 4R8PB 3B0DB 3V9RB 2RVQD 3MVDD 4KUDC 3AZHD 3MGQC 3MVDB 3MNND 3AZKD 3MNNB 5B31D 2AROB 5B31B 5BNXA 1TAFA 4H9SA 4YM6B 1P3GA 3AZND 4UUZB 1KX4D 4HGAB 3WA9A 4KGCD 1KX4B 1ZLAD 5B32G 3MGPB 4KGCB 5AV9A 5CHLB 3WTPD 5B2JB 3X1SD 5AV5C 4E45A 1B6WA 3X1SB 2NZDC 4LD9A 4J8WA 2JSSA 3WAAD 5B0ZD 4J8VD 4YS3D 1BH9B 5CPIC 5B0ZB 3W96B 4J8VB 4YS3B 5AV8B 1H3OA 5B2IA 3W99A 4X23C 1ID3D 5GXQD 5BO0B 1TZYD 4XUJD 1P34D 5GXQB 4KHAA 1TZYB 1P34B 5CPJD 2L5AA 5F99A 3REKA 3AV1D 3AZFC 1KX5B 3W97A 1HQ3D 2PYOA 1HQ3B 3B6GD 3O62A 3AZIA 3AYWA 5AV6B 5GT0D 4H9PA 3B6GB 3X1VA 3B0DC 5DNND 4ZUXD 5DNNB 3AZGD 5CPKD 5B0YB 3UTBA 3W97C 5CPKB 2F8NH 3W98D 2BYKA 2F8NB 2AROC 1AOIB 3W98B 3LZ1B 3O62C 3AZIC 3REIA 1M1AB 1P3PD 4J8UA 3X1VC 3MGRD 4YM6C 1P3BB 4J8XA 5JA4A 4HGAC 4WU9D 3UTBC 4KUDD 5E5AA 3AZMA 3MGQD 3MGPC 3AZJA 1ULYA 5B2JC 5BS7C 5JRGA 3AV2A 4J8UC 3KWQA 1N1JA 2BYMA 3AFAA 3W96C 3UTAA 1P3OA 5E5AC 3AZMC 1P3FA 4M6BA 3AZJC 5AY8A 1P3IA 5GT3A 1JFIA 1EQZA 3LZ0A 5AV5D 3AFAC 2NZDD 5C3IB 4H9NA 1P3OC 5BNXB 1TAFB 2CV5A 1P3FC 3TU4A 5CPID 1KX5C 4WV4B 3LELA 1P3GB 4QLCA 5AY8C 3X1UA 3AN2D 3WA9B 3NQJA 1P3IC 4X23D 2NQBA 1EQZC 3LZ0C 5B40A 5AV6C 1P3KA
chains in the Genus database with same CATH superfamily
2CV5C 4J8WB 4LD9B 4WU8A 3LJAA 3TU4C 5DNMA 3LELC 3AZFD 5B0YC 5B24D 3EPJA 4WNNB 1H3OB 5B2IB 1AOIC 2NQBC 3W99B 5CP6D 3LZ1C 1M18D 2ZY5A 1S32A 1U35A 4KHAB 4CAYA 5F99B 3REKB 5DNMC 1P3BC 3B6FA 1P3MA 5B1MA 3W97D 2AROD 3W97B 4XZQA 1U35C 2LY8A 3AZID 3X1TA 2PYOB 3O62B 3AZIB 3AYWB 3X1VD 2IO5C 3B6FC 4H9PB 5BNVA 3X1VB 4YM6D 1P3MC 5B1MC 3REJA 1KX3A 3UTBD 3UTBB 4XZQC 3MGPD 3MGSA 2BYKB 5B2JD 3REHA 3X1TC 3KXBA 2ZY2A 3REIB 4J8UD 5C3IC 4DQYB 4J8UB 3C1CA 4H9SC 3W96D 2YFWA 4CSRA 3REJC 4Z2MH 1P3GC 2G5IC 3B0CW 5AV8D 5E5AD 4J8XB 5JA4B 3WA9C 5E5AB 3AZMB 3KUYA 3AZJB 3REHC 5AV9C 3KXBC 3UT9A 5GSUA 5JRGB 4H9QA 2Y2NA 2CWEA 4DRAA 3KWQB 4LD9C 3C1CC 1N1JB 2BYMB 3WTPE 4J8WC 3C1BA 3AFAB 1P3OD 4WZSB 3VH5T 1P3OB 1KX5D 1P3FB 5B2IC 5AY8D 3W99C 5B31G 5B32A 5AY8B 3UT9C 5GSUC 1P3IB 2W8SA 5GT3B 1JFIB 1EQZD 2Y2IA 3LZ0D 2FJ7A 1EQZB 5AV6D 3LZ0B 2XD1A 4Z5TA 5F99C 3C1BC 3REKC 1F66A 5G49A 2CV5D 4H9NB 3TU4D 2CV5B 3LELD 3TU4B 5B0YD 3LELB 5B32C 4QLCB 5BT1C 1T3UA 3X1UB 4Z66A 2F8ND 1AOID 2NQBD 3NQJB 3LZ1D 2FJ7C 2NQBB 3RELA 3VH6T 2F2AC 2PYOC 1M1AD 5B40B 2Y2OA 4G91C 4NE5A 4Z5TC 3AYWC 2BG1A 1P3KB 1KX3B 1F66C 3MVDA 3AZLA 3AZHA 5DNMD 1P3BD 4NE6A 5DNMB 3AZKA 3EG5B 3RELC 2Y2QA 1U35D 3REIC 1S32B 1KU5A 1U35B 3A6NA 1P3LA 4UUZA 3AZLC 4CAYB 3AZNA 3B6FD 3AZEA 2IO5B 3B6FB 4KGCA 1P3MD 3EPLA 4J8XC 1ZLAA 5B1MD 1P3MB 5B1MB 3WTPA 4XZQD 3F6TA 5JRGC 3AV2C 4XZQB 3X1TD 3A6NC 3WAAA 1P3LC 3KWQC 3X1TB 3AZEC 3UTAC 3REJD 1P3GD 1ID3A 1R4VA 3REJB 1BH8A 1TZYA 4XUJA 3WA9D 3REHD 3MGSB 2HUEB 5GT3C 5AV9D 3KXBD 5CPJA 3AV1A 3REHB 5AV9B 3KXBB 4JJNA 4DRBA 3B0BA 4LD9D 4J8WD 4H9RA 2Y2HA 4ZBJB 3C1CB 2HIOA 1ID3C 2YFWB 4CSRB 4QLCC 3X1UC 5B2ID 3W99D 3EPKA 3KUYB 3UT9D 4JJNC 4G92B 5GT0A 3VH5A 3UT9B 5B40C 5GSUB 1P3KC 1KX3C 4H9QB 3NQUA 4ZUXA 3C1BD 5F99D 3REKD 2HIOC 2Y2GA 3LJAC 3AZGA 3C1BB 4WU8C 1A7WA 5BT1D 5B32B 5GT0C 1M19A 1P3PA 1S32C 2FJ7D 3MGRA 2PYOD 2FJ7B 3O62D 4Z5TD 4H9OA 3AYWD 1F66D 4Z5TB 1Z2CB 4G91B 1F66B 5G49B 4WU9A 4KUDA 3MGQA 3VH6A 1M19C 4Z66B 3RELD 2ZY3A 5FUGA 5KDMA 3REID 3RELB 4EO5C 4WU9C 3AZLD 5AVCA 3AZLB 3AZHB 4J8XD 3AZKB 3WKJA 3AZMD 1WWSA 3AZJD 3MGSC 2HUEC 5AV5A 5JRGD 3AV2D 2NZDA 1B67A 2Y2KA 3A6ND 3AV2B 4E44A 1P3LD 5AVCC 3KWQD 3A6NB 5CPIA 3AZED 1P3LB 4ZBJC 3AFAD 3AZNB 3AZEB 3UTAD 3AN2A 3WKJC 1ZLAB 3UTAB 4X23A 1P3FD 2YFVA 1HTAA 3WTPB 3KUYC 3R45A 4G92C 1P3ID 5GT3D 3EPHA 1WWIA 3WAAB 5B33A 4WNNA 3AZFA 3AN2C 5B24A 1Q9CA 5CP6A 1M18A 4QLCD 1ID3B 5B1LA 3X1UD 1BH8B 5AVBA 4XUJB 4AWLB 1P3AA 5CPJB 4JJND 4R8PA 3AV1B 5B40D 4JJNB 5B33C 1P3KD 3V9RA 1KX3D 5B24C 4Z2MG 2Y2LA 2HIOD 4H9RB 3LJAD 4WU8D 2UWXA 5CP6C 2HIOB 4WU8B 3LJAB 1M18C 5B1LC 3MNNA 2AROA 5AVBC 4UPKA 1BFMA 5B31A 4Z66C 1P3AC 4R8PC 1S32D 5GT0B 2RVQC 4YM6A 3NQUB 3MVDC 4ZUXB 3H0RC 3AZHC 3AZGB 1KX4A 3MNNC 3MGPA 3AZKC 2DF4C 5B31C 2G5HC 5B2JA 5BS7A 2VQRA 1M19D 3X1SA 1M19B 1P3PB 2RIQA 2ZM5A 3MGRB 1BH9A 3W96A 5B0ZA 4H9OB 4J8VA 3P5JB 4EO5B 5AV8A 3AZNC 4NFTA 4YS3A 1KX4C 4WU9B 5BNVB 4KUDB 4KGCC 1ZLAC 3MGQB 3A1KA 2F8NG 5BO0A 3WTPC 2F8NK 5GXQA 3X1SC 1P34A 4NE3A 3MGSD 2XD5A 3WAAC 5FUGB 5B0ZC 5KDMB 4J8VC 4YS3C 5AV8C 5AVCD 5AVCB 1KX5A 3C1CD 3VH5W 3B0CT 2Y2JA 3WKJD 2DQNC 5GXQC 1TZYC 4XUJC 4AWLC 1P34C 3WKJB 1HQ3A 3KUYD 5CPJC 5AV6A 3B6GA 3AV1C 5AV5B 5GSUD 2NZDB 5DNNA 5CPIB 5B0YA 3KSYA 5CPKA 3AN2B 3A1IA 2F8NA 1AOIA 3W98A 4X23B 3LZ1A 1HQ3C 2YFVB 5B32D 1M1AA 3B6GC 3VH6W 3R45B 1P3BA 5B33D 5DNNC 4ZUXC 5B33B 3AZGC 5CPKC 3AZFB 5B24B 3W98C 5B1LD 5CP6B 1M18B 5AVBD 1M1AC 5B1LB 4Z66D 1P3AD 5AVBB 1P3PC 1P3AB 4R8PD 3MGRC 1F1EA 4R8PB 3B0DB 3V9RB 2RVQD 3MVDD 4KUDC 3AZHD 3MGQC 3MVDB 3MNND 3AZKD 3MNNB 5B31D 2AROB 5B31B 3AL0C 3H0MC 5BNXA 1TAFA 3KFUG 4H9SA 4YM6B 1P3GA 3AZND 4UUZB 1KX4D 4HGAB 3WA9A 4KGCD 1KX4B 1ZLAD 5B32G 3MGPB 4KGCB 5AV9A 5CHLB 3WTPD 5B2JB 2JCHA 3X1SD 5AV5C 4E45A 1B6WA 3X1SB 2NZDC 4LD9A 4J8WA 1PZRA 2JSSA 3WAAD 5B0ZD 4J8VD 4YS3D 1BH9B 5CPIC 5B0ZB 3W96B 4J8VB 4YS3B 5AV8B 1H3OA 5B2IA 3W99A 4X23C 1ID3D 5GXQD 5BO0B 1TZYD 4XUJD 1P34D 5GXQB 4KHAA 1TZYB 1P34B 5CPJD 2Y2PA 2L5AA 5F99A 3REKA 3AV1D 3AZFC 1KX5B 2ZY4A 3W97A 1HQ3D 2PYOA 1HQ3B 3B6GD 3O62A 3AZIA 3AYWA 5AV6B 5GT0D 4H9PA 3B6GB 3X1VA 2JE5A 3B0DC 5DNND 4ZUXD 4WJ3C 5DNNB 3AZGD 5CPKD 5B0YB 3UTBA 3W97C 5CPKB 2F8NH 3W98D 2BYKA 2F8NB 2AROC 1AOIB 2J8PA 3W98B 3LZ1B 3O62C 3AZIC 3REIA 1M1AB 1P3PD 4J8UA 3X1VC 3MGRD 2Y2MA 4YM6C 1P3BB 4J8XA 5JA4A 4HGAC 4WU9D 3UTBC 4KUDD 5E5AA 3FDDA 3AZMA 3MGQD 3MGPC 3AZJA 1W2EA 1ULYA 5B2JC 5BS7C 5JRGA 3AV2A 2FFFB 4J8UC 3KWQA 1N1JA 2BYMA 3AFAA 3W96C 3UTAA 1P3OA 5E5AC 3AZMC 1P3FA 4M6BA 3AZJC 5AY8A 3IP4C 5GT3A 1P3IA 1JFIA 1EQZA 3LZ0A 5AV5D 3AFAC 2NZDD 5C3IB 4H9NA 1P3OC 5BNXB 1TAFB 2CV5A 1P3FC 3TU4A 5CPID 1KX5C 4WV4B 3LELA 1P3GB 4QLCA 5AY8C 3X1UA 3AN2D 3WA9B 3NQJA 1P3IC 4X23D 2NQBA 1EQZC 3LZ0C 5B40A 3H0LC 5AV6C 1P3KA
chains in the Genus database with same CATH topology
2CV5C 4J8WB 4LD9B 4WU8A 3LJAA 3TU4C 5DNMA 3LELC 3AZFD 5B0YC 5B24D 3EPJA 4WNNB 1H3OB 5B2IB 1AOIC 2NQBC 3W99B 5CP6D 3LZ1C 1M18D 2ZY5A 1S32A 1U35A 4KHAB 4CAYA 5F99B 3REKB 5DNMC 1P3BC 3B6FA 1P3MA 5B1MA 3W97D 2AROD 3W97B 4XZQA 1U35C 2LY8A 3AZID 3X1TA 2PYOB 3O62B 3AZIB 3AYWB 3X1VD 2IO5C 3B6FC 4H9PB 5BNVA 3X1VB 4YM6D 1P3MC 5B1MC 3REJA 1KX3A 3UTBD 3UTBB 4XZQC 3MGPD 3MGSA 2BYKB 5B2JD 3REHA 3X1TC 3KXBA 2ZY2A 3REIB 4J8UD 5C3IC 4DQYB 4J8UB 3C1CA 4H9SC 3W96D 2YFWA 4CSRA 3REJC 4Z2MH 1P3GC 2G5IC 3B0CW 5AV8D 5E5AD 4J8XB 5JA4B 3WA9C 5E5AB 3AZMB 3KUYA 3AZJB 3REHC 5AV9C 3KXBC 3UT9A 5GSUA 5JRGB 4H9QA 2Y2NA 2CWEA 4DRAA 3KWQB 4LD9C 3C1CC 1N1JB 2BYMB 3WTPE 4J8WC 3C1BA 3AFAB 1P3OD 4WZSB 3VH5T 1P3OB 1KX5D 1P3FB 5B2IC 5AY8D 3W99C 5B31G 5B32A 5AY8B 3UT9C 5GSUC 1P3IB 2W8SA 5GT3B 1JFIB 1EQZD 2Y2IA 3LZ0D 2FJ7A 1EQZB 5AV6D 3LZ0B 2XD1A 4Z5TA 5F99C 3C1BC 3REKC 1F66A 5G49A 2CV5D 4H9NB 3TU4D 2CV5B 3LELD 3TU4B 5B0YD 3LELB 5B32C 4QLCB 5BT1C 1T3UA 3X1UB 4Z66A 2F8ND 1AOID 2NQBD 3NQJB 3LZ1D 2FJ7C 2NQBB 3RELA 3VH6T 2F2AC 2PYOC 1M1AD 5B40B 2Y2OA 4G91C 4NE5A 4Z5TC 3AYWC 2BG1A 1P3KB 1KX3B 1F66C 3MVDA 3AZLA 3AZHA 5DNMD 1P3BD 4NE6A 5DNMB 3AZKA 3EG5B 3RELC 2Y2QA 1U35D 3REIC 1S32B 1KU5A 1U35B 3A6NA 1P3LA 4UUZA 3AZLC 4CAYB 3AZNA 3B6FD 3AZEA 2IO5B 3B6FB 4KGCA 1P3MD 3EPLA 4J8XC 1ZLAA 5B1MD 1P3MB 5B1MB 3WTPA 4XZQD 3F6TA 5JRGC 3AV2C 4XZQB 3X1TD 3A6NC 3WAAA 1P3LC 3KWQC 3X1TB 3AZEC 3UTAC 3REJD 1P3GD 1ID3A 1R4VA 3REJB 1BH8A 1TZYA 4XUJA 3WA9D 3REHD 3MGSB 2HUEB 5GT3C 5AV9D 3KXBD 5CPJA 3AV1A 3REHB 5AV9B 3KXBB 4JJNA 4DRBA 3B0BA 4LD9D 4J8WD 4H9RA 2Y2HA 4ZBJB 3C1CB 2HIOA 1ID3C 2YFWB 4CSRB 4QLCC 3X1UC 5B2ID 3W99D 3EPKA 3KUYB 3UT9D 4JJNC 4G92B 5GT0A 3VH5A 3UT9B 5B40C 5GSUB 1P3KC 1KX3C 4H9QB 3NQUA 4ZUXA 3C1BD 5F99D 3REKD 2HIOC 2Y2GA 3LJAC 3AZGA 3C1BB 4WU8C 1A7WA 5BT1D 5B32B 5GT0C 1M19A 1P3PA 1S32C 2FJ7D 3MGRA 2PYOD 2FJ7B 3O62D 4Z5TD 4H9OA 3AYWD 1F66D 4Z5TB 1Z2CB 4G91B 1F66B 5G49B 4WU9A 4KUDA 3MGQA 3VH6A 1M19C 4Z66B 3RELD 2ZY3A 5FUGA 5KDMA 3REID 3RELB 4EO5C 4WU9C 3AZLD 5AVCA 3AZLB 3AZHB 4J8XD 3AZKB 3WKJA 3AZMD 1WWSA 3AZJD 3MGSC 2HUEC 5AV5A 5JRGD 3AV2D 2NZDA 1B67A 2Y2KA 3A6ND 3AV2B 4E44A 1P3LD 5AVCC 3KWQD 3A6NB 5CPIA 3AZED 1P3LB 4ZBJC 3AFAD 3AZNB 3AZEB 3UTAD 3AN2A 3WKJC 1ZLAB 3UTAB 4X23A 1P3FD 2YFVA 1HTAA 3WTPB 3KUYC 3R45A 4G92C 1P3ID 5GT3D 3EPHA 1WWIA 3WAAB 5B33A 4WNNA 3AZFA 3AN2C 5B24A 1Q9CA 5CP6A 1M18A 4QLCD 1ID3B 5B1LA 3X1UD 1BH8B 5AVBA 4XUJB 4AWLB 1P3AA 5CPJB 4JJND 4R8PA 3AV1B 5B40D 4JJNB 5B33C 1P3KD 3V9RA 1KX3D 5B24C 4Z2MG 2Y2LA 2HIOD 4H9RB 3LJAD 4WU8D 2UWXA 5CP6C 2HIOB 4WU8B 3LJAB 1M18C 5B1LC 3MNNA 2AROA 5AVBC 4UPKA 1BFMA 5B31A 4Z66C 1P3AC 4R8PC 1S32D 5GT0B 2RVQC 4YM6A 3NQUB 3MVDC 4ZUXB 3H0RC 3AZHC 3AZGB 1KX4A 3MNNC 3MGPA 3AZKC 2DF4C 5B31C 2G5HC 5B2JA 5BS7A 2VQRA 1M19D 3X1SA 1M19B 1P3PB 2RIQA 2ZM5A 3MGRB 1BH9A 3W96A 5B0ZA 4H9OB 4J8VA 3P5JB 4EO5B 5AV8A 3AZNC 4NFTA 4YS3A 1KX4C 4WU9B 5BNVB 4KUDB 4KGCC 1ZLAC 3MGQB 3A1KA 2F8NG 5BO0A 3WTPC 2F8NK 5GXQA 3X1SC 1P34A 4NE3A 3MGSD 2XD5A 3WAAC 5FUGB 5B0ZC 5KDMB 4J8VC 4YS3C 5AV8C 5AVCD 5AVCB 1KX5A 3C1CD 3VH5W 3B0CT 2Y2JA 3WKJD 2DQNC 5GXQC 1TZYC 4XUJC 4AWLC 1P34C 3WKJB 1HQ3A 3KUYD 5CPJC 5AV6A 3B6GA 3AV1C 5AV5B 5GSUD 2NZDB 5DNNA 5CPIB 5B0YA 3KSYA 5CPKA 3AN2B 3A1IA 2F8NA 1AOIA 3W98A 4X23B 3LZ1A 1HQ3C 2YFVB 5B32D 1M1AA 3B6GC 3VH6W 3R45B 1P3BA 5B33D 5DNNC 4ZUXC 5B33B 3AZGC 5CPKC 3AZFB 5B24B 3W98C 5B1LD 5CP6B 1M18B 5AVBD 1M1AC 5B1LB 4Z66D 1P3AD 5AVBB 1P3PC 1P3AB 4R8PD 3MGRC 1F1EA 4R8PB 3B0DB 3V9RB 2RVQD 3MVDD 4KUDC 3AZHD 3MGQC 3MVDB 3MNND 3AZKD 3MNNB 5B31D 2AROB 5B31B 3AL0C 3H0MC 5BNXA 1TAFA 3KFUG 4H9SA 4YM6B 1P3GA 3AZND 4UUZB 1KX4D 4HGAB 3WA9A 4KGCD 1KX4B 1ZLAD 5B32G 3MGPB 4KGCB 5AV9A 5CHLB 3WTPD 5B2JB 2JCHA 3X1SD 5AV5C 4E45A 1B6WA 3X1SB 2NZDC 4LD9A 4J8WA 1PZRA 2JSSA 3WAAD 5B0ZD 4J8VD 4YS3D 1BH9B 5CPIC 5B0ZB 3W96B 4J8VB 4YS3B 5AV8B 1H3OA 5B2IA 3W99A 4X23C 1ID3D 5GXQD 5BO0B 1TZYD 4XUJD 1P34D 5GXQB 4KHAA 1TZYB 1P34B 5CPJD 2Y2PA 2L5AA 5F99A 3REKA 3AV1D 3AZFC 1KX5B 2ZY4A 3W97A 1HQ3D 2PYOA 1HQ3B 3B6GD 3O62A 3AZIA 3AYWA 5AV6B 5GT0D 4H9PA 3B6GB 3X1VA 2JE5A 3B0DC 5DNND 4ZUXD 4WJ3C 5DNNB 3AZGD 5CPKD 5B0YB 3UTBA 3W97C 5CPKB 2F8NH 3W98D 2BYKA 2F8NB 2AROC 1AOIB 2J8PA 3W98B 3LZ1B 3O62C 3AZIC 3REIA 1M1AB 1P3PD 4J8UA 3X1VC 3MGRD 2Y2MA 4YM6C 1P3BB 4J8XA 5JA4A 4HGAC 4WU9D 3UTBC 4KUDD 5E5AA 3FDDA 3AZMA 3MGQD 3MGPC 3AZJA 1W2EA 1ULYA 5B2JC 5BS7C 5JRGA 3AV2A 2FFFB 4J8UC 3KWQA 1N1JA 2BYMA 3AFAA 3W96C 3UTAA 1P3OA 5E5AC 3AZMC 1P3FA 4M6BA 3AZJC 5AY8A 3IP4C 5GT3A 1P3IA 1JFIA 1EQZA 3LZ0A 5AV5D 3AFAC 2NZDD 5C3IB 4H9NA 1P3OC 5BNXB 1TAFB 2CV5A 1P3FC 3TU4A 5CPID 1KX5C 4WV4B 3LELA 1P3GB 4QLCA 5AY8C 3X1UA 3AN2D 3WA9B 3NQJA 1P3IC 4X23D 2NQBA 1EQZC 3LZ0C 5B40A 3H0LC 5AV6C 1P3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 C;  4J8W B;  4LD9 B;  4WU8 A;  3LJA A;  3TU4 C;  5DNM A;  3LEL C;  3AZF D;  5B0Y C;  5B24 D;  4WNN B;  1H3O B;  5B2I B;  1AOI C;  2NQB C;  3W99 B;  5CP6 D;  3LZ1 C;  1M18 D;  1S32 A;  1U35 A;  4KHA B;  4CAY A;  5F99 B;  3REK B;  5DNM C;  1P3B C;  3B6F A;  1P3M A;  5B1M A;  3W97 D;  2ARO D;  3W97 B;  4XZQ A;  1U35 C;  2LY8 A;  3AZI D;  3X1T A;  2PYO B;  3O62 B;  3AZI B;  3AYW B;  3X1V D;  2IO5 C;  3B6F C;  4H9P B;  5BNV A;  3X1V B;  4YM6 D;  1P3M C;  5B1M C;  3REJ A;  1KX3 A;  3UTB D;  3UTB B;  4XZQ C;  3MGP D;  3MGS A;  2BYK B;  5B2J D;  3REH A;  3X1T C;  3KXB A;  3REI B;  4J8U D;  5C3I C;  4J8U B;  3C1C A;  4H9S C;  3W96 D;  2YFW A;  4CSR A;  3REJ C;  4Z2M H;  1P3G C;  5AV8 D;  3B0C W;  5E5A D;  4J8X B;  5JA4 B;  3WA9 C;  5E5A B;  3AZM B;  3KUY A;  3AZJ B;  3REH C;  5AV9 C;  3KXB C;  3UT9 A;  5GSU A;  5JRG B;  4H9Q A;  2CWE A;  4DRA A;  3KWQ B;  4LD9 C;  3C1C C;  1N1J B;  2BYM B;  3WTP E;  4J8W C;  3C1B A;  3AFA B;  1P3O D;  4WZS B;  3VH5 T;  1P3O B;  1KX5 D;  1P3F B;  5B2I C;  5AY8 D;  3W99 C;  5B31 G;  5B32 A;  5AY8 B;  3UT9 C;  5GSU C;  1P3I B;  5GT3 B;  1EQZ D;  1JFI B;  3LZ0 D;  2FJ7 A;  1EQZ B;  5AV6 D;  3LZ0 B;  3C1B C;  4Z5T A;  5F99 C;  3REK C;  1F66 A;  5G49 A;  2CV5 D;  4H9N B;  3TU4 D;  2CV5 B;  3LEL D;  3TU4 B;  5B0Y D;  3LEL B;  5B32 C;  4QLC B;  5BT1 C;  3X1U B;  4Z66 A;  2F8N D;  1AOI D;  2NQB D;  3NQJ B;  3LZ1 D;  2FJ7 C;  2NQB B;  3REL A;  3VH6 T;  2PYO C;  1M1A D;  5B40 B;  4Z5T C;  4G91 C;  4NE5 A;  3AYW C;  1F66 C;  1P3K B;  1KX3 B;  3MVD A;  3AZL A;  3AZH A;  5DNM D;  1P3B D;  4NE6 A;  5DNM B;  3AZK A;  3REL C;  1U35 D;  3REI C;  1S32 B;  1KU5 A;  1U35 B;  3A6N A;  1P3L A;  4UUZ A;  3AZL C;  4CAY B;  3AZN A;  3B6F D;  3AZE A;  2IO5 B;  3B6F B;  4KGC A;  1P3M D;  1ZLA A;  4J8X C;  5B1M D;  1P3M B;  5B1M B;  3WTP A;  4XZQ D;  5JRG C;  3AV2 C;  4XZQ B;  3X1T D;  3A6N C;  3WAA A;  1P3L C;  3KWQ C;  3X1T B;  3AZE C;  3UTA C;  3REJ D;  1P3G D;  1ID3 A;  1R4V A;  3REJ B;  1BH8 A;  1TZY A;  4XUJ A;  3WA9 D;  3REH D;  3MGS B;  2HUE B;  5GT3 C;  5AV9 D;  3KXB D;  5CPJ A;  3AV1 A;  3REH B;  5AV9 B;  3KXB B;  4JJN A;  4DRB A;  3B0B A;  4LD9 D;  4J8W D;  4H9R A;  4ZBJ B;  3C1C B;  2HIO A;  1ID3 C;  2YFW B;  4CSR B;  4QLC C;  3X1U C;  5B2I D;  3W99 D;  3KUY B;  3UT9 D;  4JJN C;  4G92 B;  5GT0 A;  3VH5 A;  3UT9 B;  5B40 C;  5GSU B;  1P3K C;  1KX3 C;  4H9Q B;  3NQU A;  4ZUX A;  3C1B D;  5F99 D;  3REK D;  2HIO C;  3LJA C;  4WU8 C;  3AZG A;  3C1B B;  1A7W A;  5BT1 D;  5B32 B;  5GT0 C;  1M19 A;  1P3P A;  1S32 C;  2FJ7 D;  3MGR A;  2PYO D;  2FJ7 B;  3O62 D;  4Z5T D;  4H9O A;  3AYW D;  1F66 D;  4Z5T B;  4G91 B;  1F66 B;  5G49 B;  4WU9 A;  4KUD A;  3MGQ A;  3VH6 A;  1M19 C;  4Z66 B;  3REL D;  5FUG A;  5KDM A;  3REI D;  3REL B;  4EO5 C;  4WU9 C;  3AZL D;  5AVC A;  3AZL B;  3AZH B;  4J8X D;  3AZK B;  3WKJ A;  3AZM D;  1WWS A;  3AZJ D;  3MGS C;  2HUE C;  5AV5 A;  5JRG D;  3AV2 D;  2NZD A;  1B67 A;  3A6N D;  3AV2 B;  4E44 A;  1P3L D;  5AVC C;  3KWQ D;  3A6N B;  5CPI A;  3AZE D;  1P3L B;  4ZBJ C;  3AFA D;  3AZN B;  3AZE B;  3UTA D;  3AN2 A;  3WKJ C;  1ZLA B;  3UTA B;  4X23 A;  1P3F D;  2YFV A;  1HTA A;  3WTP B;  3KUY C;  3R45 A;  4G92 C;  1P3I D;  5GT3 D;  1WWI A;  3WAA B;  5B33 A;  4WNN A;  3AZF A;  3AN2 C;  5B24 A;  1Q9C A;  5CP6 A;  1M18 A;  4QLC D;  1ID3 B;  5B1L A;  3X1U D;  1BH8 B;  5AVB A;  4XUJ B;  4AWL B;  1P3A A;  5CPJ B;  4JJN D;  4R8P A;  3AV1 B;  5B40 D;  4JJN B;  5B33 C;  1P3K D;  3V9R A;  1KX3 D;  5B24 C;  4Z2M G;  2HIO D;  4H9R B;  3LJA D;  4WU8 D;  5CP6 C;  2HIO B;  4WU8 B;  3LJA B;  1M18 C;  5B1L C;  3MNN A;  2ARO A;  5AVB C;  1BFM A;  5B31 A;  4Z66 C;  1P3A C;  4R8P C;  1S32 D;  5GT0 B;  2RVQ C;  4YM6 A;  3NQU B;  3MVD C;  4ZUX B;  3AZH C;  3AZG B;  1KX4 A;  3MNN C;  3MGP A;  3AZK C;  5B31 C;  5B2J A;  5BS7 A;  1M19 D;  3X1S A;  1M19 B;  1P3P B;  3MGR B;  1BH9 A;  3W96 A;  5B0Z A;  4H9O B;  4J8V A;  4YS3 A;  4EO5 B;  5AV8 A;  3AZN C;  4NFT A;  1KX4 C;  4WU9 B;  5BNV B;  4KUD B;  4KGC C;  1ZLA C;  3MGQ B;  2F8N G;  5BO0 A;  3WTP C;  2F8N K;  5GXQ A;  3X1S C;  1P34 A;  4NE3 A;  3MGS D;  3WAA C;  5FUG B;  5B0Z C;  5KDM B;  4J8V C;  4YS3 C;  5AV8 C;  5AVC D;  5AVC B;  1KX5 A;  3C1C D;  3VH5 W;  3B0C T;  3WKJ D;  5GXQ C;  1TZY C;  4XUJ C;  4AWL C;  1P34 C;  3WKJ B;  1HQ3 A;  3KUY D;  5CPJ C;  5AV6 A;  3B6G A;  3AV1 C;  5AV5 B;  5GSU D;  2NZD B;  5DNN A;  5CPI B;  5B0Y A;  3KSY A;  5CPK A;  3AN2 B;  2F8N A;  1AOI A;  3W98 A;  4X23 B;  3LZ1 A;  1HQ3 C;  2YFV B;  5B32 D;  1M1A A;  3B6G C;  3VH6 W;  3R45 B;  1P3B A;  5B33 D;  5DNN C;  4ZUX C;  5B33 B;  3AZG C;  5CPK C;  3AZF B;  5B24 B;  3W98 C;  5B1L D;  5CP6 B;  1M18 B;  5AVB D;  1M1A C;  5B1L B;  4Z66 D;  1P3A D;  5AVB B;  1P3P C;  1P3A B;  4R8P D;  3MGR C;  1F1E A;  4R8P B;  3B0D B;  3V9R B;  2RVQ D;  3MVD D;  4KUD C;  3AZH D;  3MGQ C;  3MVD B;  3MNN D;  3AZK D;  3MNN B;  5B31 D;  2ARO B;  5B31 B;  5BNX A;  1TAF A;  4H9S A;  4YM6 B;  1P3G A;  3AZN D;  4UUZ B;  1KX4 D;  4HGA B;  3WA9 A;  4KGC D;  1KX4 B;  1ZLA D;  5B32 G;  3MGP B;  4KGC B;  5AV9 A;  5CHL B;  3WTP D;  5B2J B;  3X1S D;  5AV5 C;  4E45 A;  1B6W A;  3X1S B;  2NZD C;  4LD9 A;  4J8W A;  2JSS A;  3WAA D;  5B0Z D;  4J8V D;  4YS3 D;  1BH9 B;  5CPI C;  5B0Z B;  3W96 B;  4J8V B;  4YS3 B;  5AV8 B;  1H3O A;  5B2I A;  3W99 A;  4X23 C;  1ID3 D;  5GXQ D;  5BO0 B;  1TZY D;  4XUJ D;  1P34 D;  5GXQ B;  4KHA A;  1TZY B;  1P34 B;  5CPJ D;  2L5A A;  5F99 A;  3REK A;  3AV1 D;  3AZF C;  1KX5 B;  3W97 A;  1HQ3 D;  2PYO A;  1HQ3 B;  3B6G D;  3O62 A;  3AZI A;  3AYW A;  5AV6 B;  5GT0 D;  4H9P A;  3B6G B;  3X1V A;  3B0D C;  5DNN D;  4ZUX D;  5DNN B;  3AZG D;  5CPK D;  5B0Y B;  3UTB A;  3W97 C;  5CPK B;  2F8N H;  3W98 D;  2BYK A;  2F8N B;  2ARO C;  1AOI B;  3W98 B;  3LZ1 B;  3O62 C;  3AZI C;  3REI A;  1M1A B;  1P3P D;  4J8U A;  3X1V C;  3MGR D;  4YM6 C;  1P3B B;  4J8X A;  5JA4 A;  4HGA C;  4WU9 D;  3UTB C;  4KUD D;  5E5A A;  3AZM A;  3MGQ D;  3MGP C;  3AZJ A;  1ULY A;  5B2J C;  5BS7 C;  5JRG A;  3AV2 A;  4J8U C;  3KWQ A;  1N1J A;  2BYM A;  3AFA A;  3W96 C;  3UTA A;  1P3O A;  5E5A C;  3AZM C;  1P3F A;  4M6B A;  3AZJ C;  5AY8 A;  1P3I A;  5GT3 A;  1JFI A;  1EQZ A;  3LZ0 A;  5AV5 D;  3AFA C;  2NZD D;  5C3I B;  4H9N A;  1P3O C;  5BNX B;  1TAF B;  2CV5 A;  1P3F C;  3TU4 A;  5CPI D;  1KX5 C;  4WV4 B;  3LEL A;  1P3G B;  4QLC A;  5AY8 C;  3X1U A;  3AN2 D;  3WA9 B;  3NQJ A;  1P3I C;  4X23 D;  2NQB A;  1EQZ C;  3LZ0 C;  5B40 A;  5AV6 C;  1P3K A; 
#chains in the Genus database with same CATH topology
 2CV5 C;  4J8W B;  4LD9 B;  4WU8 A;  3LJA A;  3TU4 C;  5DNM A;  3LEL C;  3AZF D;  5B0Y C;  5B24 D;  3EPJ A;  4WNN B;  1H3O B;  5B2I B;  1AOI C;  2NQB C;  3W99 B;  5CP6 D;  3LZ1 C;  1M18 D;  2ZY5 A;  1S32 A;  1U35 A;  4KHA B;  4CAY A;  5F99 B;  3REK B;  5DNM C;  1P3B C;  3B6F A;  1P3M A;  5B1M A;  3W97 D;  2ARO D;  3W97 B;  4XZQ A;  1U35 C;  2LY8 A;  3AZI D;  3X1T A;  2PYO B;  3O62 B;  3AZI B;  3AYW B;  3X1V D;  2IO5 C;  3B6F C;  4H9P B;  5BNV A;  3X1V B;  4YM6 D;  1P3M C;  5B1M C;  3REJ A;  1KX3 A;  3UTB D;  3UTB B;  4XZQ C;  3MGP D;  3MGS A;  2BYK B;  5B2J D;  3REH A;  3X1T C;  3KXB A;  2ZY2 A;  3REI B;  4J8U D;  5C3I C;  4DQY B;  4J8U B;  3C1C A;  4H9S C;  3W96 D;  2YFW A;  4CSR A;  3REJ C;  4Z2M H;  1P3G C;  2G5I C;  3B0C W;  5AV8 D;  5E5A D;  4J8X B;  5JA4 B;  3WA9 C;  5E5A B;  3AZM B;  3KUY A;  3AZJ B;  3REH C;  5AV9 C;  3KXB C;  3UT9 A;  5GSU A;  5JRG B;  4H9Q A;  2Y2N A;  2CWE A;  4DRA A;  3KWQ B;  4LD9 C;  3C1C C;  1N1J B;  2BYM B;  3WTP E;  4J8W C;  3C1B A;  3AFA B;  1P3O D;  4WZS B;  3VH5 T;  1P3O B;  1KX5 D;  1P3F B;  5B2I C;  5AY8 D;  3W99 C;  5B31 G;  5B32 A;  5AY8 B;  3UT9 C;  5GSU C;  1P3I B;  2W8S A;  5GT3 B;  1JFI B;  1EQZ D;  2Y2I A;  3LZ0 D;  2FJ7 A;  1EQZ B;  5AV6 D;  3LZ0 B;  2XD1 A;  4Z5T A;  5F99 C;  3C1B C;  3REK C;  1F66 A;  5G49 A;  2CV5 D;  4H9N B;  3TU4 D;  2CV5 B;  3LEL D;  3TU4 B;  5B0Y D;  3LEL B;  5B32 C;  4QLC B;  5BT1 C;  1T3U A;  3X1U B;  4Z66 A;  2F8N D;  1AOI D;  2NQB D;  3NQJ B;  3LZ1 D;  2FJ7 C;  2NQB B;  3REL A;  3VH6 T;  2F2A C;  2PYO C;  1M1A D;  5B40 B;  2Y2O A;  4G91 C;  4NE5 A;  4Z5T C;  3AYW C;  2BG1 A;  1P3K B;  1KX3 B;  1F66 C;  3MVD A;  3AZL A;  3AZH A;  5DNM D;  1P3B D;  4NE6 A;  5DNM B;  3AZK A;  3EG5 B;  3REL C;  2Y2Q A;  1U35 D;  3REI C;  1S32 B;  1KU5 A;  1U35 B;  3A6N A;  1P3L A;  4UUZ A;  3AZL C;  4CAY B;  3AZN A;  3B6F D;  3AZE A;  2IO5 B;  3B6F B;  4KGC A;  1P3M D;  3EPL A;  4J8X C;  1ZLA A;  5B1M D;  1P3M B;  5B1M B;  3WTP A;  4XZQ D;  3F6T A;  5JRG C;  3AV2 C;  4XZQ B;  3X1T D;  3A6N C;  3WAA A;  1P3L C;  3KWQ C;  3X1T B;  3AZE C;  3UTA C;  3REJ D;  1P3G D;  1ID3 A;  1R4V A;  3REJ B;  1BH8 A;  1TZY A;  4XUJ A;  3WA9 D;  3REH D;  3MGS B;  2HUE B;  5GT3 C;  5AV9 D;  3KXB D;  5CPJ A;  3AV1 A;  3REH B;  5AV9 B;  3KXB B;  4JJN A;  4DRB A;  3B0B A;  4LD9 D;  4J8W D;  4H9R A;  2Y2H A;  4ZBJ B;  3C1C B;  2HIO A;  1ID3 C;  2YFW B;  4CSR B;  4QLC C;  3X1U C;  5B2I D;  3W99 D;  3EPK A;  3KUY B;  3UT9 D;  4JJN C;  4G92 B;  5GT0 A;  3VH5 A;  3UT9 B;  5B40 C;  5GSU B;  1P3K C;  1KX3 C;  4H9Q B;  3NQU A;  4ZUX A;  3C1B D;  5F99 D;  3REK D;  2HIO C;  2Y2G A;  3LJA C;  3AZG A;  3C1B B;  4WU8 C;  1A7W A;  5BT1 D;  5B32 B;  5GT0 C;  1M19 A;  1P3P A;  1S32 C;  2FJ7 D;  3MGR A;  2PYO D;  2FJ7 B;  3O62 D;  4Z5T D;  4H9O A;  3AYW D;  1F66 D;  4Z5T B;  1Z2C B;  4G91 B;  1F66 B;  5G49 B;  4WU9 A;  4KUD A;  3MGQ A;  3VH6 A;  1M19 C;  4Z66 B;  3REL D;  2ZY3 A;  5FUG A;  5KDM A;  3REI D;  3REL B;  4EO5 C;  4WU9 C;  3AZL D;  5AVC A;  3AZL B;  3AZH B;  4J8X D;  3AZK B;  3WKJ A;  3AZM D;  1WWS A;  3AZJ D;  3MGS C;  2HUE C;  5AV5 A;  5JRG D;  3AV2 D;  2NZD A;  1B67 A;  2Y2K A;  3A6N D;  3AV2 B;  4E44 A;  1P3L D;  5AVC C;  3KWQ D;  3A6N B;  5CPI A;  3AZE D;  1P3L B;  4ZBJ C;  3AFA D;  3AZN B;  3AZE B;  3UTA D;  3AN2 A;  3WKJ C;  1ZLA B;  3UTA B;  4X23 A;  1P3F D;  2YFV A;  1HTA A;  3WTP B;  3KUY C;  3R45 A;  4G92 C;  1P3I D;  5GT3 D;  3EPH A;  1WWI A;  3WAA B;  5B33 A;  4WNN A;  3AZF A;  3AN2 C;  5B24 A;  1Q9C A;  5CP6 A;  1M18 A;  4QLC D;  1ID3 B;  5B1L A;  3X1U D;  1BH8 B;  5AVB A;  4XUJ B;  4AWL B;  1P3A A;  5CPJ B;  4JJN D;  4R8P A;  3AV1 B;  5B40 D;  4JJN B;  5B33 C;  1P3K D;  3V9R A;  1KX3 D;  5B24 C;  4Z2M G;  2Y2L A;  2HIO D;  4H9R B;  3LJA D;  4WU8 D;  2UWX A;  5CP6 C;  2HIO B;  4WU8 B;  3LJA B;  1M18 C;  5B1L C;  3MNN A;  2ARO A;  5AVB C;  4UPK A;  1BFM A;  5B31 A;  4Z66 C;  1P3A C;  4R8P C;  1S32 D;  5GT0 B;  2RVQ C;  4YM6 A;  3NQU B;  3MVD C;  4ZUX B;  3H0R C;  3AZH C;  3AZG B;  1KX4 A;  3MNN C;  3MGP A;  3AZK C;  2DF4 C;  5B31 C;  2G5H C;  5B2J A;  5BS7 A;  2VQR A;  1M19 D;  3X1S A;  1M19 B;  1P3P B;  2RIQ A;  2ZM5 A;  3MGR B;  1BH9 A;  3W96 A;  5B0Z A;  4H9O B;  4J8V A;  3P5J B;  4EO5 B;  5AV8 A;  3AZN C;  4NFT A;  4YS3 A;  1KX4 C;  4WU9 B;  5BNV B;  4KUD B;  4KGC C;  1ZLA C;  3MGQ B;  3A1K A;  2F8N G;  5BO0 A;  3WTP C;  2F8N K;  5GXQ A;  3X1S C;  1P34 A;  4NE3 A;  3MGS D;  2XD5 A;  3WAA C;  5FUG B;  5B0Z C;  5KDM B;  4J8V C;  4YS3 C;  5AV8 C;  5AVC D;  5AVC B;  1KX5 A;  3C1C D;  3VH5 W;  3B0C T;  2Y2J A;  3WKJ D;  2DQN C;  5GXQ C;  1TZY C;  4XUJ C;  4AWL C;  1P34 C;  3WKJ B;  1HQ3 A;  3KUY D;  5CPJ C;  5AV6 A;  3B6G A;  3AV1 C;  5AV5 B;  5GSU D;  2NZD B;  5DNN A;  5CPI B;  5B0Y A;  3KSY A;  5CPK A;  3AN2 B;  3A1I A;  2F8N A;  1AOI A;  3W98 A;  4X23 B;  3LZ1 A;  1HQ3 C;  2YFV B;  5B32 D;  1M1A A;  3B6G C;  3VH6 W;  3R45 B;  1P3B A;  5B33 D;  5DNN C;  4ZUX C;  5B33 B;  3AZG C;  5CPK C;  3AZF B;  5B24 B;  3W98 C;  5B1L D;  5CP6 B;  1M18 B;  5AVB D;  1M1A C;  5B1L B;  4Z66 D;  1P3A D;  5AVB B;  1P3P C;  1P3A B;  4R8P D;  3MGR C;  1F1E A;  4R8P B;  3B0D B;  3V9R B;  2RVQ D;  3MVD D;  4KUD C;  3AZH D;  3MGQ C;  3MVD B;  3MNN D;  3AZK D;  3MNN B;  5B31 D;  2ARO B;  5B31 B;  3AL0 C;  3H0M C;  5BNX A;  1TAF A;  3KFU G;  4H9S A;  4YM6 B;  1P3G A;  3AZN D;  4UUZ B;  1KX4 D;  4HGA B;  3WA9 A;  4KGC D;  1KX4 B;  1ZLA D;  5B32 G;  3MGP B;  4KGC B;  5AV9 A;  5CHL B;  3WTP D;  5B2J B;  2JCH A;  3X1S D;  5AV5 C;  4E45 A;  1B6W A;  3X1S B;  2NZD C;  4LD9 A;  4J8W A;  1PZR A;  2JSS A;  3WAA D;  5B0Z D;  4J8V D;  4YS3 D;  1BH9 B;  5CPI C;  5B0Z B;  3W96 B;  4J8V B;  4YS3 B;  5AV8 B;  1H3O A;  5B2I A;  3W99 A;  4X23 C;  1ID3 D;  5GXQ D;  5BO0 B;  1TZY D;  4XUJ D;  1P34 D;  5GXQ B;  4KHA A;  1TZY B;  1P34 B;  5CPJ D;  2Y2P A;  2L5A A;  5F99 A;  3REK A;  3AV1 D;  3AZF C;  1KX5 B;  2ZY4 A;  3W97 A;  1HQ3 D;  2PYO A;  1HQ3 B;  3B6G D;  3O62 A;  3AZI A;  3AYW A;  5AV6 B;  5GT0 D;  4H9P A;  3B6G B;  3X1V A;  2JE5 A;  3B0D C;  5DNN D;  4ZUX D;  4WJ3 C;  5DNN B;  3AZG D;  5CPK D;  5B0Y B;  3UTB A;  3W97 C;  5CPK B;  2F8N H;  3W98 D;  2BYK A;  2F8N B;  2ARO C;  1AOI B;  2J8P A;  3W98 B;  3LZ1 B;  3O62 C;  3AZI C;  3REI A;  1M1A B;  1P3P D;  4J8U A;  3X1V C;  3MGR D;  2Y2M A;  4YM6 C;  1P3B B;  4J8X A;  5JA4 A;  4HGA C;  4WU9 D;  3UTB C;  4KUD D;  5E5A A;  3FDD A;  3AZM A;  3MGQ D;  3MGP C;  3AZJ A;  1W2E A;  1ULY A;  5B2J C;  5BS7 C;  5JRG A;  3AV2 A;  2FFF B;  4J8U C;  3KWQ A;  1N1J A;  2BYM A;  3AFA A;  3W96 C;  3UTA A;  1P3O A;  5E5A C;  3AZM C;  1P3F A;  4M6B A;  3AZJ C;  5AY8 A;  3IP4 C;  5GT3 A;  1P3I A;  1JFI A;  1EQZ A;  3LZ0 A;  5AV5 D;  3AFA C;  2NZD D;  5C3I B;  4H9N A;  1P3O C;  5BNX B;  1TAF B;  2CV5 A;  1P3F C;  3TU4 A;  5CPI D;  1KX5 C;  4WV4 B;  3LEL A;  1P3G B;  4QLC A;  5AY8 C;  3X1U A;  3AN2 D;  3WA9 B;  3NQJ A;  1P3I C;  4X23 D;  2NQB A;  1EQZ C;  3LZ0 C;  5B40 A;  3H0L C;  5AV6 C;  1P3K A; 
#chains in the Genus database with same CATH homology
 2CV5 C;  4J8W B;  4LD9 B;  4WU8 A;  3LJA A;  3TU4 C;  5DNM A;  3LEL C;  3AZF D;  5B0Y C;  5B24 D;  3EPJ A;  4WNN B;  1H3O B;  5B2I B;  1AOI C;  2NQB C;  3W99 B;  5CP6 D;  3LZ1 C;  1M18 D;  2ZY5 A;  1S32 A;  1U35 A;  4KHA B;  4CAY A;  5F99 B;  3REK B;  5DNM C;  1P3B C;  3B6F A;  1P3M A;  5B1M A;  3W97 D;  2ARO D;  3W97 B;  4XZQ A;  1U35 C;  2LY8 A;  3AZI D;  3X1T A;  2PYO B;  3O62 B;  3AZI B;  3AYW B;  3X1V D;  2IO5 C;  3B6F C;  4H9P B;  5BNV A;  3X1V B;  4YM6 D;  1P3M C;  5B1M C;  3REJ A;  1KX3 A;  3UTB D;  3UTB B;  4XZQ C;  3MGP D;  3MGS A;  2BYK B;  5B2J D;  3REH A;  3X1T C;  3KXB A;  2ZY2 A;  3REI B;  4J8U D;  5C3I C;  4DQY B;  4J8U B;  3C1C A;  4H9S C;  3W96 D;  2YFW A;  4CSR A;  3REJ C;  4Z2M H;  1P3G C;  2G5I C;  3B0C W;  5AV8 D;  5E5A D;  4J8X B;  5JA4 B;  3WA9 C;  5E5A B;  3AZM B;  3KUY A;  3AZJ B;  3REH C;  5AV9 C;  3KXB C;  3UT9 A;  5GSU A;  5JRG B;  4H9Q A;  2Y2N A;  2CWE A;  4DRA A;  3KWQ B;  4LD9 C;  3C1C C;  1N1J B;  2BYM B;  3WTP E;  4J8W C;  3C1B A;  3AFA B;  1P3O D;  4WZS B;  3VH5 T;  1P3O B;  1KX5 D;  1P3F B;  5B2I C;  5AY8 D;  3W99 C;  5B31 G;  5B32 A;  5AY8 B;  3UT9 C;  5GSU C;  1P3I B;  2W8S A;  5GT3 B;  1JFI B;  1EQZ D;  2Y2I A;  3LZ0 D;  2FJ7 A;  1EQZ B;  5AV6 D;  3LZ0 B;  2XD1 A;  4Z5T A;  5F99 C;  3C1B C;  3REK C;  1F66 A;  5G49 A;  2CV5 D;  4H9N B;  3TU4 D;  2CV5 B;  3LEL D;  3TU4 B;  5B0Y D;  3LEL B;  5B32 C;  4QLC B;  5BT1 C;  1T3U A;  3X1U B;  4Z66 A;  2F8N D;  1AOI D;  2NQB D;  3NQJ B;  3LZ1 D;  2FJ7 C;  2NQB B;  3REL A;  3VH6 T;  2F2A C;  2PYO C;  1M1A D;  5B40 B;  2Y2O A;  4G91 C;  4NE5 A;  4Z5T C;  3AYW C;  2BG1 A;  1P3K B;  1KX3 B;  1F66 C;  3MVD A;  3AZL A;  3AZH A;  5DNM D;  1P3B D;  4NE6 A;  5DNM B;  3AZK A;  3EG5 B;  3REL C;  2Y2Q A;  1U35 D;  3REI C;  1S32 B;  1KU5 A;  1U35 B;  3A6N A;  1P3L A;  4UUZ A;  3AZL C;  4CAY B;  3AZN A;  3B6F D;  3AZE A;  2IO5 B;  3B6F B;  4KGC A;  1P3M D;  3EPL A;  4J8X C;  1ZLA A;  5B1M D;  1P3M B;  5B1M B;  3WTP A;  4XZQ D;  3F6T A;  5JRG C;  3AV2 C;  4XZQ B;  3X1T D;  3A6N C;  3WAA A;  1P3L C;  3KWQ C;  3X1T B;  3AZE C;  3UTA C;  3REJ D;  1P3G D;  1ID3 A;  1R4V A;  3REJ B;  1BH8 A;  1TZY A;  4XUJ A;  3WA9 D;  3REH D;  3MGS B;  2HUE B;  5GT3 C;  5AV9 D;  3KXB D;  5CPJ A;  3AV1 A;  3REH B;  5AV9 B;  3KXB B;  4JJN A;  4DRB A;  3B0B A;  4LD9 D;  4J8W D;  4H9R A;  2Y2H A;  4ZBJ B;  3C1C B;  2HIO A;  1ID3 C;  2YFW B;  4CSR B;  4QLC C;  3X1U C;  5B2I D;  3W99 D;  3EPK A;  3KUY B;  3UT9 D;  4JJN C;  4G92 B;  5GT0 A;  3VH5 A;  3UT9 B;  5B40 C;  5GSU B;  1P3K C;  1KX3 C;  4H9Q B;  3NQU A;  4ZUX A;  3C1B D;  5F99 D;  3REK D;  2HIO C;  2Y2G A;  3LJA C;  3AZG A;  3C1B B;  4WU8 C;  1A7W A;  5BT1 D;  5B32 B;  5GT0 C;  1M19 A;  1P3P A;  1S32 C;  2FJ7 D;  3MGR A;  2PYO D;  2FJ7 B;  3O62 D;  4Z5T D;  4H9O A;  3AYW D;  1F66 D;  4Z5T B;  1Z2C B;  4G91 B;  1F66 B;  5G49 B;  4WU9 A;  4KUD A;  3MGQ A;  3VH6 A;  1M19 C;  4Z66 B;  3REL D;  2ZY3 A;  5FUG A;  5KDM A;  3REI D;  3REL B;  4EO5 C;  4WU9 C;  3AZL D;  5AVC A;  3AZL B;  3AZH B;  4J8X D;  3AZK B;  3WKJ A;  3AZM D;  1WWS A;  3AZJ D;  3MGS C;  2HUE C;  5AV5 A;  5JRG D;  3AV2 D;  2NZD A;  1B67 A;  2Y2K A;  3A6N D;  3AV2 B;  4E44 A;  1P3L D;  5AVC C;  3KWQ D;  3A6N B;  5CPI A;  3AZE D;  1P3L B;  4ZBJ C;  3AFA D;  3AZN B;  3AZE B;  3UTA D;  3AN2 A;  3WKJ C;  1ZLA B;  3UTA B;  4X23 A;  1P3F D;  2YFV A;  1HTA A;  3WTP B;  3KUY C;  3R45 A;  4G92 C;  1P3I D;  5GT3 D;  3EPH A;  1WWI A;  3WAA B;  5B33 A;  4WNN A;  3AZF A;  3AN2 C;  5B24 A;  1Q9C A;  5CP6 A;  1M18 A;  4QLC D;  1ID3 B;  5B1L A;  3X1U D;  1BH8 B;  5AVB A;  4XUJ B;  4AWL B;  1P3A A;  5CPJ B;  4JJN D;  4R8P A;  3AV1 B;  5B40 D;  4JJN B;  5B33 C;  1P3K D;  3V9R A;  1KX3 D;  5B24 C;  4Z2M G;  2Y2L A;  2HIO D;  4H9R B;  3LJA D;  4WU8 D;  2UWX A;  5CP6 C;  2HIO B;  4WU8 B;  3LJA B;  1M18 C;  5B1L C;  3MNN A;  2ARO A;  5AVB C;  4UPK A;  1BFM A;  5B31 A;  4Z66 C;  1P3A C;  4R8P C;  1S32 D;  5GT0 B;  2RVQ C;  4YM6 A;  3NQU B;  3MVD C;  4ZUX B;  3H0R C;  3AZH C;  3AZG B;  1KX4 A;  3MNN C;  3MGP A;  3AZK C;  2DF4 C;  5B31 C;  2G5H C;  5B2J A;  5BS7 A;  2VQR A;  1M19 D;  3X1S A;  1M19 B;  1P3P B;  2RIQ A;  2ZM5 A;  3MGR B;  1BH9 A;  3W96 A;  5B0Z A;  4H9O B;  4J8V A;  3P5J B;  4EO5 B;  5AV8 A;  3AZN C;  4NFT A;  4YS3 A;  1KX4 C;  4WU9 B;  5BNV B;  4KUD B;  4KGC C;  1ZLA C;  3MGQ B;  3A1K A;  2F8N G;  5BO0 A;  3WTP C;  2F8N K;  5GXQ A;  3X1S C;  1P34 A;  4NE3 A;  3MGS D;  2XD5 A;  3WAA C;  5FUG B;  5B0Z C;  5KDM B;  4J8V C;  4YS3 C;  5AV8 C;  5AVC D;  5AVC B;  1KX5 A;  3C1C D;  3VH5 W;  3B0C T;  2Y2J A;  3WKJ D;  2DQN C;  5GXQ C;  1TZY C;  4XUJ C;  4AWL C;  1P34 C;  3WKJ B;  1HQ3 A;  3KUY D;  5CPJ C;  5AV6 A;  3B6G A;  3AV1 C;  5AV5 B;  5GSU D;  2NZD B;  5DNN A;  5CPI B;  5B0Y A;  3KSY A;  5CPK A;  3AN2 B;  3A1I A;  2F8N A;  1AOI A;  3W98 A;  4X23 B;  3LZ1 A;  1HQ3 C;  2YFV B;  5B32 D;  1M1A A;  3B6G C;  3VH6 W;  3R45 B;  1P3B A;  5B33 D;  5DNN C;  4ZUX C;  5B33 B;  3AZG C;  5CPK C;  3AZF B;  5B24 B;  3W98 C;  5B1L D;  5CP6 B;  1M18 B;  5AVB D;  1M1A C;  5B1L B;  4Z66 D;  1P3A D;  5AVB B;  1P3P C;  1P3A B;  4R8P D;  3MGR C;  1F1E A;  4R8P B;  3B0D B;  3V9R B;  2RVQ D;  3MVD D;  4KUD C;  3AZH D;  3MGQ C;  3MVD B;  3MNN D;  3AZK D;  3MNN B;  5B31 D;  2ARO B;  5B31 B;  3AL0 C;  3H0M C;  5BNX A;  1TAF A;  3KFU G;  4H9S A;  4YM6 B;  1P3G A;  3AZN D;  4UUZ B;  1KX4 D;  4HGA B;  3WA9 A;  4KGC D;  1KX4 B;  1ZLA D;  5B32 G;  3MGP B;  4KGC B;  5AV9 A;  5CHL B;  3WTP D;  5B2J B;  2JCH A;  3X1S D;  5AV5 C;  4E45 A;  1B6W A;  3X1S B;  2NZD C;  4LD9 A;  4J8W A;  1PZR A;  2JSS A;  3WAA D;  5B0Z D;  4J8V D;  4YS3 D;  1BH9 B;  5CPI C;  5B0Z B;  3W96 B;  4J8V B;  4YS3 B;  5AV8 B;  1H3O A;  5B2I A;  3W99 A;  4X23 C;  1ID3 D;  5GXQ D;  5BO0 B;  1TZY D;  4XUJ D;  1P34 D;  5GXQ B;  4KHA A;  1TZY B;  1P34 B;  5CPJ D;  2Y2P A;  2L5A A;  5F99 A;  3REK A;  3AV1 D;  3AZF C;  1KX5 B;  2ZY4 A;  3W97 A;  1HQ3 D;  2PYO A;  1HQ3 B;  3B6G D;  3O62 A;  3AZI A;  3AYW A;  5AV6 B;  5GT0 D;  4H9P A;  3B6G B;  3X1V A;  2JE5 A;  3B0D C;  5DNN D;  4ZUX D;  4WJ3 C;  5DNN B;  3AZG D;  5CPK D;  5B0Y B;  3UTB A;  3W97 C;  5CPK B;  2F8N H;  3W98 D;  2BYK A;  2F8N B;  2ARO C;  1AOI B;  2J8P A;  3W98 B;  3LZ1 B;  3O62 C;  3AZI C;  3REI A;  1M1A B;  1P3P D;  4J8U A;  3X1V C;  3MGR D;  2Y2M A;  4YM6 C;  1P3B B;  4J8X A;  5JA4 A;  4HGA C;  4WU9 D;  3UTB C;  4KUD D;  5E5A A;  3FDD A;  3AZM A;  3MGQ D;  3MGP C;  3AZJ A;  1W2E A;  1ULY A;  5B2J C;  5BS7 C;  5JRG A;  3AV2 A;  2FFF B;  4J8U C;  3KWQ A;  1N1J A;  2BYM A;  3AFA A;  3W96 C;  3UTA A;  1P3O A;  5E5A C;  3AZM C;  1P3F A;  4M6B A;  3AZJ C;  5AY8 A;  3IP4 C;  5GT3 A;  1P3I A;  1JFI A;  1EQZ A;  3LZ0 A;  5AV5 D;  3AFA C;  2NZD D;  5C3I B;  4H9N A;  1P3O C;  5BNX B;  1TAF B;  2CV5 A;  1P3F C;  3TU4 A;  5CPI D;  1KX5 C;  4WV4 B;  3LEL A;  1P3G B;  4QLC A;  5AY8 C;  3X1U A;  3AN2 D;  3WA9 B;  3NQJ A;  1P3I C;  4X23 D;  2NQB A;  1EQZ C;  3LZ0 C;  5B40 A;  3H0L C;  5AV6 C;  1P3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...