3WA9D

The nucleosome containing human h2a.z.1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9D00
4Z66B 5B1LA 5BS7C 4EO5B 5B32A 5B33A 4WU8A 3REIA 5B1LB 4H9SC 5AVBC 3B6GA 5C3IC 5B32B 5G49A 3WA9C 4WU8B 3REIB 2NZDD 3B6GB 3AZNC 3O62D 4DRAA 1TAFA 5JRGA 5G49B 4H9RA 3REHA 1P3FA 5B0ZD 3VH5A 5B0YA 4WNNA 5JRGB 5F99C 3WAAA 3AV1C 4H9RB 3REHB 5B2JA 5B24A 1KX3D 5GSUD 5B0YB 4WNNB 3WAAB 4YM6A 5B2JB 3KXBA 4X23D 1M18D 4NE6A 5B2IA 2F8NA 3KXBB 5B40A 5B2IB 4J8VB 1BFMA 3UTAC 2F8NB 5B40B 5AV5C 2NZDC 5BT1C 3O62C 3UT9C 1EQZD 3REKB 1P3MD 3C1BD 3LJAA 1KX5D 1M19C 4H9QA 5GSUC 3W97D 3LJAB 4NE5A 1P3OA 3AZJD 3MGPD 1ID3D 1P3BA 3WTPE 1M18C 5DNNA 3W96A 1P3OB 3MVDC 1P3BB 2IO5B 1P3ID 5DNNB 4Z66D 3W96B 3LZ1A 4WU9C 3AN2D 1BH8A 3VH5W 5CP6C 5AV9C 3MNNA 4Z2MH 1EQZC 3WTPD 3B6FD 3LZ1B 1WWIA 1P3MC 1BH8B 5B33D 3MNNB 1KX4A 4J8WB 4G92C 2F8NH 3W97C 2FJ7D 1KX4B 3AZJC 3MGPC 3AZGD 1ID3C 3KUYD 5GT3D 1WWSA 3VH6A 3X1VA 5DNMC 1P3FD 4XUJC 4XZQC 3AV2D 3WAAD 3UTBA 3C1CC 4J8XC 5B2JD 5B24D 3X1VB 2F8NG 4Z66C 1U35A 1TZYA 3UTBB 3AN2C 3AZIA 4EO5C 4YM6D 4ZUXD 3AZMD 2YFVA 1KU5A 5B1LC 1H3OA 1U35B 1TZYB 5B2ID 5B32C 5B33C 3AZLA 2YFVB 3REIC 4WU8C 3AZFA 1H3OB 3AZND 1P3LA 3WKJA 3AZLB 1HQ3A 3AZFB 1P3PA 3AZGC 1P3LB 5AVCA 5B31A 5JRGC 3WKJB 5F99D 1HQ3B 1P3PB 1P3FC 4AWLB 5B0YC 5AVCB 5B31B 3WAAC 3LJAD 4HGAB 5B2JC 5B24C 4KGCA 4ZBJC 2RVQC 4YM6C 3KXBC 4ZUXC 3AZMC 1P3OD 4KGCB 3MGSA 1P3AA 5B2IC 5CPJA 3UTAD 4J8UA 3AZEA 1AOIA 5AV5D 3X1SA 3MGQA 3MGSB 3VH5T 3KWQD 1P3AB 2AROD 1F66A 5BT1D 3UT9D 5CPJB 4J8UB 3AZEB 3VH6W 1AOIB 3X1SB 3MGQB 1F66B 3B0CT 3LELA 5AV6A 1M19D 5E5AD 5GT0A 3AZKA 3X1TA 4H9OA 1R4VA 3LJAC 3LELB 5AV6B 5GT0B 3TU4A 3AZKB 3X1TB 1JFIA 3MGRA 4H9OB 5GXQA 4J8VA 3W99A 3AYWA 3TU4B 1P3OC 1JFIB 3MGRB 3MVDD 2IO5C 5GXQB 3W99B 5DNNC 3AFAA 1P3KA 3AYWB 3W96C 4JJND 5CPIA 4WU9D 3REKA 4LD9B 3KWQC 5CP6D 5AV9D 2AROC 4YS3D 3B0DB 3B0BA 3AFAB 4R8PD 1P3KB 4KUDA 3NQJA 1A7WA 3LZ1C 5CPIB 3AZID 1F1EA 3MNNC 2HIOA 4KUDB 5JA4A 3NQJB 2HUEB 2F8NK 5E5AC 2CV5D 5AVBA 2HIOB 5B31G 3AZLD 3REJA 4CSRA 5JA4B 4Z5TA 3KSYA 5AVBB 1P34A 3WKJD 3REJB 4CSRB 4Z5TB 1ZLAA 5DNMD 4XUJD 5B1MA 4XZQD 1P34B 2CWEA 5AY8D 3C1CD 4J8XD 3X1VC 1ZLAB 2BYKA 4JJNC 5B1MB 5CPKA 3UTBC 5BNVA 3LZ0A 4YS3C 3AV1B 4R8PC 4WZSB 2BYKB 5B1LD 5CPKB 2L5AA 1U35C 4J8WA 3AZIC 5BNVB 3LZ0B 5B32D 3V9RA 3B0CW 4KHAA 3REID 4WU8D 1P3AD 3W98A 2CV5C 3B6GD 5CPJD 3AZLC 3VH6T 3V9RB 4KHAB 3AZFC 3W98B 1F66D 1P3LC 5JRGD 3WKJC 1HQ3C 3REHD 5BNXA 1P3PC 4AWLC 3A6NA 5B0YD 5B0ZA 5AVCC 5B31C 5AY8C 4HGAC 5BNXB 1KX3A 3A6NB 5B0ZB 5GSUA 2RVQD 3KXBD 4KGCC 4E45A 1KX3B 5GSUB 4X23A 4J8VD 4H9NA 3AYWD 2F8ND 3AZHA 5B40D 3MGSC 4X23B 1P3AC 4H9NB 4UUZA 4QLCA 3B6GC 3AFAD 5CPJC 1AOIC 3AZHB 3MGQC 3REKD 1HTAA 4UUZB 4QLCB 1F66C 4KUDD 3REHC 1P3MA 2HIOD 3RELA 3C1BA 1EQZB 1KX5A 5AV6C 2NQBA 4WV4B 5GT0C 3AZKC 1P3MB 3REJD 3RELB 3C1BB 1KX5B 2NQBB 3TU4C 4NFTA 3MGRC 1P3BD 5KDMA 4J8VC 3W99C 4E44A 3W97B 5DNND 3AYWC 5AV8A 4G91B 3W96D 5B40C 5KDMB 1P3IA 3AFAC 1P3KC 5AV8B 3LZ1D 5CPIC 4NE3A 4H9PA 3REKC 1N1JA 2PYOA 3AN2A 3MNND 1P3IB 4KUDC 2HUEC 3WTPA 3B6FA 1P3GA 2PYOB 4H9PB 1N1JB 4CAYA 4J8WD 3AN2B 1S32A 2HIOC 3WTPB 3B6FB 1P3GB 1KX4D 4CAYB 3W98D 1S32B 5B33B 3REJC 3X1UA 4Z5TC 3R45A 1M1AA 2FJ7A 1P34C 3AZGA 1P3BC 4LD9A 3KUYA 3X1UB 5GT3A 1ZLAC 3X1VD 3R45B 1M1AB 2FJ7B 3A6ND 5B1MC 3AZGB 3UTBD 3AV2A 1TAFB 3KUYB 5GT3B 1P3FB 5CPKC 1U35D 1TZYD 3AV2B 3LZ0C 5BS7A 5FUGA 5B24B 4ZUXA 3AZMA 4ZBJB 4J8WC 4H9SA 2BYMA 5FUGB 4YM6B 3AZHD 4ZUXB 3AZMB 3AZFD 3WA9A 1KX4C 4QLCD 3W98C 1P3LD 3AZNA 2BYMB 5C3IB 1HQ3D 3WA9B 1P3PD 5AVCD 5B31D 3AZNB 5F99A 3AV1A 3A6NC 5B0ZC 3RELD 2NQBD 5F99B 4KGCD 1KX3C 1TZYC 4H9QB 5BO0A 3MGSD 4X23C 5AV8D 4J8UD 3AZHC 3AZED 3UTAA 1AOID 5BO0B 3X1SD 3MGQD 5AV5A 4QLCC 3KWQA 2NZDA 2AROA 5B32G 3O62A 3UT9A 3UTAB 2PYOD 5AV5B 3KWQB 2NZDB 2AROB 3NQUA 3LELD 3O62B 3UT9B 5AV6D 1P3GD 5GT0D 3AZKD 3X1TD 1M19A 5E5AA 1S32D 3NQUB 3RELC 3C1BC 2JSSA 1KX5C 2NQBC 1ULYA 3TU4D 1M19B 5E5AB 3MGRD 1Q9CA 5GXQD 3X1UD 3W99D 1M18A 1M1AD 4G91C 4Z2MG 4LD9D 3MVDA 1M18B 5AV8C 1P3KD 4J8UC 3AZEC 1BH9A 4JJNA 5CPID 3X1SC 3MVDB 4WU9A 1P3IC 5CP6A 5AV9A 4YS3A 1EQZA 1B6WA 4R8PA 1BH9B 4JJNB 2PYOC 4WU9B 5CP6B 5AV9B 4YS3B 3LELC 3WTPC 4R8PB 3B6FC 1P3GC 3X1TC 1S32C 5AVBD 5CHLB 4M6BA 3AZIB 2CV5A 3W97A 4Z5TD 1B67A 3WA9D 2YFWA 1P34D 4DRBA 3AZJA 2CV5B 3MGPA 4G92B 1ID3A 5GXQC 3X1UC 1ZLAD 1M1AC 2FJ7C 5DNMA 2YFWB 5B1MD 4XUJA 3AZJB 4XZQA 3MGPB 1ID3B 4LD9C 3KUYC 2LY8A 5AY8A 5GT3C 3AV1D 3C1CA 3B0DC 4J8XA 5DNMB 4Z66A 4XUJB 5CPKD 3AV2C 4XZQB 5AY8B 3LZ0D 3C1CB 4J8XB
chains in the Genus database with same CATH superfamily
4Z66B 5B1LA 5BS7C 4EO5B 5B32A 5B33A 4WU8A 3REIA 5B1LB 2ZY4A 4H9SC 5AVBC 3B6GA 5C3IC 5B32B 5G49A 3WA9C 4WU8B 3REIB 2DF4C 2NZDD 3B6GB 2XD1A 3AZNC 3O62D 4DRAA 1TAFA 5JRGA 5G49B 4H9RA 3REHA 1P3FA 5B0ZD 3VH5A 5B0YA 4WNNA 5JRGB 5F99C 3WAAA 3AV1C 4H9RB 3REHB 5B2JA 5B24A 1KX3D 2Y2NA 5GSUD 2UWXA 4WNNB 5B0YB 3WAAB 2RIQA 4YM6A 5B2JB 3KXBA 4X23D 1M18D 4NE6A 5B2IA 2BG1A 3KXBB 2F8NA 5B40A 1T3UA 5B2IB 4J8VB 1BFMA 3UTAC 2F8NB 5B40B 5AV5C 2NZDC 5BT1C 3O62C 3UT9C 1EQZD 3REKB 1P3MD 3C1BD 2Y2QA 3LJAA 1KX5D 1M19C 3P5JB 4H9QA 5GSUC 3W97D 3LJAB 4NE5A 2Y2HA 3AZJD 1P3OA 3MGPD 1ID3D 1P3BA 3WTPE 1M18C 5DNNA 3W96A 1P3OB 3H0LC 3MVDC 3F6TA 1P3BB 2IO5B 1P3ID 5DNNB 4Z66D 3W96B 3LZ1A 4WU9C 3AN2D 3H0RC 1BH8A 3VH5W 5CP6C 5AV9C 3MNNA 4Z2MH 1EQZC 3WTPD 3B6FD 3LZ1B 1WWIA 1P3MC 1BH8B 5B33D 3MNNB 1KX4A 4J8WB 4G92C 2F8NH 3W97C 2FJ7D 2ZY3A 1KX4B 3AZJC 3MGPC 3AZGD 1ID3C 3KUYD 5GT3D 1WWSA 3VH6A 3X1VA 5DNMC 1P3FD 4XUJC 2ZY5A 4XZQC 3AV2D 3WAAD 3UTBA 3C1CC 4J8XC 5B2JD 5B24D 3X1VB 2F8NG 4Z66C 1U35A 1TZYA 3UTBB 3AN2C 3AZIA 4EO5C 4YM6D 4ZUXD 3AZMD 2YFVA 1KU5A 5B1LC 1H3OA 1U35B 1TZYB 5B2ID 5B32C 5B33C 3AZLA 2YFVB 3REIC 4WU8C 3AZFA 1H3OB 3AZND 1P3LA 2VQRA 3WKJA 3AZLB 1HQ3A 3AZFB 1P3PA 3AZGC 1P3LB 5AVCA 5B31A 5JRGC 3WKJB 5F99D 2Y2PA 3H0MC 1HQ3B 1P3PB 1P3FC 4AWLB 5B0YC 5AVCB 5B31B 3WAAC 3LJAD 4HGAB 5B2JC 5B24C 4KGCA 4ZBJC 2RVQC 4YM6C 3KXBC 4ZUXC 3AZMC 1P3OD 4KGCB 3MGSA 1P3AA 5B2IC 5CPJA 3UTAD 4J8UA 3AZEA 1AOIA 5AV5D 3X1SA 3MGQA 3MGSB 3VH5T 3KWQD 1P3AB 2AROD 1F66A 5BT1D 3UT9D 5CPJB 4J8UB 3AZEB 2Y2KA 3VH6W 1AOIB 3X1SB 3MGQB 2Y2JA 1F66B 3B0CT 3LELA 5AV6A 1M19D 5E5AD 5GT0A 3AZKA 3X1TA 4H9OA 1R4VA 3LJAC 3LELB 5AV6B 5GT0B 3TU4A 3AZKB 3X1TB 1JFIA 3MGRA 4H9OB 5GXQA 4J8VA 3W99A 3EPLA 3AYWA 3TU4B 1P3OC 1JFIB 3MGRB 3MVDD 2IO5C 5GXQB 3W99B 5DNNC 3AFAA 1P3KA 3AYWB 3W96C 4JJND 5CPIA 4WU9D 3REKA 4LD9B 3KWQC 5CP6D 5AV9D 2AROC 4YS3D 3B0DB 3B0BA 3AFAB 4R8PD 1P3KB 4KUDA 3NQJA 1A7WA 3LZ1C 5CPIB 3AZID 1F1EA 3MNNC 2HIOA 4KUDB 5JA4A 3NQJB 2HUEB 2F8NK 5E5AC 2CV5D 5AVBA 2HIOB 5B31G 3AZLD 3REJA 2DQNC 4CSRA 5JA4B 4Z5TA 2Y2LA 3KSYA 5AVBB 1P34A 3WKJD 3REJB 4CSRB 3IP4C 4Z5TB 1ZLAA 5DNMD 4XUJD 5B1MA 2J8PA 4XZQD 1P34B 2CWEA 5AY8D 3C1CD 4J8XD 3X1VC 1ZLAB 2BYKA 4JJNC 5B1MB 5CPKA 3FDDA 3UTBC 3AL0C 5BNVA 3LZ0A 4YS3C 3AV1B 4R8PC 4WZSB 2BYKB 5B1LD 5CPKB 2L5AA 1U35C 4J8WA 3AZIC 3A1IA 5BNVB 5B32D 3LZ0B 3V9RA 3B0CW 4KHAA 3REID 4WU8D 1P3AD 3W98A 2CV5C 3B6GD 5CPJD 3AZLC 3VH6T 3V9RB 4KHAB 3AZFC 2W8SA 3W98B 1F66D 1P3LC 2Y2IA 5JRGD 3WKJC 1HQ3C 3REHD 5BNXA 1P3PC 4AWLC 3A6NA 5B0YD 5B0ZA 5AVCC 5B31C 5AY8C 4HGAC 5BNXB 1KX3A 3A6NB 2FFFB 5B0ZB 5GSUA 2RVQD 3KXBD 4KGCC 4E45A 1KX3B 5GSUB 4X23A 4J8VD 4H9NA 2Y2MA 3AYWD 2F8ND 3AZHA 5B40D 3MGSC 4X23B 1P3AC 4H9NB 4UUZA 4QLCA 3B6GC 3AFAD 5CPJC 3EPKA 3AZHB 1AOIC 3MGQC 3REKD 1HTAA 4UUZB 4QLCB 1F66C 4KUDD 3REHC 1P3MA 2HIOD 3RELA 3C1BA 1Z2CB 2ZM5A 1EQZB 1KX5A 5AV6C 2NQBA 4WV4B 5GT0C 3AZKC 4DQYB 1P3MB 3REJD 3RELB 3C1BB 1KX5B 2NQBB 3TU4C 4WJ3C 4NFTA 3MGRC 1P3BD 5KDMA 4J8VC 3W99C 4E44A 3W97B 5DNND 3AYWC 5AV8A 4G91B 3W96D 5B40C 5KDMB 1P3IA 3AFAC 1P3KC 5AV8B 3LZ1D 5CPIC 4NE3A 4H9PA 3REKC 1N1JA 2PYOA 3AN2A 3MNND 1P3IB 1PZRA 4KUDC 2HUEC 3WTPA 3B6FA 1P3GA 2PYOB 4H9PB 1N1JB 4CAYA 4J8WD 3AN2B 1S32A 2HIOC 2JE5A 3WTPB 3B6FB 1P3GB 1KX4D 4CAYB 3W98D 1S32B 5B33B 3REJC 3X1UA 4Z5TC 3R45A 1M1AA 2FJ7A 2F2AC 1P34C 3AZGA 1P3BC 4LD9A 3KUYA 5GT3A 3X1UB 1ZLAC 3X1VD 3R45B 1M1AB 2FJ7B 3A6ND 5B1MC 3AZGB 3UTBD 3AV2A 1TAFB 3KUYB 2XD5A 5GT3B 1P3FB 5CPKC 1U35D 1TZYD 3AV2B 3LZ0C 5BS7A 5FUGA 5B24B 4ZUXA 3AZMA 1W2EA 4ZBJB 4J8WC 4H9SA 2BYMA 5FUGB 4YM6B 3AZHD 4ZUXB 3AZMB 3AZFD 3WA9A 1KX4C 4QLCD 3W98C 1P3LD 3AZNA 2BYMB 2Y2OA 5C3IB 3EPJA 1HQ3D 3WA9B 1P3PD 2JCHA 5AVCD 5B31D 3AZNB 5F99A 3AV1A 3A6NC 5B0ZC 3RELD 2NQBD 5F99B 3EPHA 4KGCD 1KX3C 1TZYC 4H9QB 5BO0A 3MGSD 4X23C 5AV8D 4J8UD 3AZHC 2ZY2A 3UTAA 3AZED 1AOID 5BO0B 3X1SD 3MGQD 4UPKA 5AV5A 4QLCC 3KWQA 2NZDA 2AROA 5B32G 3O62A 3UT9A 3UTAB 2PYOD 5AV5B 3KWQB 2NZDB 2AROB 3NQUA 3LELD 3O62B 3UT9B 5AV6D 1P3GD 5GT0D 3AZKD 3X1TD 1M19A 5E5AA 1S32D 3NQUB 2G5IC 3RELC 3C1BC 2JSSA 1KX5C 2NQBC 1ULYA 3TU4D 1M19B 5E5AB 3MGRD 1Q9CA 5GXQD 3X1UD 3W99D 1M18A 1M1AD 4G91C 4Z2MG 4LD9D 3MVDA 1M18B 5AV8C 1P3KD 4J8UC 3AZEC 1BH9A 3EG5B 4JJNA 3X1SC 5CPID 3MVDB 4WU9A 1P3IC 5CP6A 5AV9A 4YS3A 1EQZA 1B6WA 4R8PA 1BH9B 4JJNB 2PYOC 4WU9B 2Y2GA 5CP6B 5AV9B 4YS3B 3LELC 2G5HC 3WTPC 3A1KA 4R8PB 3B6FC 1P3GC 3X1TC 1S32C 5AVBD 5CHLB 4M6BA 3AZIB 2CV5A 3W97A 4Z5TD 1B67A 3WA9D 2YFWA 1P34D 4DRBA 3AZJA 2CV5B 3MGPA 4G92B 1ID3A 5GXQC 3X1UC 1ZLAD 1M1AC 2FJ7C 5DNMA 2YFWB 5B1MD 4XUJA 3AZJB 4XZQA 3MGPB 1ID3B 4LD9C 3KFUG 3KUYC 2LY8A 5AY8A 5GT3C 3AV1D 3C1CA 3B0DC 4J8XA 5DNMB 4Z66A 4XUJB 5CPKD 3AV2C 4XZQB 5AY8B 3LZ0D 3C1CB 4J8XB
chains in the Genus database with same CATH topology
4Z66B 5B1LA 5BS7C 4EO5B 5B32A 5B33A 4WU8A 3REIA 5B1LB 2ZY4A 4H9SC 5AVBC 3B6GA 5C3IC 5B32B 5G49A 3WA9C 4WU8B 3REIB 2DF4C 2NZDD 3B6GB 2XD1A 3AZNC 3O62D 4DRAA 1TAFA 5JRGA 5G49B 4H9RA 3REHA 1P3FA 5B0ZD 3VH5A 5B0YA 4WNNA 5JRGB 5F99C 3WAAA 3AV1C 4H9RB 3REHB 5B2JA 5B24A 1KX3D 2Y2NA 5GSUD 2UWXA 4WNNB 5B0YB 3WAAB 2RIQA 4YM6A 5B2JB 3KXBA 4X23D 1M18D 4NE6A 5B2IA 2BG1A 3KXBB 2F8NA 5B40A 1T3UA 5B2IB 4J8VB 1BFMA 3UTAC 2F8NB 5B40B 5AV5C 2NZDC 5BT1C 3O62C 3UT9C 1EQZD 3REKB 1P3MD 3C1BD 2Y2QA 3LJAA 1KX5D 1M19C 3P5JB 4H9QA 5GSUC 3W97D 3LJAB 4NE5A 2Y2HA 3AZJD 1P3OA 3MGPD 1ID3D 1P3BA 3WTPE 1M18C 5DNNA 3W96A 1P3OB 3H0LC 3MVDC 3F6TA 1P3BB 2IO5B 1P3ID 5DNNB 4Z66D 3W96B 3LZ1A 4WU9C 3AN2D 3H0RC 1BH8A 3VH5W 5CP6C 5AV9C 3MNNA 4Z2MH 1EQZC 3WTPD 3B6FD 3LZ1B 1WWIA 1P3MC 1BH8B 5B33D 3MNNB 1KX4A 4J8WB 4G92C 2F8NH 3W97C 2FJ7D 2ZY3A 1KX4B 3AZJC 3MGPC 3AZGD 1ID3C 3KUYD 5GT3D 1WWSA 3VH6A 3X1VA 5DNMC 1P3FD 4XUJC 2ZY5A 4XZQC 3AV2D 3WAAD 3UTBA 3C1CC 4J8XC 5B2JD 5B24D 3X1VB 2F8NG 4Z66C 1U35A 1TZYA 3UTBB 3AN2C 3AZIA 4EO5C 4YM6D 4ZUXD 3AZMD 2YFVA 1KU5A 5B1LC 1H3OA 1U35B 1TZYB 5B2ID 5B32C 5B33C 3AZLA 2YFVB 3REIC 4WU8C 3AZFA 1H3OB 3AZND 1P3LA 2VQRA 3WKJA 3AZLB 1HQ3A 3AZFB 1P3PA 3AZGC 1P3LB 5AVCA 5B31A 5JRGC 3WKJB 5F99D 2Y2PA 3H0MC 1HQ3B 1P3PB 1P3FC 4AWLB 5B0YC 5AVCB 5B31B 3WAAC 3LJAD 4HGAB 5B2JC 5B24C 4KGCA 4ZBJC 2RVQC 4YM6C 3KXBC 4ZUXC 3AZMC 1P3OD 4KGCB 3MGSA 1P3AA 5B2IC 5CPJA 3UTAD 4J8UA 3AZEA 1AOIA 5AV5D 3X1SA 3MGQA 3MGSB 3VH5T 3KWQD 1P3AB 2AROD 1F66A 5BT1D 3UT9D 5CPJB 4J8UB 3AZEB 2Y2KA 3VH6W 1AOIB 3X1SB 3MGQB 2Y2JA 1F66B 3B0CT 3LELA 5AV6A 1M19D 5E5AD 5GT0A 3AZKA 3X1TA 4H9OA 1R4VA 3LJAC 3LELB 5AV6B 5GT0B 3TU4A 3AZKB 3X1TB 1JFIA 3MGRA 4H9OB 5GXQA 4J8VA 3W99A 3EPLA 3AYWA 3TU4B 1P3OC 1JFIB 3MGRB 3MVDD 2IO5C 5GXQB 3W99B 5DNNC 3AFAA 1P3KA 3AYWB 3W96C 4JJND 5CPIA 4WU9D 3REKA 4LD9B 3KWQC 5CP6D 5AV9D 2AROC 4YS3D 3B0DB 3B0BA 3AFAB 4R8PD 1P3KB 4KUDA 3NQJA 1A7WA 3LZ1C 5CPIB 3AZID 1F1EA 3MNNC 2HIOA 4KUDB 5JA4A 3NQJB 2HUEB 2F8NK 5E5AC 2CV5D 5AVBA 2HIOB 5B31G 3AZLD 3REJA 2DQNC 4CSRA 5JA4B 4Z5TA 2Y2LA 3KSYA 5AVBB 1P34A 3WKJD 3REJB 4CSRB 3IP4C 4Z5TB 1ZLAA 5DNMD 4XUJD 5B1MA 2J8PA 4XZQD 1P34B 2CWEA 5AY8D 3C1CD 4J8XD 3X1VC 1ZLAB 2BYKA 4JJNC 5B1MB 5CPKA 3FDDA 3UTBC 3AL0C 5BNVA 3LZ0A 4YS3C 3AV1B 4R8PC 4WZSB 2BYKB 5B1LD 5CPKB 2L5AA 1U35C 4J8WA 3AZIC 3A1IA 5BNVB 5B32D 3LZ0B 3V9RA 3B0CW 4KHAA 3REID 4WU8D 1P3AD 3W98A 2CV5C 3B6GD 5CPJD 3AZLC 3VH6T 3V9RB 4KHAB 3AZFC 2W8SA 3W98B 1F66D 1P3LC 2Y2IA 5JRGD 3WKJC 1HQ3C 3REHD 5BNXA 1P3PC 4AWLC 3A6NA 5B0YD 5B0ZA 5AVCC 5B31C 5AY8C 4HGAC 5BNXB 1KX3A 3A6NB 2FFFB 5B0ZB 5GSUA 2RVQD 3KXBD 4KGCC 4E45A 1KX3B 5GSUB 4X23A 4J8VD 4H9NA 2Y2MA 3AYWD 2F8ND 3AZHA 5B40D 3MGSC 4X23B 1P3AC 4H9NB 4UUZA 4QLCA 3B6GC 3AFAD 5CPJC 3EPKA 3AZHB 1AOIC 3MGQC 3REKD 1HTAA 4UUZB 4QLCB 1F66C 4KUDD 3REHC 1P3MA 2HIOD 3RELA 3C1BA 1Z2CB 2ZM5A 1EQZB 1KX5A 5AV6C 2NQBA 4WV4B 5GT0C 3AZKC 4DQYB 1P3MB 3REJD 3RELB 3C1BB 1KX5B 2NQBB 3TU4C 4WJ3C 4NFTA 3MGRC 1P3BD 5KDMA 4J8VC 3W99C 4E44A 3W97B 5DNND 3AYWC 5AV8A 4G91B 3W96D 5B40C 5KDMB 1P3IA 3AFAC 1P3KC 5AV8B 3LZ1D 5CPIC 4NE3A 4H9PA 3REKC 1N1JA 2PYOA 3AN2A 3MNND 1P3IB 1PZRA 4KUDC 2HUEC 3WTPA 3B6FA 1P3GA 2PYOB 4H9PB 1N1JB 4CAYA 4J8WD 3AN2B 1S32A 2HIOC 2JE5A 3WTPB 3B6FB 1P3GB 1KX4D 4CAYB 3W98D 1S32B 5B33B 3REJC 3X1UA 4Z5TC 3R45A 1M1AA 2FJ7A 2F2AC 1P34C 3AZGA 1P3BC 4LD9A 3KUYA 5GT3A 3X1UB 1ZLAC 3X1VD 3R45B 1M1AB 2FJ7B 3A6ND 5B1MC 3AZGB 3UTBD 3AV2A 1TAFB 3KUYB 2XD5A 5GT3B 1P3FB 5CPKC 1U35D 1TZYD 3AV2B 3LZ0C 5BS7A 5FUGA 5B24B 4ZUXA 3AZMA 1W2EA 4ZBJB 4J8WC 4H9SA 2BYMA 5FUGB 4YM6B 3AZHD 4ZUXB 3AZMB 3AZFD 3WA9A 1KX4C 4QLCD 3W98C 1P3LD 3AZNA 2BYMB 2Y2OA 5C3IB 3EPJA 1HQ3D 3WA9B 1P3PD 2JCHA 5AVCD 5B31D 3AZNB 5F99A 3AV1A 3A6NC 5B0ZC 3RELD 2NQBD 5F99B 3EPHA 4KGCD 1KX3C 1TZYC 4H9QB 5BO0A 3MGSD 4X23C 5AV8D 4J8UD 3AZHC 2ZY2A 3UTAA 3AZED 1AOID 5BO0B 3X1SD 3MGQD 4UPKA 5AV5A 4QLCC 3KWQA 2NZDA 2AROA 5B32G 3O62A 3UT9A 3UTAB 2PYOD 5AV5B 3KWQB 2NZDB 2AROB 3NQUA 3LELD 3O62B 3UT9B 5AV6D 1P3GD 5GT0D 3AZKD 3X1TD 1M19A 5E5AA 1S32D 3NQUB 2G5IC 3RELC 3C1BC 2JSSA 1KX5C 2NQBC 1ULYA 3TU4D 1M19B 5E5AB 3MGRD 1Q9CA 5GXQD 3X1UD 3W99D 1M18A 1M1AD 4G91C 4Z2MG 4LD9D 3MVDA 1M18B 5AV8C 1P3KD 4J8UC 3AZEC 1BH9A 3EG5B 4JJNA 3X1SC 5CPID 3MVDB 4WU9A 1P3IC 5CP6A 5AV9A 4YS3A 1EQZA 1B6WA 4R8PA 1BH9B 4JJNB 2PYOC 4WU9B 2Y2GA 5CP6B 5AV9B 4YS3B 3LELC 2G5HC 3WTPC 3A1KA 4R8PB 3B6FC 1P3GC 3X1TC 1S32C 5AVBD 5CHLB 4M6BA 3AZIB 2CV5A 3W97A 4Z5TD 1B67A 3WA9D 2YFWA 1P34D 4DRBA 3AZJA 2CV5B 3MGPA 4G92B 1ID3A 5GXQC 3X1UC 1ZLAD 1M1AC 2FJ7C 5DNMA 2YFWB 5B1MD 4XUJA 3AZJB 4XZQA 3MGPB 1ID3B 4LD9C 3KFUG 3KUYC 2LY8A 5AY8A 5GT3C 3AV1D 3C1CA 3B0DC 4J8XA 5DNMB 4Z66A 4XUJB 5CPKD 3AV2C 4XZQB 5AY8B 3LZ0D 3C1CB 4J8XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z66 B;  5B1L A;  5BS7 C;  4EO5 B;  5B32 A;  5B33 A;  4WU8 A;  3REI A;  5B1L B;  4H9S C;  5AVB C;  3B6G A;  5C3I C;  5B32 B;  5G49 A;  3WA9 C;  4WU8 B;  3REI B;  2NZD D;  3B6G B;  3AZN C;  3O62 D;  4DRA A;  1TAF A;  5JRG A;  5G49 B;  4H9R A;  3REH A;  1P3F A;  5B0Z D;  3VH5 A;  5B0Y A;  4WNN A;  5JRG B;  5F99 C;  3WAA A;  3AV1 C;  4H9R B;  3REH B;  5B2J A;  5B24 A;  1KX3 D;  5GSU D;  5B0Y B;  4WNN B;  3WAA B;  4YM6 A;  5B2J B;  3KXB A;  4X23 D;  1M18 D;  4NE6 A;  5B2I A;  2F8N A;  3KXB B;  5B40 A;  5B2I B;  4J8V B;  1BFM A;  3UTA C;  2F8N B;  5B40 B;  5AV5 C;  2NZD C;  5BT1 C;  3O62 C;  3UT9 C;  1EQZ D;  3REK B;  1P3M D;  3C1B D;  3LJA A;  1KX5 D;  1M19 C;  4H9Q A;  5GSU C;  3W97 D;  3LJA B;  4NE5 A;  1P3O A;  3AZJ D;  3MGP D;  1ID3 D;  1P3B A;  3WTP E;  1M18 C;  5DNN A;  3W96 A;  1P3O B;  3MVD C;  1P3B B;  2IO5 B;  1P3I D;  5DNN B;  4Z66 D;  3W96 B;  3LZ1 A;  4WU9 C;  3AN2 D;  1BH8 A;  3VH5 W;  5CP6 C;  5AV9 C;  3MNN A;  4Z2M H;  1EQZ C;  3WTP D;  3B6F D;  3LZ1 B;  1WWI A;  1P3M C;  1BH8 B;  5B33 D;  3MNN B;  1KX4 A;  4J8W B;  4G92 C;  2F8N H;  3W97 C;  2FJ7 D;  1KX4 B;  3AZJ C;  3MGP C;  3AZG D;  1ID3 C;  3KUY D;  5GT3 D;  1WWS A;  3VH6 A;  3X1V A;  5DNM C;  1P3F D;  4XUJ C;  4XZQ C;  3AV2 D;  3WAA D;  3UTB A;  3C1C C;  4J8X C;  5B2J D;  5B24 D;  3X1V B;  2F8N G;  4Z66 C;  1U35 A;  1TZY A;  3UTB B;  3AN2 C;  3AZI A;  4EO5 C;  4YM6 D;  4ZUX D;  3AZM D;  2YFV A;  1KU5 A;  5B1L C;  1H3O A;  1U35 B;  1TZY B;  5B2I D;  5B32 C;  5B33 C;  3AZL A;  2YFV B;  3REI C;  4WU8 C;  3AZF A;  1H3O B;  3AZN D;  1P3L A;  3WKJ A;  3AZL B;  1HQ3 A;  3AZF B;  1P3P A;  3AZG C;  1P3L B;  5AVC A;  5B31 A;  5JRG C;  3WKJ B;  5F99 D;  1HQ3 B;  1P3P B;  1P3F C;  4AWL B;  5B0Y C;  5AVC B;  5B31 B;  3WAA C;  3LJA D;  4HGA B;  5B2J C;  5B24 C;  4KGC A;  4ZBJ C;  2RVQ C;  4YM6 C;  3KXB C;  4ZUX C;  3AZM C;  1P3O D;  4KGC B;  3MGS A;  1P3A A;  5B2I C;  5CPJ A;  3UTA D;  4J8U A;  3AZE A;  1AOI A;  5AV5 D;  3X1S A;  3MGQ A;  3MGS B;  3VH5 T;  3KWQ D;  1P3A B;  2ARO D;  1F66 A;  5BT1 D;  3UT9 D;  5CPJ B;  4J8U B;  3AZE B;  3VH6 W;  1AOI B;  3X1S B;  3MGQ B;  1F66 B;  3B0C T;  3LEL A;  5AV6 A;  1M19 D;  5E5A D;  5GT0 A;  3AZK A;  3X1T A;  4H9O A;  1R4V A;  3LJA C;  3LEL B;  5AV6 B;  5GT0 B;  3TU4 A;  3AZK B;  3X1T B;  1JFI A;  3MGR A;  4H9O B;  5GXQ A;  4J8V A;  3W99 A;  3AYW A;  3TU4 B;  1P3O C;  1JFI B;  3MGR B;  3MVD D;  2IO5 C;  5GXQ B;  3W99 B;  5DNN C;  3AFA A;  1P3K A;  3AYW B;  3W96 C;  4JJN D;  5CPI A;  4WU9 D;  3REK A;  4LD9 B;  3KWQ C;  5CP6 D;  5AV9 D;  2ARO C;  4YS3 D;  3B0D B;  3B0B A;  3AFA B;  4R8P D;  1P3K B;  4KUD A;  3NQJ A;  1A7W A;  3LZ1 C;  5CPI B;  3AZI D;  1F1E A;  3MNN C;  2HIO A;  4KUD B;  5JA4 A;  3NQJ B;  2HUE B;  2F8N K;  5E5A C;  2CV5 D;  5AVB A;  2HIO B;  5B31 G;  3AZL D;  3REJ A;  4CSR A;  5JA4 B;  4Z5T A;  3KSY A;  5AVB B;  1P34 A;  3WKJ D;  3REJ B;  4CSR B;  4Z5T B;  1ZLA A;  5DNM D;  4XUJ D;  5B1M A;  4XZQ D;  1P34 B;  2CWE A;  5AY8 D;  3C1C D;  4J8X D;  3X1V C;  1ZLA B;  2BYK A;  4JJN C;  5B1M B;  5CPK A;  3UTB C;  5BNV A;  3LZ0 A;  4YS3 C;  3AV1 B;  4R8P C;  4WZS B;  2BYK B;  5B1L D;  5CPK B;  2L5A A;  1U35 C;  4J8W A;  3AZI C;  5BNV B;  3LZ0 B;  5B32 D;  3V9R A;  3B0C W;  4KHA A;  3REI D;  4WU8 D;  1P3A D;  3W98 A;  2CV5 C;  3B6G D;  5CPJ D;  3AZL C;  3VH6 T;  3V9R B;  4KHA B;  3AZF C;  3W98 B;  1F66 D;  1P3L C;  5JRG D;  3WKJ C;  1HQ3 C;  3REH D;  5BNX A;  1P3P C;  4AWL C;  3A6N A;  5B0Y D;  5B0Z A;  5AVC C;  5B31 C;  5AY8 C;  4HGA C;  5BNX B;  1KX3 A;  3A6N B;  5B0Z B;  5GSU A;  2RVQ D;  3KXB D;  4KGC C;  4E45 A;  1KX3 B;  5GSU B;  4X23 A;  4J8V D;  4H9N A;  3AYW D;  2F8N D;  3AZH A;  5B40 D;  3MGS C;  4X23 B;  1P3A C;  4H9N B;  4UUZ A;  4QLC A;  3B6G C;  3AFA D;  5CPJ C;  1AOI C;  3AZH B;  3MGQ C;  3REK D;  1HTA A;  4UUZ B;  4QLC B;  1F66 C;  4KUD D;  3REH C;  1P3M A;  2HIO D;  3REL A;  3C1B A;  1EQZ B;  1KX5 A;  5AV6 C;  2NQB A;  4WV4 B;  5GT0 C;  3AZK C;  1P3M B;  3REJ D;  3REL B;  3C1B B;  1KX5 B;  2NQB B;  3TU4 C;  4NFT A;  3MGR C;  1P3B D;  5KDM A;  4J8V C;  3W99 C;  4E44 A;  3W97 B;  5DNN D;  3AYW C;  5AV8 A;  4G91 B;  3W96 D;  5B40 C;  5KDM B;  1P3I A;  3AFA C;  1P3K C;  5AV8 B;  3LZ1 D;  5CPI C;  4NE3 A;  4H9P A;  3REK C;  1N1J A;  2PYO A;  3AN2 A;  3MNN D;  1P3I B;  4KUD C;  2HUE C;  3WTP A;  3B6F A;  1P3G A;  2PYO B;  4H9P B;  1N1J B;  4CAY A;  4J8W D;  3AN2 B;  1S32 A;  2HIO C;  3WTP B;  3B6F B;  1P3G B;  1KX4 D;  4CAY B;  3W98 D;  1S32 B;  5B33 B;  3REJ C;  3X1U A;  4Z5T C;  3R45 A;  1M1A A;  2FJ7 A;  1P34 C;  3AZG A;  1P3B C;  4LD9 A;  3KUY A;  3X1U B;  5GT3 A;  1ZLA C;  3X1V D;  3R45 B;  1M1A B;  2FJ7 B;  3A6N D;  5B1M C;  3AZG B;  3UTB D;  3AV2 A;  1TAF B;  3KUY B;  5GT3 B;  1P3F B;  5CPK C;  1U35 D;  1TZY D;  3AV2 B;  3LZ0 C;  5BS7 A;  5FUG A;  5B24 B;  4ZUX A;  3AZM A;  4ZBJ B;  4J8W C;  4H9S A;  2BYM A;  5FUG B;  4YM6 B;  3AZH D;  4ZUX B;  3AZM B;  3AZF D;  3WA9 A;  1KX4 C;  4QLC D;  3W98 C;  1P3L D;  3AZN A;  2BYM B;  5C3I B;  1HQ3 D;  3WA9 B;  1P3P D;  5AVC D;  5B31 D;  3AZN B;  5F99 A;  3AV1 A;  3A6N C;  5B0Z C;  3REL D;  2NQB D;  5F99 B;  4KGC D;  1KX3 C;  1TZY C;  4H9Q B;  5BO0 A;  3MGS D;  4X23 C;  5AV8 D;  4J8U D;  3AZH C;  3AZE D;  3UTA A;  1AOI D;  5BO0 B;  3X1S D;  3MGQ D;  5AV5 A;  4QLC C;  3KWQ A;  2NZD A;  2ARO A;  5B32 G;  3O62 A;  3UT9 A;  3UTA B;  2PYO D;  5AV5 B;  3KWQ B;  2NZD B;  2ARO B;  3NQU A;  3LEL D;  3O62 B;  3UT9 B;  5AV6 D;  1P3G D;  5GT0 D;  3AZK D;  3X1T D;  1M19 A;  5E5A A;  1S32 D;  3NQU B;  3REL C;  3C1B C;  2JSS A;  1KX5 C;  2NQB C;  1ULY A;  3TU4 D;  1M19 B;  5E5A B;  3MGR D;  1Q9C A;  5GXQ D;  3X1U D;  3W99 D;  1M18 A;  1M1A D;  4G91 C;  4Z2M G;  4LD9 D;  3MVD A;  1M18 B;  5AV8 C;  1P3K D;  4J8U C;  3AZE C;  1BH9 A;  4JJN A;  5CPI D;  3X1S C;  3MVD B;  4WU9 A;  1P3I C;  5CP6 A;  5AV9 A;  4YS3 A;  1EQZ A;  1B6W A;  4R8P A;  1BH9 B;  4JJN B;  2PYO C;  4WU9 B;  5CP6 B;  5AV9 B;  4YS3 B;  3LEL C;  3WTP C;  4R8P B;  3B6F C;  1P3G C;  3X1T C;  1S32 C;  5AVB D;  5CHL B;  4M6B A;  3AZI B;  2CV5 A;  3W97 A;  4Z5T D;  1B67 A;  3WA9 D;  2YFW A;  1P34 D;  4DRB A;  3AZJ A;  2CV5 B;  3MGP A;  4G92 B;  1ID3 A;  5GXQ C;  3X1U C;  1ZLA D;  1M1A C;  2FJ7 C;  5DNM A;  2YFW B;  5B1M D;  4XUJ A;  3AZJ B;  4XZQ A;  3MGP B;  1ID3 B;  4LD9 C;  3KUY C;  2LY8 A;  5AY8 A;  5GT3 C;  3AV1 D;  3C1C A;  3B0D C;  4J8X A;  5DNM B;  4Z66 A;  4XUJ B;  5CPK D;  3AV2 C;  4XZQ B;  5AY8 B;  3LZ0 D;  3C1C B;  4J8X B; 
#chains in the Genus database with same CATH topology
 4Z66 B;  5B1L A;  5BS7 C;  4EO5 B;  5B32 A;  5B33 A;  4WU8 A;  3REI A;  5B1L B;  2ZY4 A;  4H9S C;  5AVB C;  3B6G A;  5C3I C;  5B32 B;  5G49 A;  3WA9 C;  4WU8 B;  3REI B;  2DF4 C;  2NZD D;  3B6G B;  2XD1 A;  3AZN C;  3O62 D;  4DRA A;  1TAF A;  5JRG A;  5G49 B;  4H9R A;  3REH A;  1P3F A;  5B0Z D;  3VH5 A;  5B0Y A;  4WNN A;  5JRG B;  5F99 C;  3WAA A;  3AV1 C;  4H9R B;  3REH B;  5B2J A;  5B24 A;  1KX3 D;  2Y2N A;  5GSU D;  2UWX A;  4WNN B;  5B0Y B;  3WAA B;  2RIQ A;  4YM6 A;  5B2J B;  3KXB A;  4X23 D;  1M18 D;  4NE6 A;  5B2I A;  2BG1 A;  3KXB B;  2F8N A;  5B40 A;  1T3U A;  5B2I B;  4J8V B;  1BFM A;  3UTA C;  2F8N B;  5B40 B;  5AV5 C;  2NZD C;  5BT1 C;  3O62 C;  3UT9 C;  1EQZ D;  3REK B;  1P3M D;  3C1B D;  2Y2Q A;  3LJA A;  1KX5 D;  1M19 C;  3P5J B;  4H9Q A;  5GSU C;  3W97 D;  3LJA B;  4NE5 A;  2Y2H A;  3AZJ D;  1P3O A;  3MGP D;  1ID3 D;  1P3B A;  3WTP E;  1M18 C;  5DNN A;  3W96 A;  1P3O B;  3H0L C;  3MVD C;  3F6T A;  1P3B B;  2IO5 B;  1P3I D;  5DNN B;  4Z66 D;  3W96 B;  3LZ1 A;  4WU9 C;  3AN2 D;  3H0R C;  1BH8 A;  3VH5 W;  5CP6 C;  5AV9 C;  3MNN A;  4Z2M H;  1EQZ C;  3WTP D;  3B6F D;  3LZ1 B;  1WWI A;  1P3M C;  1BH8 B;  5B33 D;  3MNN B;  1KX4 A;  4J8W B;  4G92 C;  2F8N H;  3W97 C;  2FJ7 D;  2ZY3 A;  1KX4 B;  3AZJ C;  3MGP C;  3AZG D;  1ID3 C;  3KUY D;  5GT3 D;  1WWS A;  3VH6 A;  3X1V A;  5DNM C;  1P3F D;  4XUJ C;  2ZY5 A;  4XZQ C;  3AV2 D;  3WAA D;  3UTB A;  3C1C C;  4J8X C;  5B2J D;  5B24 D;  3X1V B;  2F8N G;  4Z66 C;  1U35 A;  1TZY A;  3UTB B;  3AN2 C;  3AZI A;  4EO5 C;  4YM6 D;  4ZUX D;  3AZM D;  2YFV A;  1KU5 A;  5B1L C;  1H3O A;  1U35 B;  1TZY B;  5B2I D;  5B32 C;  5B33 C;  3AZL A;  2YFV B;  3REI C;  4WU8 C;  3AZF A;  1H3O B;  3AZN D;  1P3L A;  2VQR A;  3WKJ A;  3AZL B;  1HQ3 A;  3AZF B;  1P3P A;  3AZG C;  1P3L B;  5AVC A;  5B31 A;  5JRG C;  3WKJ B;  5F99 D;  2Y2P A;  3H0M C;  1HQ3 B;  1P3P B;  1P3F C;  4AWL B;  5B0Y C;  5AVC B;  5B31 B;  3WAA C;  3LJA D;  4HGA B;  5B2J C;  5B24 C;  4KGC A;  4ZBJ C;  2RVQ C;  4YM6 C;  3KXB C;  4ZUX C;  3AZM C;  1P3O D;  4KGC B;  3MGS A;  1P3A A;  5B2I C;  5CPJ A;  3UTA D;  4J8U A;  3AZE A;  1AOI A;  5AV5 D;  3X1S A;  3MGQ A;  3MGS B;  3VH5 T;  3KWQ D;  1P3A B;  2ARO D;  1F66 A;  5BT1 D;  3UT9 D;  5CPJ B;  4J8U B;  3AZE B;  2Y2K A;  3VH6 W;  1AOI B;  3X1S B;  3MGQ B;  2Y2J A;  1F66 B;  3B0C T;  3LEL A;  5AV6 A;  1M19 D;  5E5A D;  5GT0 A;  3AZK A;  3X1T A;  4H9O A;  1R4V A;  3LJA C;  3LEL B;  5AV6 B;  5GT0 B;  3TU4 A;  3AZK B;  3X1T B;  1JFI A;  3MGR A;  4H9O B;  5GXQ A;  4J8V A;  3W99 A;  3EPL A;  3AYW A;  3TU4 B;  1P3O C;  1JFI B;  3MGR B;  3MVD D;  2IO5 C;  5GXQ B;  3W99 B;  5DNN C;  3AFA A;  1P3K A;  3AYW B;  3W96 C;  4JJN D;  5CPI A;  4WU9 D;  3REK A;  4LD9 B;  3KWQ C;  5CP6 D;  5AV9 D;  2ARO C;  4YS3 D;  3B0D B;  3B0B A;  3AFA B;  4R8P D;  1P3K B;  4KUD A;  3NQJ A;  1A7W A;  3LZ1 C;  5CPI B;  3AZI D;  1F1E A;  3MNN C;  2HIO A;  4KUD B;  5JA4 A;  3NQJ B;  2HUE B;  2F8N K;  5E5A C;  2CV5 D;  5AVB A;  2HIO B;  5B31 G;  3AZL D;  3REJ A;  2DQN C;  4CSR A;  5JA4 B;  4Z5T A;  2Y2L A;  3KSY A;  5AVB B;  1P34 A;  3WKJ D;  3REJ B;  4CSR B;  3IP4 C;  4Z5T B;  1ZLA A;  5DNM D;  4XUJ D;  5B1M A;  2J8P A;  4XZQ D;  1P34 B;  2CWE A;  5AY8 D;  3C1C D;  4J8X D;  3X1V C;  1ZLA B;  2BYK A;  4JJN C;  5B1M B;  5CPK A;  3FDD A;  3UTB C;  3AL0 C;  5BNV A;  3LZ0 A;  4YS3 C;  3AV1 B;  4R8P C;  4WZS B;  2BYK B;  5B1L D;  5CPK B;  2L5A A;  1U35 C;  4J8W A;  3AZI C;  3A1I A;  5BNV B;  5B32 D;  3LZ0 B;  3V9R A;  3B0C W;  4KHA A;  3REI D;  4WU8 D;  1P3A D;  3W98 A;  2CV5 C;  3B6G D;  5CPJ D;  3AZL C;  3VH6 T;  3V9R B;  4KHA B;  3AZF C;  2W8S A;  3W98 B;  1F66 D;  1P3L C;  2Y2I A;  5JRG D;  3WKJ C;  1HQ3 C;  3REH D;  5BNX A;  1P3P C;  4AWL C;  3A6N A;  5B0Y D;  5B0Z A;  5AVC C;  5B31 C;  5AY8 C;  4HGA C;  5BNX B;  1KX3 A;  3A6N B;  2FFF B;  5B0Z B;  5GSU A;  2RVQ D;  3KXB D;  4KGC C;  4E45 A;  1KX3 B;  5GSU B;  4X23 A;  4J8V D;  4H9N A;  2Y2M A;  3AYW D;  2F8N D;  3AZH A;  5B40 D;  3MGS C;  4X23 B;  1P3A C;  4H9N B;  4UUZ A;  4QLC A;  3B6G C;  3AFA D;  5CPJ C;  3EPK A;  3AZH B;  1AOI C;  3MGQ C;  3REK D;  1HTA A;  4UUZ B;  4QLC B;  1F66 C;  4KUD D;  3REH C;  1P3M A;  2HIO D;  3REL A;  3C1B A;  1Z2C B;  2ZM5 A;  1EQZ B;  1KX5 A;  5AV6 C;  2NQB A;  4WV4 B;  5GT0 C;  3AZK C;  4DQY B;  1P3M B;  3REJ D;  3REL B;  3C1B B;  1KX5 B;  2NQB B;  3TU4 C;  4WJ3 C;  4NFT A;  3MGR C;  1P3B D;  5KDM A;  4J8V C;  3W99 C;  4E44 A;  3W97 B;  5DNN D;  3AYW C;  5AV8 A;  4G91 B;  3W96 D;  5B40 C;  5KDM B;  1P3I A;  3AFA C;  1P3K C;  5AV8 B;  3LZ1 D;  5CPI C;  4NE3 A;  4H9P A;  3REK C;  1N1J A;  2PYO A;  3AN2 A;  3MNN D;  1P3I B;  1PZR A;  4KUD C;  2HUE C;  3WTP A;  3B6F A;  1P3G A;  2PYO B;  4H9P B;  1N1J B;  4CAY A;  4J8W D;  3AN2 B;  1S32 A;  2HIO C;  2JE5 A;  3WTP B;  3B6F B;  1P3G B;  1KX4 D;  4CAY B;  3W98 D;  1S32 B;  5B33 B;  3REJ C;  3X1U A;  4Z5T C;  3R45 A;  1M1A A;  2FJ7 A;  2F2A C;  1P34 C;  3AZG A;  1P3B C;  4LD9 A;  3KUY A;  5GT3 A;  3X1U B;  1ZLA C;  3X1V D;  3R45 B;  1M1A B;  2FJ7 B;  3A6N D;  5B1M C;  3AZG B;  3UTB D;  3AV2 A;  1TAF B;  3KUY B;  2XD5 A;  5GT3 B;  1P3F B;  5CPK C;  1U35 D;  1TZY D;  3AV2 B;  3LZ0 C;  5BS7 A;  5FUG A;  5B24 B;  4ZUX A;  3AZM A;  1W2E A;  4ZBJ B;  4J8W C;  4H9S A;  2BYM A;  5FUG B;  4YM6 B;  3AZH D;  4ZUX B;  3AZM B;  3AZF D;  3WA9 A;  1KX4 C;  4QLC D;  3W98 C;  1P3L D;  3AZN A;  2BYM B;  2Y2O A;  5C3I B;  3EPJ A;  1HQ3 D;  3WA9 B;  1P3P D;  2JCH A;  5AVC D;  5B31 D;  3AZN B;  5F99 A;  3AV1 A;  3A6N C;  5B0Z C;  3REL D;  2NQB D;  5F99 B;  3EPH A;  4KGC D;  1KX3 C;  1TZY C;  4H9Q B;  5BO0 A;  3MGS D;  4X23 C;  5AV8 D;  4J8U D;  3AZH C;  2ZY2 A;  3UTA A;  3AZE D;  1AOI D;  5BO0 B;  3X1S D;  3MGQ D;  4UPK A;  5AV5 A;  4QLC C;  3KWQ A;  2NZD A;  2ARO A;  5B32 G;  3O62 A;  3UT9 A;  3UTA B;  2PYO D;  5AV5 B;  3KWQ B;  2NZD B;  2ARO B;  3NQU A;  3LEL D;  3O62 B;  3UT9 B;  5AV6 D;  1P3G D;  5GT0 D;  3AZK D;  3X1T D;  1M19 A;  5E5A A;  1S32 D;  3NQU B;  2G5I C;  3REL C;  3C1B C;  2JSS A;  1KX5 C;  2NQB C;  1ULY A;  3TU4 D;  1M19 B;  5E5A B;  3MGR D;  1Q9C A;  5GXQ D;  3X1U D;  3W99 D;  1M18 A;  1M1A D;  4G91 C;  4Z2M G;  4LD9 D;  3MVD A;  1M18 B;  5AV8 C;  1P3K D;  4J8U C;  3AZE C;  1BH9 A;  3EG5 B;  4JJN A;  3X1S C;  5CPI D;  3MVD B;  4WU9 A;  1P3I C;  5CP6 A;  5AV9 A;  4YS3 A;  1EQZ A;  1B6W A;  4R8P A;  1BH9 B;  4JJN B;  2PYO C;  4WU9 B;  2Y2G A;  5CP6 B;  5AV9 B;  4YS3 B;  3LEL C;  2G5H C;  3WTP C;  3A1K A;  4R8P B;  3B6F C;  1P3G C;  3X1T C;  1S32 C;  5AVB D;  5CHL B;  4M6B A;  3AZI B;  2CV5 A;  3W97 A;  4Z5T D;  1B67 A;  3WA9 D;  2YFW A;  1P34 D;  4DRB A;  3AZJ A;  2CV5 B;  3MGP A;  4G92 B;  1ID3 A;  5GXQ C;  3X1U C;  1ZLA D;  1M1A C;  2FJ7 C;  5DNM A;  2YFW B;  5B1M D;  4XUJ A;  3AZJ B;  4XZQ A;  3MGP B;  1ID3 B;  4LD9 C;  3KFU G;  3KUY C;  2LY8 A;  5AY8 A;  5GT3 C;  3AV1 D;  3C1C A;  3B0D C;  4J8X A;  5DNM B;  4Z66 A;  4XUJ B;  5CPK D;  3AV2 C;  4XZQ B;  5AY8 B;  3LZ0 D;  3C1C B;  4J8X B; 
#chains in the Genus database with same CATH homology
 4Z66 B;  5B1L A;  5BS7 C;  4EO5 B;  5B32 A;  5B33 A;  4WU8 A;  3REI A;  5B1L B;  2ZY4 A;  4H9S C;  5AVB C;  3B6G A;  5C3I C;  5B32 B;  5G49 A;  3WA9 C;  4WU8 B;  3REI B;  2DF4 C;  2NZD D;  3B6G B;  2XD1 A;  3AZN C;  3O62 D;  4DRA A;  1TAF A;  5JRG A;  5G49 B;  4H9R A;  3REH A;  1P3F A;  5B0Z D;  3VH5 A;  5B0Y A;  4WNN A;  5JRG B;  5F99 C;  3WAA A;  3AV1 C;  4H9R B;  3REH B;  5B2J A;  5B24 A;  1KX3 D;  2Y2N A;  5GSU D;  2UWX A;  4WNN B;  5B0Y B;  3WAA B;  2RIQ A;  4YM6 A;  5B2J B;  3KXB A;  4X23 D;  1M18 D;  4NE6 A;  5B2I A;  2BG1 A;  3KXB B;  2F8N A;  5B40 A;  1T3U A;  5B2I B;  4J8V B;  1BFM A;  3UTA C;  2F8N B;  5B40 B;  5AV5 C;  2NZD C;  5BT1 C;  3O62 C;  3UT9 C;  1EQZ D;  3REK B;  1P3M D;  3C1B D;  2Y2Q A;  3LJA A;  1KX5 D;  1M19 C;  3P5J B;  4H9Q A;  5GSU C;  3W97 D;  3LJA B;  4NE5 A;  2Y2H A;  3AZJ D;  1P3O A;  3MGP D;  1ID3 D;  1P3B A;  3WTP E;  1M18 C;  5DNN A;  3W96 A;  1P3O B;  3H0L C;  3MVD C;  3F6T A;  1P3B B;  2IO5 B;  1P3I D;  5DNN B;  4Z66 D;  3W96 B;  3LZ1 A;  4WU9 C;  3AN2 D;  3H0R C;  1BH8 A;  3VH5 W;  5CP6 C;  5AV9 C;  3MNN A;  4Z2M H;  1EQZ C;  3WTP D;  3B6F D;  3LZ1 B;  1WWI A;  1P3M C;  1BH8 B;  5B33 D;  3MNN B;  1KX4 A;  4J8W B;  4G92 C;  2F8N H;  3W97 C;  2FJ7 D;  2ZY3 A;  1KX4 B;  3AZJ C;  3MGP C;  3AZG D;  1ID3 C;  3KUY D;  5GT3 D;  1WWS A;  3VH6 A;  3X1V A;  5DNM C;  1P3F D;  4XUJ C;  2ZY5 A;  4XZQ C;  3AV2 D;  3WAA D;  3UTB A;  3C1C C;  4J8X C;  5B2J D;  5B24 D;  3X1V B;  2F8N G;  4Z66 C;  1U35 A;  1TZY A;  3UTB B;  3AN2 C;  3AZI A;  4EO5 C;  4YM6 D;  4ZUX D;  3AZM D;  2YFV A;  1KU5 A;  5B1L C;  1H3O A;  1U35 B;  1TZY B;  5B2I D;  5B32 C;  5B33 C;  3AZL A;  2YFV B;  3REI C;  4WU8 C;  3AZF A;  1H3O B;  3AZN D;  1P3L A;  2VQR A;  3WKJ A;  3AZL B;  1HQ3 A;  3AZF B;  1P3P A;  3AZG C;  1P3L B;  5AVC A;  5B31 A;  5JRG C;  3WKJ B;  5F99 D;  2Y2P A;  3H0M C;  1HQ3 B;  1P3P B;  1P3F C;  4AWL B;  5B0Y C;  5AVC B;  5B31 B;  3WAA C;  3LJA D;  4HGA B;  5B2J C;  5B24 C;  4KGC A;  4ZBJ C;  2RVQ C;  4YM6 C;  3KXB C;  4ZUX C;  3AZM C;  1P3O D;  4KGC B;  3MGS A;  1P3A A;  5B2I C;  5CPJ A;  3UTA D;  4J8U A;  3AZE A;  1AOI A;  5AV5 D;  3X1S A;  3MGQ A;  3MGS B;  3VH5 T;  3KWQ D;  1P3A B;  2ARO D;  1F66 A;  5BT1 D;  3UT9 D;  5CPJ B;  4J8U B;  3AZE B;  2Y2K A;  3VH6 W;  1AOI B;  3X1S B;  3MGQ B;  2Y2J A;  1F66 B;  3B0C T;  3LEL A;  5AV6 A;  1M19 D;  5E5A D;  5GT0 A;  3AZK A;  3X1T A;  4H9O A;  1R4V A;  3LJA C;  3LEL B;  5AV6 B;  5GT0 B;  3TU4 A;  3AZK B;  3X1T B;  1JFI A;  3MGR A;  4H9O B;  5GXQ A;  4J8V A;  3W99 A;  3EPL A;  3AYW A;  3TU4 B;  1P3O C;  1JFI B;  3MGR B;  3MVD D;  2IO5 C;  5GXQ B;  3W99 B;  5DNN C;  3AFA A;  1P3K A;  3AYW B;  3W96 C;  4JJN D;  5CPI A;  4WU9 D;  3REK A;  4LD9 B;  3KWQ C;  5CP6 D;  5AV9 D;  2ARO C;  4YS3 D;  3B0D B;  3B0B A;  3AFA B;  4R8P D;  1P3K B;  4KUD A;  3NQJ A;  1A7W A;  3LZ1 C;  5CPI B;  3AZI D;  1F1E A;  3MNN C;  2HIO A;  4KUD B;  5JA4 A;  3NQJ B;  2HUE B;  2F8N K;  5E5A C;  2CV5 D;  5AVB A;  2HIO B;  5B31 G;  3AZL D;  3REJ A;  2DQN C;  4CSR A;  5JA4 B;  4Z5T A;  2Y2L A;  3KSY A;  5AVB B;  1P34 A;  3WKJ D;  3REJ B;  4CSR B;  3IP4 C;  4Z5T B;  1ZLA A;  5DNM D;  4XUJ D;  5B1M A;  2J8P A;  4XZQ D;  1P34 B;  2CWE A;  5AY8 D;  3C1C D;  4J8X D;  3X1V C;  1ZLA B;  2BYK A;  4JJN C;  5B1M B;  5CPK A;  3FDD A;  3UTB C;  3AL0 C;  5BNV A;  3LZ0 A;  4YS3 C;  3AV1 B;  4R8P C;  4WZS B;  2BYK B;  5B1L D;  5CPK B;  2L5A A;  1U35 C;  4J8W A;  3AZI C;  3A1I A;  5BNV B;  5B32 D;  3LZ0 B;  3V9R A;  3B0C W;  4KHA A;  3REI D;  4WU8 D;  1P3A D;  3W98 A;  2CV5 C;  3B6G D;  5CPJ D;  3AZL C;  3VH6 T;  3V9R B;  4KHA B;  3AZF C;  2W8S A;  3W98 B;  1F66 D;  1P3L C;  2Y2I A;  5JRG D;  3WKJ C;  1HQ3 C;  3REH D;  5BNX A;  1P3P C;  4AWL C;  3A6N A;  5B0Y D;  5B0Z A;  5AVC C;  5B31 C;  5AY8 C;  4HGA C;  5BNX B;  1KX3 A;  3A6N B;  2FFF B;  5B0Z B;  5GSU A;  2RVQ D;  3KXB D;  4KGC C;  4E45 A;  1KX3 B;  5GSU B;  4X23 A;  4J8V D;  4H9N A;  2Y2M A;  3AYW D;  2F8N D;  3AZH A;  5B40 D;  3MGS C;  4X23 B;  1P3A C;  4H9N B;  4UUZ A;  4QLC A;  3B6G C;  3AFA D;  5CPJ C;  3EPK A;  3AZH B;  1AOI C;  3MGQ C;  3REK D;  1HTA A;  4UUZ B;  4QLC B;  1F66 C;  4KUD D;  3REH C;  1P3M A;  2HIO D;  3REL A;  3C1B A;  1Z2C B;  2ZM5 A;  1EQZ B;  1KX5 A;  5AV6 C;  2NQB A;  4WV4 B;  5GT0 C;  3AZK C;  4DQY B;  1P3M B;  3REJ D;  3REL B;  3C1B B;  1KX5 B;  2NQB B;  3TU4 C;  4WJ3 C;  4NFT A;  3MGR C;  1P3B D;  5KDM A;  4J8V C;  3W99 C;  4E44 A;  3W97 B;  5DNN D;  3AYW C;  5AV8 A;  4G91 B;  3W96 D;  5B40 C;  5KDM B;  1P3I A;  3AFA C;  1P3K C;  5AV8 B;  3LZ1 D;  5CPI C;  4NE3 A;  4H9P A;  3REK C;  1N1J A;  2PYO A;  3AN2 A;  3MNN D;  1P3I B;  1PZR A;  4KUD C;  2HUE C;  3WTP A;  3B6F A;  1P3G A;  2PYO B;  4H9P B;  1N1J B;  4CAY A;  4J8W D;  3AN2 B;  1S32 A;  2HIO C;  2JE5 A;  3WTP B;  3B6F B;  1P3G B;  1KX4 D;  4CAY B;  3W98 D;  1S32 B;  5B33 B;  3REJ C;  3X1U A;  4Z5T C;  3R45 A;  1M1A A;  2FJ7 A;  2F2A C;  1P34 C;  3AZG A;  1P3B C;  4LD9 A;  3KUY A;  5GT3 A;  3X1U B;  1ZLA C;  3X1V D;  3R45 B;  1M1A B;  2FJ7 B;  3A6N D;  5B1M C;  3AZG B;  3UTB D;  3AV2 A;  1TAF B;  3KUY B;  2XD5 A;  5GT3 B;  1P3F B;  5CPK C;  1U35 D;  1TZY D;  3AV2 B;  3LZ0 C;  5BS7 A;  5FUG A;  5B24 B;  4ZUX A;  3AZM A;  1W2E A;  4ZBJ B;  4J8W C;  4H9S A;  2BYM A;  5FUG B;  4YM6 B;  3AZH D;  4ZUX B;  3AZM B;  3AZF D;  3WA9 A;  1KX4 C;  4QLC D;  3W98 C;  1P3L D;  3AZN A;  2BYM B;  2Y2O A;  5C3I B;  3EPJ A;  1HQ3 D;  3WA9 B;  1P3P D;  2JCH A;  5AVC D;  5B31 D;  3AZN B;  5F99 A;  3AV1 A;  3A6N C;  5B0Z C;  3REL D;  2NQB D;  5F99 B;  3EPH A;  4KGC D;  1KX3 C;  1TZY C;  4H9Q B;  5BO0 A;  3MGS D;  4X23 C;  5AV8 D;  4J8U D;  3AZH C;  2ZY2 A;  3UTA A;  3AZE D;  1AOI D;  5BO0 B;  3X1S D;  3MGQ D;  4UPK A;  5AV5 A;  4QLC C;  3KWQ A;  2NZD A;  2ARO A;  5B32 G;  3O62 A;  3UT9 A;  3UTA B;  2PYO D;  5AV5 B;  3KWQ B;  2NZD B;  2ARO B;  3NQU A;  3LEL D;  3O62 B;  3UT9 B;  5AV6 D;  1P3G D;  5GT0 D;  3AZK D;  3X1T D;  1M19 A;  5E5A A;  1S32 D;  3NQU B;  2G5I C;  3REL C;  3C1B C;  2JSS A;  1KX5 C;  2NQB C;  1ULY A;  3TU4 D;  1M19 B;  5E5A B;  3MGR D;  1Q9C A;  5GXQ D;  3X1U D;  3W99 D;  1M18 A;  1M1A D;  4G91 C;  4Z2M G;  4LD9 D;  3MVD A;  1M18 B;  5AV8 C;  1P3K D;  4J8U C;  3AZE C;  1BH9 A;  3EG5 B;  4JJN A;  3X1S C;  5CPI D;  3MVD B;  4WU9 A;  1P3I C;  5CP6 A;  5AV9 A;  4YS3 A;  1EQZ A;  1B6W A;  4R8P A;  1BH9 B;  4JJN B;  2PYO C;  4WU9 B;  2Y2G A;  5CP6 B;  5AV9 B;  4YS3 B;  3LEL C;  2G5H C;  3WTP C;  3A1K A;  4R8P B;  3B6F C;  1P3G C;  3X1T C;  1S32 C;  5AVB D;  5CHL B;  4M6B A;  3AZI B;  2CV5 A;  3W97 A;  4Z5T D;  1B67 A;  3WA9 D;  2YFW A;  1P34 D;  4DRB A;  3AZJ A;  2CV5 B;  3MGP A;  4G92 B;  1ID3 A;  5GXQ C;  3X1U C;  1ZLA D;  1M1A C;  2FJ7 C;  5DNM A;  2YFW B;  5B1M D;  4XUJ A;  3AZJ B;  4XZQ A;  3MGP B;  1ID3 B;  4LD9 C;  3KFU G;  3KUY C;  2LY8 A;  5AY8 A;  5GT3 C;  3AV1 D;  3C1C A;  3B0D C;  4J8X A;  5DNM B;  4Z66 A;  4XUJ B;  5CPK D;  3AV2 C;  4XZQ B;  5AY8 B;  3LZ0 D;  3C1C B;  4J8X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...