3WAAA

The nucleosome containing human h2a.z.2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaA00
2HUEC 1U35C 2CV5A 5DNNB 4WZSB 2AROA 4KUDA 5C3IB 4J8WB 5C3IC 2AROD 3AZHA 1M18B 3O62C 2LY8A 1P3AA 3AZHD 4E45A 2FJ7A 3AZJC 1P3AD 4DRBA 2YFVB 5CPJA 2FJ7D 4Z2MH 5CPJD 3AZFA 4LD9C 5GT0C 2F8NA 3AZFD 3MGPB 4WV4B 4X23A 1P3LC 2F8ND 4CSRB 4X23D 2IO5C 4H9QB 4H9RB 5B31G 5BS7C 3V9RA 5CPKD 4Z5TA 4XZQC 5BNVA 4Z5TD 4EO5C 4WU9B 1S32D 4WU9C 3KWQA 3LELA 3MGQC 3W96A 3AYWC 3KWQD 3LELD 3A6NC 3AZIA 5CPIB 3W96D 4J8XC 2BYMB 3AZID 4JJNA 4H9PB 3LZ0B 3AZGC 4G91C 4ZBJB 3X1VC 1WWSA 3B0DB 3LZ1A 3NQUB 3B0DC 1P3PA 3W98B 3LZ1D 4YS3B 5GXQA 3C1BB 1P3PD 5KDMA 1TAFA 5B31B 5B0YD 5B31C 5GXQD 5B1LB 2CV5C 5B1LC 5JRGB 5AV6B 4KUDC 3UT9A 3REJC 5CP6B 1KX4A 3UTBC 3UT9D 3AZMC 1ZLAB 3UTAB 1KX4D 3NQJB 4G92C 1P3MA 3AFAC 2HIOB 5AVBB 1F66B 2PYOA 2NQBA 3W99B 3WKJB 3REID 2PYOD 3KXBB 3MGSD 2NQBD 1BH9B 5GT3A 3R45B 4R8PB 1AOIB 5GT3D 3WTPE 3TU4B 5FUGA 3TU4C 3W97C 1ID3C 1EQZA 4WU8A 4WNNB 1EQZD 3AN2B 4WU8D 1U35A 5AY8B 1F1EA 5AY8C 5DNNA 3X1UB 2JSSA 1U35D 3X1UC 4J8UB 4HGAC 1M18A 3VH6W 5AV9C 3B6GB 4JJNC 3O62D 3LJAD 3AZJA 3B6GC 3B0CT 3REKB 2YFVA 3AZJD 4ZUXC 4J8VB 3REKC 4J8VC 3WA9B 4LD9A 4E44A 5GT0A 3REHC 3WA9C 5B24C 4LD9D 5GT0D 5AV5C 3MNNB 1TZYB 1P3GB 1P3KB 1P3LD 5F99C 3X1TB 3MVDB 5BS7A 4XZQA 4XZQD 1P3MC 4QLCB 5E5AB 4XUJB 4WU9A 1M1AC 3MGQA 3AYWA 3A6NA 5BO0B 3MGQD 1HQ3B 4J8XA 3AYWD 1P3FB 1HQ3C 1P3BC 3A6ND 3AZGA 4J8XD 5G49B 5B2JB 3X1VA 5B2IB 3KUYB 4H9NA 3AZGD 3NQUA 3X1VD 5B40B 3AZNB 4KGCB 5B40C 5AV8B 4YS3A 3C1BA 5B31A 1BH8B 3X1SB 4UUZA 5B1LA 5B31D 1KX3B 5BNXA 5DNNC 4AWLB 5JRGA 2CV5D 4AWLC 5B1LD 5B32B 3REJA 4J8WC 3UTBA 4KUDD 3AZMA 3REJD 1KX5B 3UTBD 1M18C 2BYKA 3AZMD 1KX5C 3AFAA 4NE5A 3AFAD 1B67A 3AV2B 5AVCB 3MGRB 3MGPC 3B0CW 3TU4A 5B0ZB 3W97A 1ID3A 3AV1B 1HTAA 3TU4D 3W97D 3C1CB 1ID3D 2NZDB 4NE3A 1H3OB 4WNNA 3AZKB 3AZKC 3VH6T 5AY8A 3X1UA 1P3OB 5AY8D 4J8UA 3X1UD 3RELB 5CPIC 3RELC 5AV9A 1M19B 4Z66B 3B0BA 3B6GA 4Z66C 5AV9D 3LZ0C 4ZBJC 4JJND 3B6GD 4ZUXA 3REKA 1JFIB 3W98C 4J8VA 5GSUB 4ZUXD 3REKD 3REHA 4YS3C 3WA9A 3C1BC 5B24A 4KHAA 4J8VD 5AV5A 3REHD 5B24D 1TZYA 5AV5D 5JRGC 5F99A 5AV6C 1N1JA 3AZLB 1P3KA 3AZLC 5F99D 5CP6C 5B1MB 5B1MC 1ZLAC 3UTAC 4NFTA 5DNMB 2RVQC 5DNMC 1P3MD 3VH5T 2HIOC 3WTPB 5AVBC 1F66C 1M1AA 2F8NG 3W99C 3WKJC 1M1AD 4H9SC 3KXBC 5BO0A 1HQ3A 1P3BA 2L5AA 4R8PC 1AOIC 1HQ3D 1P3BD 5G49A 5B2IA 2AROB 5B40A 3AZHB 3AZNA 5CHLB 1P3AB 5B40D 3AN2C 2FJ7B 5CPJB 5DNND 4J8WA 4J8UC 3AZFB 2F8NB 4J8WD 1KX5A 1M18D 1KX5D 5CPKB 1R4VA 3V9RB 4Z5TB 5JA4B 4H9OB 3MGPA 1S32B 3MNNC 2F8NK 1TZYC 4CSRA 3MGPD 1P3GC 1P3KC 5B0ZA 4H9QA 4H9RA 3X1TC 3MVDC 3KWQB 3LELB 2NZDA 3AZIB 4QLCC 5B32G 3AZKA 5E5AC 4XUJC 3AZKD 1P3PB 5B0YB 4WU9D 5GXQB 1B6WA 5CPIA 3RELA 3VH5W 1P3FC 2BYMA 5CPID 4Z66A 3RELD 4H9PA 3LZ0A 5B2JC 5B2IC 4Z66D 3KUYC 3LZ0D 3UT9B 2F8NH 3W98A 1JFIA 1KX4B 3AZNC 4KGCC 3W98D 5AV8C 4YS3D 3C1BD 3X1SC 1P3IB 1P3IC 1KX3C 5AV6A 3REIB 3MGSB 3AZEB 2NQBB 3AZLA 5JRGD 5B32C 3AZEC 5AV6D 5CP6A 3B6FB 3AZLD 3B6FC 5B1MA 1ZLAA 5CP6D 3UTAA 3NQJA 5GT3B 5B1MD 1ZLAD 3UTAD 5DNMA 2HIOA 5FUGB 5AVBA 1F66A 2RVQD 5DNMD 3AV2C 2HIOD 3W99A 5AVBD 3WKJA 1F66D 1EQZB 4H9SA 5AVCC 3KXBA 4WU8B 3W99D 3MGRC 3WAAB 3WAAC 3WKJD 1BH9A 3KXBD 2HUEB 1U35B 3R45A 4R8PA 1AOIA 5B0ZC 4R8PD 1AOID 3KSYA 3AV1C 3C1CC 2NZDC 3O62B 3LJAB 5B33B 3LJAC 5B33C 3AN2A 3AZJB 3AN2D 4CAYB 1P3OC 4LD9B 5GT0B 4J8UD 1P3LB 1M19C 2IO5B 5CPKA 5GSUC 4XZQB 4YM6B 4YM6C 5JA4A 4H9OA 3VH6A 4EO5B 3WA9D 3MNNA 1S32A 5BT1C 1P3GA 3MNND 1TZYD 2YFWB 1P34B 3X1TA 3MVDA 1P34C 1P3GD 3MGQB 1P3KD 3AYWB 3X1TD 3MVDD 3A6NB 4J8XB 4QLCA 5E5AA 3AZGB 4G91B 4XUJA 3X1VB 4QLCD 4H9NB 4M6BA 5E5AD 4XUJD 3WTPC 5B0YA 1P3FA 4UUZB 2CV5B 1Q9CA 5BNXB 5B2JA 1P3FD 4KUDB 3KUYA 2AROC 3REJB 5B2JD 5B2ID 3UTBB 3KUYD 4KGCA 3AZMB 3AZHC 5AV8A 4G92B 3AZND 2BYKB 1BH8A 1P3AC 3AFAB 3X1SA 3VH5A 5AV8D 4KGCD 1P3IA 2FJ7C 1KX3A 3X1SD 1P3ID 5CPJC 3REIA 1KX3D 3MGSA 5B32A 3AZEA 3AZFC 3B6FA 1ULYA 5B32D 3AZED 3B6FD 4X23B 4X23C 3W97B 1ID3B 5CPKC 3AV2A 5BNVB 5AVCA 3MGRA 3AV2D 4Z5TC 3WAAA 5AVCD 3MGRD 3WAAD 1S32C 4Z2MG 3AV1A 3W96B 3KWQC 5B0ZD 4HGAB 3LELC 3W96C 1A7WA 3C1CA 1H3OA 3AV1D 3AZIC 5AV9B 3O62A 3LJAA 3C1CD 5B33A 2NZDD 4JJNB 5B33D 3LZ1B 1KU5A 2CWEA 4CAYA 4ZUXB 3LZ1C 1P3OA 1P3PC 4NE6A 5B0YC 1P3OD 3REHB 5KDMB 1TAFB 4KHAB 5GXQC 5B24B 5AV5B 1M19A 1P3LA 5F99B 1M19D 1N1JB 3UT9C 5GSUA 1KX4C 4YM6A 5GSUD 1P3MB 4DRAA 4YM6D 2PYOB 3REIC 5BT1D 2PYOC 1M1AB 3MGSC 2YFWA 1P34A 2NQBC 1P34D 5GT3C 1P3BB 1BFMA 3WTPA 3WTPD 1WWIA 1EQZC 4WU8C
chains in the Genus database with same CATH superfamily
2HUEC 1U35C 2CV5A 5DNNB 4WZSB 3P5JB 2AROA 4KUDA 5C3IB 4J8WB 5C3IC 2AROD 3AZHA 1M18B 3O62C 2LY8A 1P3AA 3AZHD 4E45A 2ZM5A 2FJ7A 3AZJC 1P3AD 4DRBA 2YFVB 5CPJA 2FJ7D 4Z2MH 5CPJD 3AZFA 4LD9C 5GT0C 2F8NA 3FDDA 3AZFD 3MGPB 4WV4B 4X23A 1P3LC 2F8ND 4CSRB 4X23D 2IO5C 4H9QB 4H9RB 5B31G 5BS7C 3V9RA 5CPKD 4Z5TA 4XZQC 5BNVA 4Z5TD 4EO5C 2FFFB 4WU9B 1S32D 4WU9C 3KWQA 3LELA 3MGQC 3W96A 3AYWC 3IP4C 3KWQD 3LELD 3A6NC 3AZIA 5CPIB 3W96D 4J8XC 2BYMB 3AZID 4JJNA 4H9PB 3LZ0B 3AZGC 4G91C 4ZBJB 3X1VC 1WWSA 3B0DB 3LZ1A 3NQUB 2XD1A 3B0DC 1P3PA 3W98B 3LZ1D 4YS3B 5GXQA 3C1BB 1P3PD 5KDMA 1TAFA 5B31B 5B0YD 4DQYB 5B31C 5GXQD 5B1LB 2CV5C 5B1LC 5JRGB 5AV6B 4KUDC 3UT9A 3REJC 5CP6B 1KX4A 3UTBC 3UT9D 3AZMC 1ZLAB 3UTAB 1KX4D 3NQJB 4G92C 1P3MA 3AFAC 2HIOB 5AVBB 1F66B 2PYOA 2NQBA 3W99B 2DF4C 3WKJB 3REID 2PYOD 3KXBB 3MGSD 2NQBD 1BH9B 5GT3A 3R45B 4R8PB 1AOIB 3H0LC 5GT3D 3WTPE 2Y2KA 3TU4B 5FUGA 3TU4C 3W97C 1ID3C 2Y2JA 1EQZA 4WU8A 4WNNB 1EQZD 3AN2B 4WU8D 1U35A 5AY8B 1F1EA 5AY8C 5DNNA 3X1UB 2JSSA 1U35D 3X1UC 2Y2OA 4J8UB 3EPHA 4HGAC 1M18A 3VH6W 5AV9C 3B6GB 4JJNC 3O62D 3LJAD 3AZJA 3B6GC 3B0CT 3REKB 2YFVA 3AZJD 4ZUXC 4J8VB 3REKC 4J8VC 3WA9B 4LD9A 4E44A 1W2EA 5GT0A 3REHC 3WA9C 2F2AC 2RIQA 5B24C 4LD9D 5GT0D 5AV5C 3MNNB 1TZYB 1P3GB 1P3KB 1P3LD 5F99C 3X1TB 3MVDB 5BS7A 2VQRA 4XZQA 2W8SA 4XZQD 1P3MC 4QLCB 5E5AB 4XUJB 4WU9A 1M1AC 2DQNC 3MGQA 3AYWA 3A6NA 5BO0B 3MGQD 1HQ3B 4J8XA 3AYWD 1P3FB 1HQ3C 1P3BC 3A6ND 3AZGA 4J8XD 5G49B 5B2JB 3X1VA 5B2IB 3KUYB 4H9NA 3AZGD 3NQUA 3X1VD 5B40B 3AZNB 4KGCB 5B40C 5AV8B 4YS3A 3C1BA 5B31A 1BH8B 3X1SB 4UUZA 5B1LA 5B31D 1KX3B 5BNXA 5DNNC 4AWLB 5JRGA 2CV5D 4AWLC 5B1LD 2J8PA 5B32B 3REJA 4J8WC 3UTBA 4KUDD 3AZMA 3REJD 1KX5B 3UTBD 1M18C 2BYKA 3AZMD 1KX5C 3AFAA 4NE5A 3AFAD 2BG1A 1B67A 3AV2B 5AVCB 3MGRB 3MGPC 2Y2QA 3B0CW 2ZY3A 3TU4A 5B0ZB 3W97A 1ID3A 3AV1B 1HTAA 3TU4D 3W97D 3C1CB 1ID3D 2NZDB 4NE3A 1H3OB 3EPKA 4WNNA 3AZKB 3AZKC 3VH6T 5AY8A 3X1UA 1P3OB 5AY8D 2Y2LA 4J8UA 3X1UD 3RELB 5CPIC 3RELC 5AV9A 4WJ3C 1M19B 1Z2CB 4Z66B 3B0BA 3B6GA 3EG5B 4Z66C 5AV9D 3LZ0C 4ZBJC 4JJND 3B6GD 4ZUXA 3REKA 1JFIB 3W98C 4J8VA 5GSUB 3EPLA 4ZUXD 3REKD 3REHA 4YS3C 3WA9A 3C1BC 5B24A 4KHAA 2G5IC 4J8VD 5AV5A 3REHD 5B24D 1TZYA 5AV5D 5JRGC 5F99A 5AV6C 1N1JA 3AZLB 1P3KA 3A1KA 3AZLC 5F99D 5CP6C 5B1MB 5B1MC 1ZLAC 3UTAC 4NFTA 5DNMB 2RVQC 5DNMC 1P3MD 3VH5T 2HIOC 3WTPB 5AVBC 1F66C 2UWXA 2Y2HA 1M1AA 2F8NG 3W99C 3WKJC 1M1AD 4H9SC 3KXBC 5BO0A 1HQ3A 1P3BA 2L5AA 4R8PC 1AOIC 1HQ3D 1P3BD 5G49A 5B2IA 2AROB 5B40A 3AZHB 3AZNA 5CHLB 2ZY4A 1P3AB 5B40D 3AN2C 2FJ7B 5CPJB 5DNND 4J8WA 4J8UC 3AZFB 2F8NB 4J8WD 1KX5A 1M18D 1KX5D 5CPKB 1R4VA 3V9RB 4Z5TB 5JA4B 4H9OB 3MGPA 1S32B 3MNNC 1PZRA 2F8NK 1TZYC 4CSRA 3MGPD 1P3GC 1P3KC 5B0ZA 4H9QA 4H9RA 3X1TC 3MVDC 3KWQB 3LELB 2NZDA 3AZIB 4QLCC 5B32G 3AZKA 5E5AC 4XUJC 3AZKD 2Y2GA 1P3PB 3EPJA 5B0YB 4WU9D 5GXQB 1B6WA 5CPIA 3RELA 3VH5W 1P3FC 2BYMA 5CPID 4Z66A 3RELD 4H9PA 3LZ0A 5B2JC 5B2IC 4Z66D 3KUYC 3LZ0D 3UT9B 2F8NH 3W98A 1JFIA 1KX4B 3AZNC 4KGCC 3W98D 5AV8C 4YS3D 3C1BD 3X1SC 1P3IB 1P3IC 2JE5A 1KX3C 5AV6A 3REIB 3MGSB 3AZEB 2NQBB 3AZLA 5JRGD 5B32C 3AZEC 5AV6D 5CP6A 3B6FB 3AZLD 3B6FC 5B1MA 1ZLAA 5CP6D 3UTAA 3NQJA 5GT3B 5B1MD 1ZLAD 3UTAD 5DNMA 2HIOA 5FUGB 5AVBA 1F66A 2RVQD 5DNMD 3AV2C 2HIOD 3W99A 5AVBD 3WKJA 1F66D 1EQZB 2Y2NA 4H9SA 5AVCC 4WU8B 3W99D 3KXBA 3MGRC 3WAAC 3WKJD 3WAAB 2G5HC 1BH9A 3KXBD 2HUEB 1U35B 3R45A 4R8PA 1AOIA 5B0ZC 4R8PD 1AOID 3KSYA 3AV1C 3C1CC 2NZDC 3O62B 3LJAB 5B33B 3LJAC 5B33C 3AN2A 2ZY2A 3AZJB 2Y2MA 3AN2D 4CAYB 1P3OC 4LD9B 5GT0B 4J8UD 2Y2PA 1P3LB 1M19C 2IO5B 5CPKA 5GSUC 4XZQB 4YM6B 4YM6C 5JA4A 4H9OA 3VH6A 4EO5B 3WA9D 3MNNA 1S32A 5BT1C 1P3GA 3MNND 1TZYD 2YFWB 1P34B 3X1TA 3MVDA 1P34C 1P3GD 3MGQB 1P3KD 3AYWB 3X1TD 3MVDD 3A6NB 4J8XB 4QLCA 4UPKA 5E5AA 3AZGB 4G91B 4XUJA 3X1VB 4QLCD 4H9NB 4M6BA 3F6TA 4XUJD 5E5AD 3WTPC 3KFUG 5B0YA 1P3FA 4UUZB 2XD5A 2CV5B 1Q9CA 5BNXB 5B2JA 1P3FD 4KUDB 3KUYA 2AROC 3REJB 5B2JD 5B2ID 3UTBB 3KUYD 4KGCA 1T3UA 3AZMB 3AZHC 5AV8A 4G92B 3AZND 2BYKB 1BH8A 1P3AC 3AFAB 3X1SA 3VH5A 5AV8D 4KGCD 1P3IA 2FJ7C 2Y2IA 1KX3A 3X1SD 3A1IA 1P3ID 5CPJC 3REIA 1KX3D 3MGSA 5B32A 3AZEA 3AZFC 3B6FA 1ULYA 5B32D 3AZED 3B6FD 4X23B 4X23C 3W97B 1ID3B 5CPKC 3AV2A 3H0MC 5BNVB 5AVCA 3MGRA 3AV2D 4Z5TC 3WAAA 5AVCD 3MGRD 3WAAD 1S32C 4Z2MG 3AV1A 3W96B 3KWQC 5B0ZD 4HGAB 3LELC 3W96C 1A7WA 3C1CA 1H3OA 3AV1D 3AZIC 5AV9B 3O62A 3LJAA 3C1CD 5B33A 2NZDD 3H0RC 4JJNB 2ZY5A 5B33D 3LZ1B 1KU5A 2CWEA 4CAYA 4ZUXB 3LZ1C 1P3OA 1P3PC 4NE6A 5B0YC 1P3OD 3REHB 5KDMB 1TAFB 4KHAB 5GXQC 5B24B 5AV5B 1M19A 1P3LA 5F99B 1M19D 1N1JB 3UT9C 5GSUA 2JCHA 1KX4C 4YM6A 5GSUD 1P3MB 4DRAA 4YM6D 3AL0C 2PYOB 3REIC 5BT1D 2PYOC 1M1AB 3MGSC 2YFWA 1P34A 2NQBC 1P34D 5GT3C 1P3BB 1BFMA 3WTPA 3WTPD 1WWIA 1EQZC 4WU8C
chains in the Genus database with same CATH topology
2HUEC 1U35C 2CV5A 5DNNB 4WZSB 3P5JB 2AROA 4KUDA 5C3IB 4J8WB 5C3IC 2AROD 3AZHA 1M18B 3O62C 2LY8A 1P3AA 3AZHD 4E45A 2ZM5A 2FJ7A 3AZJC 1P3AD 4DRBA 2YFVB 5CPJA 2FJ7D 4Z2MH 5CPJD 3AZFA 4LD9C 5GT0C 2F8NA 3FDDA 3AZFD 3MGPB 4WV4B 4X23A 1P3LC 2F8ND 4CSRB 4X23D 2IO5C 4H9QB 4H9RB 5B31G 5BS7C 3V9RA 5CPKD 4Z5TA 4XZQC 5BNVA 4Z5TD 4EO5C 2FFFB 4WU9B 1S32D 4WU9C 3KWQA 3LELA 3MGQC 3W96A 3AYWC 3IP4C 3KWQD 3LELD 3A6NC 3AZIA 5CPIB 3W96D 4J8XC 2BYMB 3AZID 4JJNA 4H9PB 3LZ0B 3AZGC 4G91C 4ZBJB 3X1VC 1WWSA 3B0DB 3LZ1A 3NQUB 2XD1A 3B0DC 1P3PA 3W98B 3LZ1D 4YS3B 5GXQA 3C1BB 1P3PD 5KDMA 1TAFA 5B31B 5B0YD 4DQYB 5B31C 5GXQD 5B1LB 2CV5C 5B1LC 5JRGB 5AV6B 4KUDC 3UT9A 3REJC 5CP6B 1KX4A 3UTBC 3UT9D 3AZMC 1ZLAB 3UTAB 1KX4D 3NQJB 4G92C 1P3MA 3AFAC 2HIOB 5AVBB 1F66B 2PYOA 2NQBA 3W99B 2DF4C 3WKJB 3REID 2PYOD 3KXBB 3MGSD 2NQBD 1BH9B 5GT3A 3R45B 4R8PB 1AOIB 3H0LC 5GT3D 3WTPE 2Y2KA 3TU4B 5FUGA 3TU4C 3W97C 1ID3C 2Y2JA 1EQZA 4WU8A 4WNNB 1EQZD 3AN2B 4WU8D 1U35A 5AY8B 1F1EA 5AY8C 5DNNA 3X1UB 2JSSA 1U35D 3X1UC 2Y2OA 4J8UB 3EPHA 4HGAC 1M18A 3VH6W 5AV9C 3B6GB 4JJNC 3O62D 3LJAD 3AZJA 3B6GC 3B0CT 3REKB 2YFVA 3AZJD 4ZUXC 4J8VB 3REKC 4J8VC 3WA9B 4LD9A 4E44A 1W2EA 5GT0A 3REHC 3WA9C 2F2AC 2RIQA 5B24C 4LD9D 5GT0D 5AV5C 3MNNB 1TZYB 1P3GB 1P3KB 1P3LD 5F99C 3X1TB 3MVDB 5BS7A 2VQRA 4XZQA 2W8SA 4XZQD 1P3MC 4QLCB 5E5AB 4XUJB 4WU9A 1M1AC 2DQNC 3MGQA 3AYWA 3A6NA 5BO0B 3MGQD 1HQ3B 4J8XA 3AYWD 1P3FB 1HQ3C 1P3BC 3A6ND 3AZGA 4J8XD 5G49B 5B2JB 3X1VA 5B2IB 3KUYB 4H9NA 3AZGD 3NQUA 3X1VD 5B40B 3AZNB 4KGCB 5B40C 5AV8B 4YS3A 3C1BA 5B31A 1BH8B 3X1SB 4UUZA 5B1LA 5B31D 1KX3B 5BNXA 5DNNC 4AWLB 5JRGA 2CV5D 4AWLC 5B1LD 2J8PA 5B32B 3REJA 4J8WC 3UTBA 4KUDD 3AZMA 3REJD 1KX5B 3UTBD 1M18C 2BYKA 3AZMD 1KX5C 3AFAA 4NE5A 3AFAD 2BG1A 1B67A 3AV2B 5AVCB 3MGRB 3MGPC 2Y2QA 3B0CW 2ZY3A 3TU4A 5B0ZB 3W97A 1ID3A 3AV1B 1HTAA 3TU4D 3W97D 3C1CB 1ID3D 2NZDB 4NE3A 1H3OB 3EPKA 4WNNA 3AZKB 3AZKC 3VH6T 5AY8A 3X1UA 1P3OB 5AY8D 2Y2LA 4J8UA 3X1UD 3RELB 5CPIC 3RELC 5AV9A 4WJ3C 1M19B 1Z2CB 4Z66B 3B0BA 3B6GA 3EG5B 4Z66C 5AV9D 3LZ0C 4ZBJC 4JJND 3B6GD 4ZUXA 3REKA 1JFIB 3W98C 4J8VA 5GSUB 3EPLA 4ZUXD 3REKD 3REHA 4YS3C 3WA9A 3C1BC 5B24A 4KHAA 2G5IC 4J8VD 5AV5A 3REHD 5B24D 1TZYA 5AV5D 5JRGC 5F99A 5AV6C 1N1JA 3AZLB 1P3KA 3A1KA 3AZLC 5F99D 5CP6C 5B1MB 5B1MC 1ZLAC 3UTAC 4NFTA 5DNMB 2RVQC 5DNMC 1P3MD 3VH5T 2HIOC 3WTPB 5AVBC 1F66C 2UWXA 2Y2HA 1M1AA 2F8NG 3W99C 3WKJC 1M1AD 4H9SC 3KXBC 5BO0A 1HQ3A 1P3BA 2L5AA 4R8PC 1AOIC 1HQ3D 1P3BD 5G49A 5B2IA 2AROB 5B40A 3AZHB 3AZNA 5CHLB 2ZY4A 1P3AB 5B40D 3AN2C 2FJ7B 5CPJB 5DNND 4J8WA 4J8UC 3AZFB 2F8NB 4J8WD 1KX5A 1M18D 1KX5D 5CPKB 1R4VA 3V9RB 4Z5TB 5JA4B 4H9OB 3MGPA 1S32B 3MNNC 1PZRA 2F8NK 1TZYC 4CSRA 3MGPD 1P3GC 1P3KC 5B0ZA 4H9QA 4H9RA 3X1TC 3MVDC 3KWQB 3LELB 2NZDA 3AZIB 4QLCC 5B32G 3AZKA 5E5AC 4XUJC 3AZKD 2Y2GA 1P3PB 3EPJA 5B0YB 4WU9D 5GXQB 1B6WA 5CPIA 3RELA 3VH5W 1P3FC 2BYMA 5CPID 4Z66A 3RELD 4H9PA 3LZ0A 5B2JC 5B2IC 4Z66D 3KUYC 3LZ0D 3UT9B 2F8NH 3W98A 1JFIA 1KX4B 3AZNC 4KGCC 3W98D 5AV8C 4YS3D 3C1BD 3X1SC 1P3IB 1P3IC 2JE5A 1KX3C 5AV6A 3REIB 3MGSB 3AZEB 2NQBB 3AZLA 5JRGD 5B32C 3AZEC 5AV6D 5CP6A 3B6FB 3AZLD 3B6FC 5B1MA 1ZLAA 5CP6D 3UTAA 3NQJA 5GT3B 5B1MD 1ZLAD 3UTAD 5DNMA 2HIOA 5FUGB 5AVBA 1F66A 2RVQD 5DNMD 3AV2C 2HIOD 3W99A 5AVBD 3WKJA 1F66D 1EQZB 2Y2NA 4H9SA 5AVCC 4WU8B 3W99D 3KXBA 3MGRC 3WAAC 3WKJD 3WAAB 2G5HC 1BH9A 3KXBD 2HUEB 1U35B 3R45A 4R8PA 1AOIA 5B0ZC 4R8PD 1AOID 3KSYA 3AV1C 3C1CC 2NZDC 3O62B 3LJAB 5B33B 3LJAC 5B33C 3AN2A 2ZY2A 3AZJB 2Y2MA 3AN2D 4CAYB 1P3OC 4LD9B 5GT0B 4J8UD 2Y2PA 1P3LB 1M19C 2IO5B 5CPKA 5GSUC 4XZQB 4YM6B 4YM6C 5JA4A 4H9OA 3VH6A 4EO5B 3WA9D 3MNNA 1S32A 5BT1C 1P3GA 3MNND 1TZYD 2YFWB 1P34B 3X1TA 3MVDA 1P34C 1P3GD 3MGQB 1P3KD 3AYWB 3X1TD 3MVDD 3A6NB 4J8XB 4QLCA 4UPKA 5E5AA 3AZGB 4G91B 4XUJA 3X1VB 4QLCD 4H9NB 4M6BA 3F6TA 4XUJD 5E5AD 3WTPC 3KFUG 5B0YA 1P3FA 4UUZB 2XD5A 2CV5B 1Q9CA 5BNXB 5B2JA 1P3FD 4KUDB 3KUYA 2AROC 3REJB 5B2JD 5B2ID 3UTBB 3KUYD 4KGCA 1T3UA 3AZMB 3AZHC 5AV8A 4G92B 3AZND 2BYKB 1BH8A 1P3AC 3AFAB 3X1SA 3VH5A 5AV8D 4KGCD 1P3IA 2FJ7C 2Y2IA 1KX3A 3X1SD 3A1IA 1P3ID 5CPJC 3REIA 1KX3D 3MGSA 5B32A 3AZEA 3AZFC 3B6FA 1ULYA 5B32D 3AZED 3B6FD 4X23B 4X23C 3W97B 1ID3B 5CPKC 3AV2A 3H0MC 5BNVB 5AVCA 3MGRA 3AV2D 4Z5TC 3WAAA 5AVCD 3MGRD 3WAAD 1S32C 4Z2MG 3AV1A 3W96B 3KWQC 5B0ZD 4HGAB 3LELC 3W96C 1A7WA 3C1CA 1H3OA 3AV1D 3AZIC 5AV9B 3O62A 3LJAA 3C1CD 5B33A 2NZDD 3H0RC 4JJNB 2ZY5A 5B33D 3LZ1B 1KU5A 2CWEA 4CAYA 4ZUXB 3LZ1C 1P3OA 1P3PC 4NE6A 5B0YC 1P3OD 3REHB 5KDMB 1TAFB 4KHAB 5GXQC 5B24B 5AV5B 1M19A 1P3LA 5F99B 1M19D 1N1JB 3UT9C 5GSUA 2JCHA 1KX4C 4YM6A 5GSUD 1P3MB 4DRAA 4YM6D 3AL0C 2PYOB 3REIC 5BT1D 2PYOC 1M1AB 3MGSC 2YFWA 1P34A 2NQBC 1P34D 5GT3C 1P3BB 1BFMA 3WTPA 3WTPD 1WWIA 1EQZC 4WU8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE C;  1U35 C;  2CV5 A;  5DNN B;  4WZS B;  2ARO A;  4KUD A;  5C3I B;  4J8W B;  5C3I C;  2ARO D;  3AZH A;  1M18 B;  3O62 C;  2LY8 A;  1P3A A;  3AZH D;  4E45 A;  2FJ7 A;  3AZJ C;  1P3A D;  4DRB A;  2YFV B;  5CPJ A;  2FJ7 D;  4Z2M H;  5CPJ D;  3AZF A;  4LD9 C;  5GT0 C;  2F8N A;  3AZF D;  3MGP B;  4WV4 B;  4X23 A;  1P3L C;  2F8N D;  4CSR B;  4X23 D;  2IO5 C;  4H9Q B;  4H9R B;  5B31 G;  5BS7 C;  3V9R A;  5CPK D;  4Z5T A;  4XZQ C;  5BNV A;  4Z5T D;  4EO5 C;  4WU9 B;  1S32 D;  4WU9 C;  3KWQ A;  3LEL A;  3MGQ C;  3W96 A;  3AYW C;  3KWQ D;  3LEL D;  3A6N C;  3AZI A;  5CPI B;  3W96 D;  4J8X C;  2BYM B;  3AZI D;  4JJN A;  4H9P B;  3LZ0 B;  3AZG C;  4G91 C;  4ZBJ B;  3X1V C;  1WWS A;  3B0D B;  3LZ1 A;  3NQU B;  3B0D C;  1P3P A;  3W98 B;  3LZ1 D;  4YS3 B;  5GXQ A;  3C1B B;  1P3P D;  5KDM A;  1TAF A;  5B31 B;  5B0Y D;  5B31 C;  5GXQ D;  5B1L B;  2CV5 C;  5B1L C;  5JRG B;  5AV6 B;  4KUD C;  3UT9 A;  3REJ C;  5CP6 B;  1KX4 A;  3UTB C;  3UT9 D;  3AZM C;  1ZLA B;  3UTA B;  1KX4 D;  3NQJ B;  4G92 C;  1P3M A;  3AFA C;  2HIO B;  5AVB B;  1F66 B;  2PYO A;  2NQB A;  3W99 B;  3WKJ B;  3REI D;  2PYO D;  3KXB B;  3MGS D;  2NQB D;  1BH9 B;  5GT3 A;  3R45 B;  4R8P B;  1AOI B;  5GT3 D;  3WTP E;  3TU4 B;  5FUG A;  3TU4 C;  3W97 C;  1ID3 C;  1EQZ A;  4WU8 A;  4WNN B;  1EQZ D;  3AN2 B;  4WU8 D;  1U35 A;  5AY8 B;  1F1E A;  5AY8 C;  5DNN A;  3X1U B;  2JSS A;  1U35 D;  3X1U C;  4J8U B;  4HGA C;  1M18 A;  3VH6 W;  5AV9 C;  3B6G B;  4JJN C;  3O62 D;  3LJA D;  3AZJ A;  3B6G C;  3B0C T;  3REK B;  2YFV A;  3AZJ D;  4ZUX C;  4J8V B;  3REK C;  4J8V C;  3WA9 B;  4LD9 A;  4E44 A;  5GT0 A;  3REH C;  3WA9 C;  5B24 C;  4LD9 D;  5GT0 D;  5AV5 C;  3MNN B;  1TZY B;  1P3G B;  1P3K B;  1P3L D;  5F99 C;  3X1T B;  3MVD B;  5BS7 A;  4XZQ A;  4XZQ D;  1P3M C;  4QLC B;  5E5A B;  4XUJ B;  4WU9 A;  1M1A C;  3MGQ A;  3AYW A;  3A6N A;  5BO0 B;  3MGQ D;  1HQ3 B;  4J8X A;  3AYW D;  1P3F B;  1HQ3 C;  1P3B C;  3A6N D;  3AZG A;  4J8X D;  5G49 B;  5B2J B;  3X1V A;  5B2I B;  3KUY B;  4H9N A;  3AZG D;  3NQU A;  3X1V D;  5B40 B;  3AZN B;  4KGC B;  5B40 C;  5AV8 B;  4YS3 A;  3C1B A;  5B31 A;  1BH8 B;  3X1S B;  4UUZ A;  5B1L A;  5B31 D;  1KX3 B;  5BNX A;  5DNN C;  4AWL B;  5JRG A;  2CV5 D;  4AWL C;  5B1L D;  5B32 B;  3REJ A;  4J8W C;  3UTB A;  4KUD D;  3AZM A;  3REJ D;  1KX5 B;  3UTB D;  1M18 C;  2BYK A;  3AZM D;  1KX5 C;  3AFA A;  4NE5 A;  3AFA D;  1B67 A;  3AV2 B;  5AVC B;  3MGR B;  3MGP C;  3B0C W;  3TU4 A;  5B0Z B;  3W97 A;  1ID3 A;  3AV1 B;  1HTA A;  3TU4 D;  3W97 D;  3C1C B;  1ID3 D;  2NZD B;  4NE3 A;  1H3O B;  4WNN A;  3AZK B;  3AZK C;  3VH6 T;  5AY8 A;  3X1U A;  1P3O B;  5AY8 D;  4J8U A;  3X1U D;  3REL B;  5CPI C;  3REL C;  5AV9 A;  1M19 B;  4Z66 B;  3B0B A;  3B6G A;  4Z66 C;  5AV9 D;  3LZ0 C;  4ZBJ C;  4JJN D;  3B6G D;  4ZUX A;  3REK A;  1JFI B;  3W98 C;  4J8V A;  5GSU B;  4ZUX D;  3REK D;  3REH A;  4YS3 C;  3WA9 A;  3C1B C;  5B24 A;  4KHA A;  4J8V D;  5AV5 A;  3REH D;  5B24 D;  1TZY A;  5AV5 D;  5JRG C;  5F99 A;  5AV6 C;  1N1J A;  3AZL B;  1P3K A;  3AZL C;  5F99 D;  5CP6 C;  5B1M B;  5B1M C;  1ZLA C;  3UTA C;  4NFT A;  5DNM B;  2RVQ C;  5DNM C;  1P3M D;  3VH5 T;  2HIO C;  3WTP B;  5AVB C;  1F66 C;  1M1A A;  2F8N G;  3W99 C;  3WKJ C;  1M1A D;  4H9S C;  3KXB C;  5BO0 A;  1HQ3 A;  1P3B A;  2L5A A;  4R8P C;  1AOI C;  1HQ3 D;  1P3B D;  5G49 A;  5B2I A;  2ARO B;  5B40 A;  3AZH B;  3AZN A;  5CHL B;  1P3A B;  5B40 D;  3AN2 C;  2FJ7 B;  5CPJ B;  5DNN D;  4J8W A;  4J8U C;  3AZF B;  2F8N B;  4J8W D;  1KX5 A;  1M18 D;  1KX5 D;  5CPK B;  1R4V A;  3V9R B;  4Z5T B;  5JA4 B;  4H9O B;  3MGP A;  1S32 B;  3MNN C;  2F8N K;  1TZY C;  4CSR A;  3MGP D;  1P3G C;  1P3K C;  5B0Z A;  4H9Q A;  4H9R A;  3X1T C;  3MVD C;  3KWQ B;  3LEL B;  2NZD A;  3AZI B;  4QLC C;  5B32 G;  3AZK A;  5E5A C;  4XUJ C;  3AZK D;  1P3P B;  5B0Y B;  4WU9 D;  5GXQ B;  1B6W A;  5CPI A;  3REL A;  3VH5 W;  1P3F C;  2BYM A;  5CPI D;  4Z66 A;  3REL D;  4H9P A;  3LZ0 A;  5B2J C;  5B2I C;  4Z66 D;  3KUY C;  3LZ0 D;  3UT9 B;  2F8N H;  3W98 A;  1JFI A;  1KX4 B;  3AZN C;  4KGC C;  3W98 D;  5AV8 C;  4YS3 D;  3C1B D;  3X1S C;  1P3I B;  1P3I C;  1KX3 C;  5AV6 A;  3REI B;  3MGS B;  3AZE B;  2NQB B;  3AZL A;  5JRG D;  5B32 C;  3AZE C;  5AV6 D;  5CP6 A;  3B6F B;  3AZL D;  3B6F C;  5B1M A;  1ZLA A;  5CP6 D;  3UTA A;  3NQJ A;  5GT3 B;  5B1M D;  1ZLA D;  3UTA D;  5DNM A;  2HIO A;  5FUG B;  5AVB A;  1F66 A;  2RVQ D;  5DNM D;  3AV2 C;  2HIO D;  3W99 A;  5AVB D;  3WKJ A;  1F66 D;  1EQZ B;  4H9S A;  5AVC C;  3KXB A;  4WU8 B;  3W99 D;  3MGR C;  3WAA B;  3WAA C;  3WKJ D;  1BH9 A;  3KXB D;  2HUE B;  1U35 B;  3R45 A;  4R8P A;  1AOI A;  5B0Z C;  4R8P D;  1AOI D;  3KSY A;  3AV1 C;  3C1C C;  2NZD C;  3O62 B;  3LJA B;  5B33 B;  3LJA C;  5B33 C;  3AN2 A;  3AZJ B;  3AN2 D;  4CAY B;  1P3O C;  4LD9 B;  5GT0 B;  4J8U D;  1P3L B;  1M19 C;  2IO5 B;  5CPK A;  5GSU C;  4XZQ B;  4YM6 B;  4YM6 C;  5JA4 A;  4H9O A;  3VH6 A;  4EO5 B;  3WA9 D;  3MNN A;  1S32 A;  5BT1 C;  1P3G A;  3MNN D;  1TZY D;  2YFW B;  1P34 B;  3X1T A;  3MVD A;  1P34 C;  1P3G D;  3MGQ B;  1P3K D;  3AYW B;  3X1T D;  3MVD D;  3A6N B;  4J8X B;  4QLC A;  5E5A A;  3AZG B;  4G91 B;  4XUJ A;  3X1V B;  4QLC D;  4H9N B;  4M6B A;  5E5A D;  4XUJ D;  3WTP C;  5B0Y A;  1P3F A;  4UUZ B;  2CV5 B;  1Q9C A;  5BNX B;  5B2J A;  1P3F D;  4KUD B;  3KUY A;  2ARO C;  3REJ B;  5B2J D;  5B2I D;  3UTB B;  3KUY D;  4KGC A;  3AZM B;  3AZH C;  5AV8 A;  4G92 B;  3AZN D;  2BYK B;  1BH8 A;  1P3A C;  3AFA B;  3X1S A;  3VH5 A;  5AV8 D;  4KGC D;  1P3I A;  2FJ7 C;  1KX3 A;  3X1S D;  1P3I D;  5CPJ C;  3REI A;  1KX3 D;  3MGS A;  5B32 A;  3AZE A;  3AZF C;  3B6F A;  1ULY A;  5B32 D;  3AZE D;  3B6F D;  4X23 B;  4X23 C;  3W97 B;  1ID3 B;  5CPK C;  3AV2 A;  5BNV B;  5AVC A;  3MGR A;  3AV2 D;  4Z5T C;  3WAA A;  5AVC D;  3MGR D;  3WAA D;  1S32 C;  4Z2M G;  3AV1 A;  3W96 B;  3KWQ C;  5B0Z D;  4HGA B;  3LEL C;  3W96 C;  1A7W A;  3C1C A;  1H3O A;  3AV1 D;  3AZI C;  5AV9 B;  3O62 A;  3LJA A;  3C1C D;  5B33 A;  2NZD D;  4JJN B;  5B33 D;  3LZ1 B;  1KU5 A;  2CWE A;  4CAY A;  4ZUX B;  3LZ1 C;  1P3O A;  1P3P C;  4NE6 A;  5B0Y C;  1P3O D;  3REH B;  5KDM B;  1TAF B;  4KHA B;  5GXQ C;  5B24 B;  5AV5 B;  1M19 A;  1P3L A;  5F99 B;  1M19 D;  1N1J B;  3UT9 C;  5GSU A;  1KX4 C;  4YM6 A;  5GSU D;  1P3M B;  4DRA A;  4YM6 D;  2PYO B;  3REI C;  5BT1 D;  2PYO C;  1M1A B;  3MGS C;  2YFW A;  1P34 A;  2NQB C;  1P34 D;  5GT3 C;  1P3B B;  1BFM A;  3WTP A;  3WTP D;  1WWI A;  1EQZ C;  4WU8 C; 
#chains in the Genus database with same CATH topology
 2HUE C;  1U35 C;  2CV5 A;  5DNN B;  4WZS B;  3P5J B;  2ARO A;  4KUD A;  5C3I B;  4J8W B;  5C3I C;  2ARO D;  3AZH A;  1M18 B;  3O62 C;  2LY8 A;  1P3A A;  3AZH D;  4E45 A;  2ZM5 A;  2FJ7 A;  3AZJ C;  1P3A D;  4DRB A;  2YFV B;  5CPJ A;  2FJ7 D;  4Z2M H;  5CPJ D;  3AZF A;  4LD9 C;  5GT0 C;  2F8N A;  3FDD A;  3AZF D;  3MGP B;  4WV4 B;  4X23 A;  1P3L C;  2F8N D;  4CSR B;  4X23 D;  2IO5 C;  4H9Q B;  4H9R B;  5B31 G;  5BS7 C;  3V9R A;  5CPK D;  4Z5T A;  4XZQ C;  5BNV A;  4Z5T D;  4EO5 C;  2FFF B;  4WU9 B;  1S32 D;  4WU9 C;  3KWQ A;  3LEL A;  3MGQ C;  3W96 A;  3AYW C;  3IP4 C;  3KWQ D;  3LEL D;  3A6N C;  3AZI A;  5CPI B;  3W96 D;  4J8X C;  2BYM B;  3AZI D;  4JJN A;  4H9P B;  3LZ0 B;  3AZG C;  4G91 C;  4ZBJ B;  3X1V C;  1WWS A;  3B0D B;  3LZ1 A;  3NQU B;  2XD1 A;  3B0D C;  1P3P A;  3W98 B;  3LZ1 D;  4YS3 B;  5GXQ A;  3C1B B;  1P3P D;  5KDM A;  1TAF A;  5B31 B;  5B0Y D;  4DQY B;  5B31 C;  5GXQ D;  5B1L B;  2CV5 C;  5B1L C;  5JRG B;  5AV6 B;  4KUD C;  3UT9 A;  3REJ C;  5CP6 B;  1KX4 A;  3UTB C;  3UT9 D;  3AZM C;  1ZLA B;  3UTA B;  1KX4 D;  3NQJ B;  4G92 C;  1P3M A;  3AFA C;  2HIO B;  5AVB B;  1F66 B;  2PYO A;  2NQB A;  3W99 B;  2DF4 C;  3WKJ B;  3REI D;  2PYO D;  3KXB B;  3MGS D;  2NQB D;  1BH9 B;  5GT3 A;  3R45 B;  4R8P B;  1AOI B;  3H0L C;  5GT3 D;  3WTP E;  2Y2K A;  3TU4 B;  5FUG A;  3TU4 C;  3W97 C;  1ID3 C;  2Y2J A;  1EQZ A;  4WU8 A;  4WNN B;  1EQZ D;  3AN2 B;  4WU8 D;  1U35 A;  5AY8 B;  1F1E A;  5AY8 C;  5DNN A;  3X1U B;  2JSS A;  1U35 D;  3X1U C;  2Y2O A;  4J8U B;  3EPH A;  4HGA C;  1M18 A;  3VH6 W;  5AV9 C;  3B6G B;  4JJN C;  3O62 D;  3LJA D;  3AZJ A;  3B6G C;  3B0C T;  3REK B;  2YFV A;  3AZJ D;  4ZUX C;  4J8V B;  3REK C;  4J8V C;  3WA9 B;  4LD9 A;  4E44 A;  1W2E A;  5GT0 A;  3REH C;  3WA9 C;  2F2A C;  2RIQ A;  5B24 C;  4LD9 D;  5GT0 D;  5AV5 C;  3MNN B;  1TZY B;  1P3G B;  1P3K B;  1P3L D;  5F99 C;  3X1T B;  3MVD B;  5BS7 A;  2VQR A;  4XZQ A;  2W8S A;  4XZQ D;  1P3M C;  4QLC B;  5E5A B;  4XUJ B;  4WU9 A;  1M1A C;  2DQN C;  3MGQ A;  3AYW A;  3A6N A;  5BO0 B;  3MGQ D;  1HQ3 B;  4J8X A;  3AYW D;  1P3F B;  1HQ3 C;  1P3B C;  3A6N D;  3AZG A;  4J8X D;  5G49 B;  5B2J B;  3X1V A;  5B2I B;  3KUY B;  4H9N A;  3AZG D;  3NQU A;  3X1V D;  5B40 B;  3AZN B;  4KGC B;  5B40 C;  5AV8 B;  4YS3 A;  3C1B A;  5B31 A;  1BH8 B;  3X1S B;  4UUZ A;  5B1L A;  5B31 D;  1KX3 B;  5BNX A;  5DNN C;  4AWL B;  5JRG A;  2CV5 D;  4AWL C;  5B1L D;  2J8P A;  5B32 B;  3REJ A;  4J8W C;  3UTB A;  4KUD D;  3AZM A;  3REJ D;  1KX5 B;  3UTB D;  1M18 C;  2BYK A;  3AZM D;  1KX5 C;  3AFA A;  4NE5 A;  3AFA D;  2BG1 A;  1B67 A;  3AV2 B;  5AVC B;  3MGR B;  3MGP C;  2Y2Q A;  3B0C W;  2ZY3 A;  3TU4 A;  5B0Z B;  3W97 A;  1ID3 A;  3AV1 B;  1HTA A;  3TU4 D;  3W97 D;  3C1C B;  1ID3 D;  2NZD B;  4NE3 A;  1H3O B;  3EPK A;  4WNN A;  3AZK B;  3AZK C;  3VH6 T;  5AY8 A;  3X1U A;  1P3O B;  5AY8 D;  2Y2L A;  4J8U A;  3X1U D;  3REL B;  5CPI C;  3REL C;  5AV9 A;  4WJ3 C;  1M19 B;  1Z2C B;  4Z66 B;  3B0B A;  3B6G A;  3EG5 B;  4Z66 C;  5AV9 D;  3LZ0 C;  4ZBJ C;  4JJN D;  3B6G D;  4ZUX A;  3REK A;  1JFI B;  3W98 C;  4J8V A;  5GSU B;  3EPL A;  4ZUX D;  3REK D;  3REH A;  4YS3 C;  3WA9 A;  3C1B C;  5B24 A;  4KHA A;  2G5I C;  4J8V D;  5AV5 A;  3REH D;  5B24 D;  1TZY A;  5AV5 D;  5JRG C;  5F99 A;  5AV6 C;  1N1J A;  3AZL B;  1P3K A;  3A1K A;  3AZL C;  5F99 D;  5CP6 C;  5B1M B;  5B1M C;  1ZLA C;  3UTA C;  4NFT A;  5DNM B;  2RVQ C;  5DNM C;  1P3M D;  3VH5 T;  2HIO C;  3WTP B;  5AVB C;  1F66 C;  2UWX A;  2Y2H A;  1M1A A;  2F8N G;  3W99 C;  3WKJ C;  1M1A D;  4H9S C;  3KXB C;  5BO0 A;  1HQ3 A;  1P3B A;  2L5A A;  4R8P C;  1AOI C;  1HQ3 D;  1P3B D;  5G49 A;  5B2I A;  2ARO B;  5B40 A;  3AZH B;  3AZN A;  5CHL B;  2ZY4 A;  1P3A B;  5B40 D;  3AN2 C;  2FJ7 B;  5CPJ B;  5DNN D;  4J8W A;  4J8U C;  3AZF B;  2F8N B;  4J8W D;  1KX5 A;  1M18 D;  1KX5 D;  5CPK B;  1R4V A;  3V9R B;  4Z5T B;  5JA4 B;  4H9O B;  3MGP A;  1S32 B;  3MNN C;  1PZR A;  2F8N K;  1TZY C;  4CSR A;  3MGP D;  1P3G C;  1P3K C;  5B0Z A;  4H9Q A;  4H9R A;  3X1T C;  3MVD C;  3KWQ B;  3LEL B;  2NZD A;  3AZI B;  4QLC C;  5B32 G;  3AZK A;  5E5A C;  4XUJ C;  3AZK D;  2Y2G A;  1P3P B;  3EPJ A;  5B0Y B;  4WU9 D;  5GXQ B;  1B6W A;  5CPI A;  3REL A;  3VH5 W;  1P3F C;  2BYM A;  5CPI D;  4Z66 A;  3REL D;  4H9P A;  3LZ0 A;  5B2J C;  5B2I C;  4Z66 D;  3KUY C;  3LZ0 D;  3UT9 B;  2F8N H;  3W98 A;  1JFI A;  1KX4 B;  3AZN C;  4KGC C;  3W98 D;  5AV8 C;  4YS3 D;  3C1B D;  3X1S C;  1P3I B;  1P3I C;  2JE5 A;  1KX3 C;  5AV6 A;  3REI B;  3MGS B;  3AZE B;  2NQB B;  3AZL A;  5JRG D;  5B32 C;  3AZE C;  5AV6 D;  5CP6 A;  3B6F B;  3AZL D;  3B6F C;  5B1M A;  1ZLA A;  5CP6 D;  3UTA A;  3NQJ A;  5GT3 B;  5B1M D;  1ZLA D;  3UTA D;  5DNM A;  2HIO A;  5FUG B;  5AVB A;  1F66 A;  2RVQ D;  5DNM D;  3AV2 C;  2HIO D;  3W99 A;  5AVB D;  3WKJ A;  1F66 D;  1EQZ B;  2Y2N A;  4H9S A;  5AVC C;  4WU8 B;  3W99 D;  3KXB A;  3MGR C;  3WAA C;  3WKJ D;  3WAA B;  2G5H C;  1BH9 A;  3KXB D;  2HUE B;  1U35 B;  3R45 A;  4R8P A;  1AOI A;  5B0Z C;  4R8P D;  1AOI D;  3KSY A;  3AV1 C;  3C1C C;  2NZD C;  3O62 B;  3LJA B;  5B33 B;  3LJA C;  5B33 C;  3AN2 A;  2ZY2 A;  3AZJ B;  2Y2M A;  3AN2 D;  4CAY B;  1P3O C;  4LD9 B;  5GT0 B;  4J8U D;  2Y2P A;  1P3L B;  1M19 C;  2IO5 B;  5CPK A;  5GSU C;  4XZQ B;  4YM6 B;  4YM6 C;  5JA4 A;  4H9O A;  3VH6 A;  4EO5 B;  3WA9 D;  3MNN A;  1S32 A;  5BT1 C;  1P3G A;  3MNN D;  1TZY D;  2YFW B;  1P34 B;  3X1T A;  3MVD A;  1P34 C;  1P3G D;  3MGQ B;  1P3K D;  3AYW B;  3X1T D;  3MVD D;  3A6N B;  4J8X B;  4QLC A;  4UPK A;  5E5A A;  3AZG B;  4G91 B;  4XUJ A;  3X1V B;  4QLC D;  4H9N B;  4M6B A;  3F6T A;  4XUJ D;  5E5A D;  3WTP C;  3KFU G;  5B0Y A;  1P3F A;  4UUZ B;  2XD5 A;  2CV5 B;  1Q9C A;  5BNX B;  5B2J A;  1P3F D;  4KUD B;  3KUY A;  2ARO C;  3REJ B;  5B2J D;  5B2I D;  3UTB B;  3KUY D;  4KGC A;  1T3U A;  3AZM B;  3AZH C;  5AV8 A;  4G92 B;  3AZN D;  2BYK B;  1BH8 A;  1P3A C;  3AFA B;  3X1S A;  3VH5 A;  5AV8 D;  4KGC D;  1P3I A;  2FJ7 C;  2Y2I A;  1KX3 A;  3X1S D;  3A1I A;  1P3I D;  5CPJ C;  3REI A;  1KX3 D;  3MGS A;  5B32 A;  3AZE A;  3AZF C;  3B6F A;  1ULY A;  5B32 D;  3AZE D;  3B6F D;  4X23 B;  4X23 C;  3W97 B;  1ID3 B;  5CPK C;  3AV2 A;  3H0M C;  5BNV B;  5AVC A;  3MGR A;  3AV2 D;  4Z5T C;  3WAA A;  5AVC D;  3MGR D;  3WAA D;  1S32 C;  4Z2M G;  3AV1 A;  3W96 B;  3KWQ C;  5B0Z D;  4HGA B;  3LEL C;  3W96 C;  1A7W A;  3C1C A;  1H3O A;  3AV1 D;  3AZI C;  5AV9 B;  3O62 A;  3LJA A;  3C1C D;  5B33 A;  2NZD D;  3H0R C;  4JJN B;  2ZY5 A;  5B33 D;  3LZ1 B;  1KU5 A;  2CWE A;  4CAY A;  4ZUX B;  3LZ1 C;  1P3O A;  1P3P C;  4NE6 A;  5B0Y C;  1P3O D;  3REH B;  5KDM B;  1TAF B;  4KHA B;  5GXQ C;  5B24 B;  5AV5 B;  1M19 A;  1P3L A;  5F99 B;  1M19 D;  1N1J B;  3UT9 C;  5GSU A;  2JCH A;  1KX4 C;  4YM6 A;  5GSU D;  1P3M B;  4DRA A;  4YM6 D;  3AL0 C;  2PYO B;  3REI C;  5BT1 D;  2PYO C;  1M1A B;  3MGS C;  2YFW A;  1P34 A;  2NQB C;  1P34 D;  5GT3 C;  1P3B B;  1BFM A;  3WTP A;  3WTP D;  1WWI A;  1EQZ C;  4WU8 C; 
#chains in the Genus database with same CATH homology
 2HUE C;  1U35 C;  2CV5 A;  5DNN B;  4WZS B;  3P5J B;  2ARO A;  4KUD A;  5C3I B;  4J8W B;  5C3I C;  2ARO D;  3AZH A;  1M18 B;  3O62 C;  2LY8 A;  1P3A A;  3AZH D;  4E45 A;  2ZM5 A;  2FJ7 A;  3AZJ C;  1P3A D;  4DRB A;  2YFV B;  5CPJ A;  2FJ7 D;  4Z2M H;  5CPJ D;  3AZF A;  4LD9 C;  5GT0 C;  2F8N A;  3FDD A;  3AZF D;  3MGP B;  4WV4 B;  4X23 A;  1P3L C;  2F8N D;  4CSR B;  4X23 D;  2IO5 C;  4H9Q B;  4H9R B;  5B31 G;  5BS7 C;  3V9R A;  5CPK D;  4Z5T A;  4XZQ C;  5BNV A;  4Z5T D;  4EO5 C;  2FFF B;  4WU9 B;  1S32 D;  4WU9 C;  3KWQ A;  3LEL A;  3MGQ C;  3W96 A;  3AYW C;  3IP4 C;  3KWQ D;  3LEL D;  3A6N C;  3AZI A;  5CPI B;  3W96 D;  4J8X C;  2BYM B;  3AZI D;  4JJN A;  4H9P B;  3LZ0 B;  3AZG C;  4G91 C;  4ZBJ B;  3X1V C;  1WWS A;  3B0D B;  3LZ1 A;  3NQU B;  2XD1 A;  3B0D C;  1P3P A;  3W98 B;  3LZ1 D;  4YS3 B;  5GXQ A;  3C1B B;  1P3P D;  5KDM A;  1TAF A;  5B31 B;  5B0Y D;  4DQY B;  5B31 C;  5GXQ D;  5B1L B;  2CV5 C;  5B1L C;  5JRG B;  5AV6 B;  4KUD C;  3UT9 A;  3REJ C;  5CP6 B;  1KX4 A;  3UTB C;  3UT9 D;  3AZM C;  1ZLA B;  3UTA B;  1KX4 D;  3NQJ B;  4G92 C;  1P3M A;  3AFA C;  2HIO B;  5AVB B;  1F66 B;  2PYO A;  2NQB A;  3W99 B;  2DF4 C;  3WKJ B;  3REI D;  2PYO D;  3KXB B;  3MGS D;  2NQB D;  1BH9 B;  5GT3 A;  3R45 B;  4R8P B;  1AOI B;  3H0L C;  5GT3 D;  3WTP E;  2Y2K A;  3TU4 B;  5FUG A;  3TU4 C;  3W97 C;  1ID3 C;  2Y2J A;  1EQZ A;  4WU8 A;  4WNN B;  1EQZ D;  3AN2 B;  4WU8 D;  1U35 A;  5AY8 B;  1F1E A;  5AY8 C;  5DNN A;  3X1U B;  2JSS A;  1U35 D;  3X1U C;  2Y2O A;  4J8U B;  3EPH A;  4HGA C;  1M18 A;  3VH6 W;  5AV9 C;  3B6G B;  4JJN C;  3O62 D;  3LJA D;  3AZJ A;  3B6G C;  3B0C T;  3REK B;  2YFV A;  3AZJ D;  4ZUX C;  4J8V B;  3REK C;  4J8V C;  3WA9 B;  4LD9 A;  4E44 A;  1W2E A;  5GT0 A;  3REH C;  3WA9 C;  2F2A C;  2RIQ A;  5B24 C;  4LD9 D;  5GT0 D;  5AV5 C;  3MNN B;  1TZY B;  1P3G B;  1P3K B;  1P3L D;  5F99 C;  3X1T B;  3MVD B;  5BS7 A;  2VQR A;  4XZQ A;  2W8S A;  4XZQ D;  1P3M C;  4QLC B;  5E5A B;  4XUJ B;  4WU9 A;  1M1A C;  2DQN C;  3MGQ A;  3AYW A;  3A6N A;  5BO0 B;  3MGQ D;  1HQ3 B;  4J8X A;  3AYW D;  1P3F B;  1HQ3 C;  1P3B C;  3A6N D;  3AZG A;  4J8X D;  5G49 B;  5B2J B;  3X1V A;  5B2I B;  3KUY B;  4H9N A;  3AZG D;  3NQU A;  3X1V D;  5B40 B;  3AZN B;  4KGC B;  5B40 C;  5AV8 B;  4YS3 A;  3C1B A;  5B31 A;  1BH8 B;  3X1S B;  4UUZ A;  5B1L A;  5B31 D;  1KX3 B;  5BNX A;  5DNN C;  4AWL B;  5JRG A;  2CV5 D;  4AWL C;  5B1L D;  2J8P A;  5B32 B;  3REJ A;  4J8W C;  3UTB A;  4KUD D;  3AZM A;  3REJ D;  1KX5 B;  3UTB D;  1M18 C;  2BYK A;  3AZM D;  1KX5 C;  3AFA A;  4NE5 A;  3AFA D;  2BG1 A;  1B67 A;  3AV2 B;  5AVC B;  3MGR B;  3MGP C;  2Y2Q A;  3B0C W;  2ZY3 A;  3TU4 A;  5B0Z B;  3W97 A;  1ID3 A;  3AV1 B;  1HTA A;  3TU4 D;  3W97 D;  3C1C B;  1ID3 D;  2NZD B;  4NE3 A;  1H3O B;  3EPK A;  4WNN A;  3AZK B;  3AZK C;  3VH6 T;  5AY8 A;  3X1U A;  1P3O B;  5AY8 D;  2Y2L A;  4J8U A;  3X1U D;  3REL B;  5CPI C;  3REL C;  5AV9 A;  4WJ3 C;  1M19 B;  1Z2C B;  4Z66 B;  3B0B A;  3B6G A;  3EG5 B;  4Z66 C;  5AV9 D;  3LZ0 C;  4ZBJ C;  4JJN D;  3B6G D;  4ZUX A;  3REK A;  1JFI B;  3W98 C;  4J8V A;  5GSU B;  3EPL A;  4ZUX D;  3REK D;  3REH A;  4YS3 C;  3WA9 A;  3C1B C;  5B24 A;  4KHA A;  2G5I C;  4J8V D;  5AV5 A;  3REH D;  5B24 D;  1TZY A;  5AV5 D;  5JRG C;  5F99 A;  5AV6 C;  1N1J A;  3AZL B;  1P3K A;  3A1K A;  3AZL C;  5F99 D;  5CP6 C;  5B1M B;  5B1M C;  1ZLA C;  3UTA C;  4NFT A;  5DNM B;  2RVQ C;  5DNM C;  1P3M D;  3VH5 T;  2HIO C;  3WTP B;  5AVB C;  1F66 C;  2UWX A;  2Y2H A;  1M1A A;  2F8N G;  3W99 C;  3WKJ C;  1M1A D;  4H9S C;  3KXB C;  5BO0 A;  1HQ3 A;  1P3B A;  2L5A A;  4R8P C;  1AOI C;  1HQ3 D;  1P3B D;  5G49 A;  5B2I A;  2ARO B;  5B40 A;  3AZH B;  3AZN A;  5CHL B;  2ZY4 A;  1P3A B;  5B40 D;  3AN2 C;  2FJ7 B;  5CPJ B;  5DNN D;  4J8W A;  4J8U C;  3AZF B;  2F8N B;  4J8W D;  1KX5 A;  1M18 D;  1KX5 D;  5CPK B;  1R4V A;  3V9R B;  4Z5T B;  5JA4 B;  4H9O B;  3MGP A;  1S32 B;  3MNN C;  1PZR A;  2F8N K;  1TZY C;  4CSR A;  3MGP D;  1P3G C;  1P3K C;  5B0Z A;  4H9Q A;  4H9R A;  3X1T C;  3MVD C;  3KWQ B;  3LEL B;  2NZD A;  3AZI B;  4QLC C;  5B32 G;  3AZK A;  5E5A C;  4XUJ C;  3AZK D;  2Y2G A;  1P3P B;  3EPJ A;  5B0Y B;  4WU9 D;  5GXQ B;  1B6W A;  5CPI A;  3REL A;  3VH5 W;  1P3F C;  2BYM A;  5CPI D;  4Z66 A;  3REL D;  4H9P A;  3LZ0 A;  5B2J C;  5B2I C;  4Z66 D;  3KUY C;  3LZ0 D;  3UT9 B;  2F8N H;  3W98 A;  1JFI A;  1KX4 B;  3AZN C;  4KGC C;  3W98 D;  5AV8 C;  4YS3 D;  3C1B D;  3X1S C;  1P3I B;  1P3I C;  2JE5 A;  1KX3 C;  5AV6 A;  3REI B;  3MGS B;  3AZE B;  2NQB B;  3AZL A;  5JRG D;  5B32 C;  3AZE C;  5AV6 D;  5CP6 A;  3B6F B;  3AZL D;  3B6F C;  5B1M A;  1ZLA A;  5CP6 D;  3UTA A;  3NQJ A;  5GT3 B;  5B1M D;  1ZLA D;  3UTA D;  5DNM A;  2HIO A;  5FUG B;  5AVB A;  1F66 A;  2RVQ D;  5DNM D;  3AV2 C;  2HIO D;  3W99 A;  5AVB D;  3WKJ A;  1F66 D;  1EQZ B;  2Y2N A;  4H9S A;  5AVC C;  4WU8 B;  3W99 D;  3KXB A;  3MGR C;  3WAA C;  3WKJ D;  3WAA B;  2G5H C;  1BH9 A;  3KXB D;  2HUE B;  1U35 B;  3R45 A;  4R8P A;  1AOI A;  5B0Z C;  4R8P D;  1AOI D;  3KSY A;  3AV1 C;  3C1C C;  2NZD C;  3O62 B;  3LJA B;  5B33 B;  3LJA C;  5B33 C;  3AN2 A;  2ZY2 A;  3AZJ B;  2Y2M A;  3AN2 D;  4CAY B;  1P3O C;  4LD9 B;  5GT0 B;  4J8U D;  2Y2P A;  1P3L B;  1M19 C;  2IO5 B;  5CPK A;  5GSU C;  4XZQ B;  4YM6 B;  4YM6 C;  5JA4 A;  4H9O A;  3VH6 A;  4EO5 B;  3WA9 D;  3MNN A;  1S32 A;  5BT1 C;  1P3G A;  3MNN D;  1TZY D;  2YFW B;  1P34 B;  3X1T A;  3MVD A;  1P34 C;  1P3G D;  3MGQ B;  1P3K D;  3AYW B;  3X1T D;  3MVD D;  3A6N B;  4J8X B;  4QLC A;  4UPK A;  5E5A A;  3AZG B;  4G91 B;  4XUJ A;  3X1V B;  4QLC D;  4H9N B;  4M6B A;  3F6T A;  4XUJ D;  5E5A D;  3WTP C;  3KFU G;  5B0Y A;  1P3F A;  4UUZ B;  2XD5 A;  2CV5 B;  1Q9C A;  5BNX B;  5B2J A;  1P3F D;  4KUD B;  3KUY A;  2ARO C;  3REJ B;  5B2J D;  5B2I D;  3UTB B;  3KUY D;  4KGC A;  1T3U A;  3AZM B;  3AZH C;  5AV8 A;  4G92 B;  3AZN D;  2BYK B;  1BH8 A;  1P3A C;  3AFA B;  3X1S A;  3VH5 A;  5AV8 D;  4KGC D;  1P3I A;  2FJ7 C;  2Y2I A;  1KX3 A;  3X1S D;  3A1I A;  1P3I D;  5CPJ C;  3REI A;  1KX3 D;  3MGS A;  5B32 A;  3AZE A;  3AZF C;  3B6F A;  1ULY A;  5B32 D;  3AZE D;  3B6F D;  4X23 B;  4X23 C;  3W97 B;  1ID3 B;  5CPK C;  3AV2 A;  3H0M C;  5BNV B;  5AVC A;  3MGR A;  3AV2 D;  4Z5T C;  3WAA A;  5AVC D;  3MGR D;  3WAA D;  1S32 C;  4Z2M G;  3AV1 A;  3W96 B;  3KWQ C;  5B0Z D;  4HGA B;  3LEL C;  3W96 C;  1A7W A;  3C1C A;  1H3O A;  3AV1 D;  3AZI C;  5AV9 B;  3O62 A;  3LJA A;  3C1C D;  5B33 A;  2NZD D;  3H0R C;  4JJN B;  2ZY5 A;  5B33 D;  3LZ1 B;  1KU5 A;  2CWE A;  4CAY A;  4ZUX B;  3LZ1 C;  1P3O A;  1P3P C;  4NE6 A;  5B0Y C;  1P3O D;  3REH B;  5KDM B;  1TAF B;  4KHA B;  5GXQ C;  5B24 B;  5AV5 B;  1M19 A;  1P3L A;  5F99 B;  1M19 D;  1N1J B;  3UT9 C;  5GSU A;  2JCH A;  1KX4 C;  4YM6 A;  5GSU D;  1P3M B;  4DRA A;  4YM6 D;  3AL0 C;  2PYO B;  3REI C;  5BT1 D;  2PYO C;  1M1A B;  3MGS C;  2YFW A;  1P34 A;  2NQB C;  1P34 D;  5GT3 C;  1P3B B;  1BFM A;  3WTP A;  3WTP D;  1WWI A;  1EQZ C;  4WU8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...