3WAAB

The nucleosome containing human h2a.z.2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaB00
4AWLB 5B0YC 2F8ND 3AZFB 3UT9D 1M1AB 4UUZB 3X1UB 4J8WA 3X1VA 1TZYB 1BH8A 5GT0B 5GSUD 5CP6A 2AROA 4J8UC 1B67A 5AVBD 3REJA 5AV6D 5CPJB 3MGPA 3LJAD 1B6WA 3RELD 1KX5C 1F1EA 3WA9A 4LD9A 3VH6T 3W98B 2HUEB 5AV6A 5B32G 3WTPA 1P3BC 3UTBB 5B1MB 5BNVA 4G92C 1KX4C 5AVCC 1P3OB 5BS7A 5AV5B 5AY8D 2CV5D 5F99C 3REHA 4WU8D 4J8WB 3X1TD 3X1VB 3A6ND 3MGSC 1ULYA 1BH8B 5CP6B 5GXQC 2CV5A 4J8XD 2AROB 3KUYC 3X1SD 5JRGD 3REJB 1P3FA 1P3LA 1ZLAC 5B1LA 3MNNC 3MGPB 5B2JD 3WA9B 2F8NG 4LD9B 4KUDD 4YS3C 3W97C 5BT1D 3AV2A 1P34C 3WTPB 5BNVB 3O62D 4KUDA 4ZBJB 3AN2C 2HIOC 1P3PC 1N1JA 1M18B 5CPIA 3REHB 2NZDA 5CPKC 3C1CA 4G91B 3MVDD 4J8VC 1P3ID 1F66A 4XUJC 1P3MA 1P3LB 1S32D 1P3FB 5B1LB 5B32C 3AV2B 3AZHC 3AZKC 4JJND 3WKJD 4KUDB 5B33C 5B40D 3B0DC 5B31B 1N1JB 5AV8C 5CPIB 4Z5TD 4YM6D 4XZQD 1P3KC 1KX3D 2NZDB 5B24C 3AZEA 3C1CB 2L5AA 1F66B 1P3MB 1KX5A 1U35D 2NQBD 4E45A 5DNNA 3UTAD 1P3BA 5GSUC 1U35A 2NQBA 1ID3D 4Z2MG 1EQZA 2JSSA 4Z66A 3KWQC 3LELA 3B6FA 3AZGA 3RELC 3LZ1C 3AZFD 2PYOA 3V9RA 3VH5T 1M1AD 3X1UD 3LZ0A 3REKD 1TZYD 5GT0D 3AZEB 4QLCA 3AZIA 4J8UB 3AZFA 3W99C 3KUYA 3REKA 5CPJD 5CHLB 3AV1C 1P3AC 5DNNB 1KX5B 4EO5C 2F8NK 4WU8C 3A6NC 3W98D 1P3BB 5B2IA 5B1MD 4KHAA 3AFAD 3AN2A 1EQZB 3X1SC 5JRGC 1P3OD 4Z66B 3NQJA 3LELB 3B6FB 5AV5D 3AZGB 5B0ZC 3AFAA 5CPKA 3V9RB 2PYOB 5BT1C 3X1VD 3LZ0B 4J8VA 3B0CW 5CP6D 4QLCB 3AZIB 4WU9A 4ZUXA 3KXBA 3VH6A 2AROD 3O62C 3KUYB 3REJD 1AOIC 3REKB 3MGPD 4H9SA 3WA9D 1BH9A 3REID 4YS3B 4NE3A 4LD9D 3AYWC 4X23A 3B6GD 5B2IB 3WTPD 1P3IC 4H9OA 4R8PC 4NE5A 3REIA 4KHAB 2YFVA 3AN2B 2HIOB 1S32C 3B6GA 3NQJB 4WV4B 5AV8A 3C1BC 1M18D 5E5AC 2RVQC 1P3KA 4HGAC 5DNMA 3AFAB 5CPKB 3REHD 2FJ7C 4J8VB 1M18A 4WU9B 4ZUXB 3KXBB 1JFIB 1P3LD 5C3IC 1P3FD 5B1LD 3VH6W 1BH9B 4YM6C 4XZQC 1KX3C 3WAAC 4X23B 5G49A 3AV2D 2BYKB 1HTAA 4H9OB 3REIB 2YFVB 3B0DB 3KSYA 3W96A 3LZ1A 3MGQC 3AZMC 3B6GB 5AV8B 5B31D 4H9QA 4E44A 5CPID 2YFWA 1P3KB 5DNMB 5B24B 2NZDD 1P3GA 3C1CD 5B31A 3W99A 1M19C 1F66D 2LY8A 1P3AA 1P3MD 3AZNC 2IO5C 3AZLA 5GT0C 5G49B 4Z2MH 5AV9A 5KDMA 4KGCC 3AZJA 4H9PA 1HQ3C 5B0ZA 3LZ1B 3W96B 3MGRA 4H9QB 5GT3C 3W98C 2YFWB 4CAYA 4H9NA 3R45B 3UTBC 5B1MC 5B0YA 1P3GB 3AZED 3W99B 4J8UD 1AOIA 3TU4C 3AV1B 1P3AB 4EO5B 5BNXB 1KX5D 5DNND 4J8UA 3AYWA 4J8WC 1P3BD 3AZLB 4M6BA 4R8PA 5AV9B 3VH5A 5KDMB 3UT9C 1EQZD 3AZJB 4H9PB 4Z66D 3LELD 3B6FD 3MGPC 5B0ZB 3AZGD 5E5AA 1KX4A 3MGRB 2FJ7A 5AVCA 2PYOD 4CAYB 5AVBC 4H9NB 5AV6C 3LZ0D 5B0YB 3LJAC 4QLCD 5F99A 3AZID 3KUYD 4ZBJC 3MGSA 1AOIB 5GXQA 4WZSB 3AYWB 3REHC 4YS3D 3W97D 3WTPE 1ZLAA 4G91C 5B2ID 3MNNA 5AY8C 4NFTA 4R8PB 2CV5C 4YS3A 3W97A 3AN2D 1P34A 3MGQA 3X1TC 2HIOD 3C1BB 1P3FC 5E5AB 4G92B 4HGAB 3VH5W 1KX4B 4J8XC 2FJ7B 5AVCB 5CPKD 3AV2C 2HIOA 1P3PA 4J8VD 4CSRA 5B2JC 5F99B 4WU9D 4ZUXD 3KXBD 4KUDC 3MGSB 5C3IB 3AZNA 5GXQB 5CPIC 4XUJA 1JFIA 1A7WA 4X23D 1ZLAB 3C1CC 4KGCA 3MNNB 2F8NH 3AZKD 5B32A 3W97B 1HQ3A 3MGQB 1P34B 1P3MC 3MVDC 5AV8D 2BYKA 3AZHA 3AZKA 1WWSA 1R4VA 1P3KD 5DNMD 5B33A 5B24D 1P3PB 4CSRB 3TU4A 5B24A 1KU5A 3AZNB 2IO5B 4XUJB 4JJNC 3WKJC 5B40C 2F8NA 3AZEC 4KGCB 3UT9A 5B32B 4Z5TC 3KWQD 1HQ3B 5GSUA 4DRBA 3W96D 3LZ1D 5DNNC 5GT3B 3AZHB 4WNNA 3AZKB 5AVBA 3KWQA 5B33B 3LJAA 3RELA 1P3GD 1U35C 2NQBC 3W99D 1EQZC 3TU4B 3UTAC 4Z66C 3LELC 3B6FC 3R45A 3AZGC 3AV1D 1P3AD 1ID3C 2PYOC 2CWEA 5AY8A 3LZ0C 3AZLD 2F8NB 3AV1A 4QLCC 4AWLC 5BNXA 3AZIC 3AZFC 4WU8A 3UT9B 5AV9D 3X1TA 3A6NA 3X1UC 1M1AC 3AZJD 4DRAA 3REKC 5GSUB 1TZYC 5B0ZD 4J8XA 3MGRD 4WNNB 3X1SA 5AVBB 5JRGA 5AV6B 5B2IC 3KWQB 5CPJC 5B2JA 4H9RA 3LJAB 5B0YD 3RELB 5JA4A 2HUEC 1AOID 1TAFA 3O62A 3AFAC 3AYWD 1P3OC 5AY8B 5AV5C 2CV5B 4R8PD 4WU9C 4ZUXC 4WU8B 3KXBC 5B31G 3X1TB 3A6NB 3MVDA 3X1VC 3C1BD 4H9SC 5CP6C 1P3IA 1H3OA 2RVQD 5E5AD 4J8XB 1KX4D 2AROC 2FJ7D 5AVCD 3X1SB 5JRGB 4X23C 1S32A 3C1BA 3REJC 5B2JB 4H9RB 5JA4B 3WA9C 5F99D 3REIC 1BFMA 4LD9C 3MGSD 3B6GC 1TAFB 3WTPC 5GXQD 4JJNA 3O62B 5DNMC 3WKJA 3WAAD 5B40A 5BO0A 1ZLAD 5BS7C 2BYMA 3MNND 1M18C 4Z5TA 4YM6A 4XZQA 1KX3A 3WAAA 3MVDB 3MGQD 1P34D 3AZMD 1Q9CA 1P3IB 1H3OB 1S32B 3AZMA 1P3LC 1P3PD 3NQUA 5B1LC 5FUGA 1M19D 3UTAA 3W96C 3AZND 1ID3A 1M19A 4JJNB 3WKJB 4XUJD 5B40B 5BO0B 1WWIA 1P3GC 2BYMB 5B31C 4KGCD 1M1AA 4UUZA 3X1UA 4Z5TB 5B32D 4YM6B 3B0BA 4XZQB 1KX3B 1TZYA 3WAAB 5GT0A 1HQ3D 2NZDC 3B0CT 5GT3D 3AZHD 1F66C 5CPJA 5B33D 3UTBD 3AZLC 1U35B 3AZMB 2NQBB 3NQUB 5GT3A 5FUGB 5AV9C 3W98A 3UTAB 3TU4D 3AZJC 3UTBA 5B1MA 1ID3B 3MGRC 1M19B 4J8WD 1P3OA 5AV5A 4NE6A
chains in the Genus database with same CATH superfamily
4AWLB 5B0YC 2F8ND 3AZFB 3UT9D 1M1AB 4UUZB 3X1UB 4J8WA 3X1VA 1TZYB 1BH8A 5GT0B 5GSUD 5CP6A 2ZY5A 2AROA 4J8UC 2G5HC 1B67A 5AVBD 3REJA 5AV6D 5CPJB 3MGPA 3LJAD 1B6WA 3RELD 1KX5C 1F1EA 3WA9A 4LD9A 3VH6T 3W98B 2HUEB 3P5JB 5AV6A 5B32G 3WTPA 1P3BC 3UTBB 5B1MB 5BNVA 4G92C 1KX4C 3EPLA 5AVCC 1P3OB 5BS7A 5AV5B 5AY8D 2CV5D 5F99C 3REHA 4WU8D 4J8WB 3X1TD 3X1VB 3A6ND 3FDDA 3MGSC 1ULYA 1BH8B 5CP6B 5GXQC 2CV5A 4J8XD 2AROB 3KUYC 3X1SD 5JRGD 3REJB 1P3FA 1P3LA 1ZLAC 5B1LA 3MNNC 2DF4C 3MGPB 5B2JD 4DQYB 3WA9B 2F8NG 4LD9B 4KUDD 2JE5A 4YS3C 3W97C 5BT1D 3AV2A 1P34C 3WTPB 5BNVB 3O62D 4KUDA 4ZBJB 3AN2C 2HIOC 1P3PC 1N1JA 1M18B 5CPIA 3REHB 2NZDA 5CPKC 3C1CA 4G91B 3MVDD 4J8VC 3H0RC 1P3ID 1F66A 4XUJC 1P3MA 1P3LB 1S32D 1P3FB 5B1LB 5B32C 3AV2B 3A1KA 3AZHC 3AZKC 4JJND 3WKJD 4KUDB 5B33C 5B40D 3B0DC 5B31B 1N1JB 5AV8C 3EPKA 5CPIB 4Z5TD 4YM6D 4XZQD 1P3KC 1KX3D 2NZDB 5B24C 3AZEA 3C1CB 2L5AA 1F66B 1P3MB 1KX5A 1U35D 2NQBD 4E45A 5DNNA 3UTAD 1P3BA 5GSUC 1U35A 2NQBA 2Y2IA 1ID3D 4Z2MG 1EQZA 3H0LC 2JSSA 4Z66A 3KWQC 3LELA 3B6FA 3AZGA 3RELC 3LZ1C 3AZFD 2PYOA 3V9RA 3VH5T 1M1AD 3X1UD 3LZ0A 3REKD 1TZYD 5GT0D 3AZEB 4QLCA 3AZIA 4J8UB 3AZFA 3W99C 3KUYA 3REKA 5CPJD 2ZY3A 5CHLB 3AV1C 1P3AC 5DNNB 1KX5B 4EO5C 2Y2QA 2F8NK 4WU8C 3A6NC 1W2EA 1P3BB 5B2IA 3W98D 5B1MD 4KHAA 3AFAD 3AN2A 1EQZB 3X1SC 5JRGC 1P3OD 4Z66B 3NQJA 3LELB 2RIQA 3B6FB 5AV5D 3AZGB 2XD5A 5B0ZC 3AFAA 5CPKA 3V9RB 2PYOB 5BT1C 3X1VD 3AL0C 3LZ0B 4J8VA 3B0CW 5CP6D 4QLCB 3AZIB 4WU9A 4ZUXA 3KXBA 3VH6A 2AROD 3O62C 1Z2CB 3KUYB 3REJD 1AOIC 3REKB 3MGPD 4H9SA 3WA9D 1BH9A 3REID 2Y2KA 4YS3B 4NE3A 4LD9D 3AYWC 4X23A 3B6GD 5B2IB 2FFFB 3WTPD 3EG5B 1P3IC 4H9OA 4R8PC 4NE5A 3REIA 4KHAB 2YFVA 3AN2B 2HIOB 1S32C 3B6GA 3NQJB 4WV4B 5AV8A 3C1BC 1M18D 5E5AC 2RVQC 1P3KA 4HGAC 5DNMA 3AFAB 2DQNC 3REHD 5CPKB 2FJ7C 4J8VB 1M18A 4WU9B 4ZUXB 3KXBB 1JFIB 2Y2GA 2Y2LA 1P3LD 5C3IC 1P3FD 5B1LD 3VH6W 1BH9B 4YM6C 4XZQC 1KX3C 3WAAC 4X23B 5G49A 3AV2D 3A1IA 2BYKB 1HTAA 4H9OB 3REIB 2YFVB 3B0DB 3KSYA 3W96A 3LZ1A 3MGQC 3AZMC 3B6GB 5AV8B 5B31D 4H9QA 4E44A 5CPID 2YFWA 2JCHA 5DNMB 1P3KB 5B24B 2NZDD 1P3GA 3C1CD 5B31A 3W99A 1M19C 1F66D 2LY8A 1P3AA 1P3MD 3AZNC 2ZM5A 2IO5C 3AZLA 5GT0C 5G49B 4Z2MH 5AV9A 5KDMA 4KGCC 3KFUG 3F6TA 3AZJA 4H9PA 1HQ3C 5B0ZA 3LZ1B 3W96B 3MGRA 2G5IC 4H9QB 5GT3C 3W98C 2YFWB 4CAYA 4H9NA 3R45B 3UTBC 5B1MC 5B0YA 1P3GB 3AZED 3W99B 4J8UD 1AOIA 3TU4C 3AV1B 1P3AB 4EO5B 5BNXB 1KX5D 5DNND 4J8UA 2Y2JA 3AYWA 4J8WC 1P3BD 3AZLB 4M6BA 4R8PA 5AV9B 3VH5A 5KDMB 3UT9C 1EQZD 3AZJB 4H9PB 4Z66D 3LELD 3B6FD 3MGPC 5B0ZB 3AZGD 5E5AA 1KX4A 3MGRB 2FJ7A 5AVCA 2PYOD 4CAYB 5AVBC 4H9NB 5AV6C 3LZ0D 5B0YB 3LJAC 4QLCD 5F99A 3AZID 3KUYD 4ZBJC 3MGSA 1AOIB 5GXQA 4WZSB 3AYWB 3REHC 4YS3D 3W97D 3WTPE 1ZLAA 4G91C 5B2ID 3MNNA 5AY8C 4NFTA 4R8PB 2CV5C 4YS3A 3W97A 3AN2D 1P34A 3MGQA 3X1TC 2HIOD 3C1BB 1P3FC 5E5AB 4G92B 4HGAB 3VH5W 1KX4B 4J8XC 2FJ7B 5AVCB 5CPKD 3AV2C 2HIOA 1P3PA 4J8VD 4CSRA 5B2JC 5F99B 4WU9D 2Y2HA 4ZUXD 3KXBD 4KUDC 4UPKA 3MGSB 5C3IB 3AZNA 5GXQB 5CPIC 4XUJA 1JFIA 1A7WA 4X23D 1ZLAB 3C1CC 4KGCA 3MNNB 2F8NH 3AZKD 5B32A 3W97B 1HQ3A 3MGQB 1P34B 1P3MC 3MVDC 5AV8D 2BYKA 3AZHA 3AZKA 1WWSA 1R4VA 1P3KD 5DNMD 5B33A 5B24D 1P3PB 4CSRB 3TU4A 5B24A 1KU5A 3AZNB 2IO5B 4XUJB 4JJNC 3WKJC 5B40C 2F8NA 3AZEC 4KGCB 3UT9A 1PZRA 5B32B 4Z5TC 3KWQD 1HQ3B 5GSUA 4DRBA 3W96D 3LZ1D 5DNNC 5GT3B 3AZHB 4WNNA 3AZKB 5AVBA 3KWQA 5B33B 3LJAA 3RELA 1P3GD 1U35C 2NQBC 3W99D 1EQZC 3TU4B 3UTAC 4Z66C 3LELC 3B6FC 3R45A 3AZGC 3AV1D 1P3AD 1ID3C 2PYOC 2CWEA 5AY8A 3LZ0C 3AZLD 2F8NB 3AV1A 4QLCC 4AWLC 5BNXA 3AZIC 3AZFC 2F2AC 4WU8A 3UT9B 5AV9D 3X1TA 3A6NA 3X1UC 1M1AC 3AZJD 4DRAA 3REKC 5GSUB 1TZYC 3H0MC 5B0ZD 2Y2NA 4J8XA 3MGRD 4WNNB 3X1SA 5AVBB 5JRGA 5AV6B 5B2IC 3KWQB 5CPJC 5B2JA 4H9RA 3LJAB 5B0YD 3RELB 5JA4A 2HUEC 1AOID 1TAFA 1T3UA 2W8SA 3O62A 3AFAC 3AYWD 1P3OC 2BG1A 5AY8B 2Y2MA 5AV5C 2CV5B 4R8PD 4WU9C 4ZUXC 4WU8B 3KXBC 5B31G 3X1TB 3A6NB 3MVDA 3X1VC 3C1BD 4H9SC 5CP6C 1P3IA 1H3OA 2RVQD 5E5AD 4J8XB 1KX4D 2AROC 2FJ7D 5AVCD 3X1SB 5JRGB 4X23C 1S32A 3C1BA 3REJC 5B2JB 4H9RB 5JA4B 3WA9C 5F99D 3IP4C 3REIC 1BFMA 4LD9C 3MGSD 3B6GC 1TAFB 3WTPC 2UWXA 5GXQD 4JJNA 3O62B 5DNMC 3WKJA 3WAAD 5B40A 5BO0A 3EPJA 1ZLAD 5BS7C 2BYMA 3EPHA 3MNND 1M18C 4Z5TA 2Y2OA 4YM6A 4XZQA 1KX3A 3WAAA 3MVDB 3MGQD 1P34D 3AZMD 1Q9CA 2Y2PA 1P3IB 2ZY2A 1H3OB 2J8PA 1S32B 3AZMA 1P3LC 1P3PD 3NQUA 5B1LC 5FUGA 1M19D 3UTAA 3W96C 2XD1A 3AZND 1ID3A 4WJ3C 1M19A 4JJNB 2VQRA 3WKJB 4XUJD 5B40B 5BO0B 1WWIA 1P3GC 2BYMB 5B31C 4KGCD 1M1AA 4UUZA 3X1UA 4Z5TB 5B32D 4YM6B 3B0BA 4XZQB 1KX3B 1TZYA 3WAAB 5GT0A 1HQ3D 2NZDC 3B0CT 5GT3D 3AZHD 1F66C 5CPJA 5B33D 3UTBD 3AZLC 1U35B 3AZMB 2NQBB 3NQUB 5GT3A 5FUGB 5AV9C 3W98A 3UTAB 3TU4D 3AZJC 3UTBA 5B1MA 1ID3B 3MGRC 1M19B 4J8WD 1P3OA 2ZY4A 5AV5A 4NE6A
chains in the Genus database with same CATH topology
4AWLB 5B0YC 2F8ND 3AZFB 3UT9D 1M1AB 4UUZB 3X1UB 4J8WA 3X1VA 1TZYB 1BH8A 5GT0B 5GSUD 5CP6A 2ZY5A 2AROA 4J8UC 2G5HC 1B67A 5AVBD 3REJA 5AV6D 5CPJB 3MGPA 3LJAD 1B6WA 3RELD 1KX5C 1F1EA 3WA9A 4LD9A 3VH6T 3W98B 2HUEB 3P5JB 5AV6A 5B32G 3WTPA 1P3BC 3UTBB 5B1MB 5BNVA 4G92C 1KX4C 3EPLA 5AVCC 1P3OB 5BS7A 5AV5B 5AY8D 2CV5D 5F99C 3REHA 4WU8D 4J8WB 3X1TD 3X1VB 3A6ND 3FDDA 3MGSC 1ULYA 1BH8B 5CP6B 5GXQC 2CV5A 4J8XD 2AROB 3KUYC 3X1SD 5JRGD 3REJB 1P3FA 1P3LA 1ZLAC 5B1LA 3MNNC 2DF4C 3MGPB 5B2JD 4DQYB 3WA9B 2F8NG 4LD9B 4KUDD 2JE5A 4YS3C 3W97C 5BT1D 3AV2A 1P34C 3WTPB 5BNVB 3O62D 4KUDA 4ZBJB 3AN2C 2HIOC 1P3PC 1N1JA 1M18B 5CPIA 3REHB 2NZDA 5CPKC 3C1CA 4G91B 3MVDD 4J8VC 3H0RC 1P3ID 1F66A 4XUJC 1P3MA 1P3LB 1S32D 1P3FB 5B1LB 5B32C 3AV2B 3A1KA 3AZHC 3AZKC 4JJND 3WKJD 4KUDB 5B33C 5B40D 3B0DC 5B31B 1N1JB 5AV8C 3EPKA 5CPIB 4Z5TD 4YM6D 4XZQD 1P3KC 1KX3D 2NZDB 5B24C 3AZEA 3C1CB 2L5AA 1F66B 1P3MB 1KX5A 1U35D 2NQBD 4E45A 5DNNA 3UTAD 1P3BA 5GSUC 1U35A 2NQBA 2Y2IA 1ID3D 4Z2MG 1EQZA 3H0LC 2JSSA 4Z66A 3KWQC 3LELA 3B6FA 3AZGA 3RELC 3LZ1C 3AZFD 2PYOA 3V9RA 3VH5T 1M1AD 3X1UD 3LZ0A 3REKD 1TZYD 5GT0D 3AZEB 4QLCA 3AZIA 4J8UB 3AZFA 3W99C 3KUYA 3REKA 5CPJD 2ZY3A 5CHLB 3AV1C 1P3AC 5DNNB 1KX5B 4EO5C 2Y2QA 2F8NK 4WU8C 3A6NC 1W2EA 1P3BB 5B2IA 3W98D 5B1MD 4KHAA 3AFAD 3AN2A 1EQZB 3X1SC 5JRGC 1P3OD 4Z66B 3NQJA 3LELB 2RIQA 3B6FB 5AV5D 3AZGB 2XD5A 5B0ZC 3AFAA 5CPKA 3V9RB 2PYOB 5BT1C 3X1VD 3AL0C 3LZ0B 4J8VA 3B0CW 5CP6D 4QLCB 3AZIB 4WU9A 4ZUXA 3KXBA 3VH6A 2AROD 3O62C 1Z2CB 3KUYB 3REJD 1AOIC 3REKB 3MGPD 4H9SA 3WA9D 1BH9A 3REID 2Y2KA 4YS3B 4NE3A 4LD9D 3AYWC 4X23A 3B6GD 5B2IB 2FFFB 3WTPD 3EG5B 1P3IC 4H9OA 4R8PC 4NE5A 3REIA 4KHAB 2YFVA 3AN2B 2HIOB 1S32C 3B6GA 3NQJB 4WV4B 5AV8A 3C1BC 1M18D 5E5AC 2RVQC 1P3KA 4HGAC 5DNMA 3AFAB 2DQNC 3REHD 5CPKB 2FJ7C 4J8VB 1M18A 4WU9B 4ZUXB 3KXBB 1JFIB 2Y2GA 2Y2LA 1P3LD 5C3IC 1P3FD 5B1LD 3VH6W 1BH9B 4YM6C 4XZQC 1KX3C 3WAAC 4X23B 5G49A 3AV2D 3A1IA 2BYKB 1HTAA 4H9OB 3REIB 2YFVB 3B0DB 3KSYA 3W96A 3LZ1A 3MGQC 3AZMC 3B6GB 5AV8B 5B31D 4H9QA 4E44A 5CPID 2YFWA 2JCHA 5DNMB 1P3KB 5B24B 2NZDD 1P3GA 3C1CD 5B31A 3W99A 1M19C 1F66D 2LY8A 1P3AA 1P3MD 3AZNC 2ZM5A 2IO5C 3AZLA 5GT0C 5G49B 4Z2MH 5AV9A 5KDMA 4KGCC 3KFUG 3F6TA 3AZJA 4H9PA 1HQ3C 5B0ZA 3LZ1B 3W96B 3MGRA 2G5IC 4H9QB 5GT3C 3W98C 2YFWB 4CAYA 4H9NA 3R45B 3UTBC 5B1MC 5B0YA 1P3GB 3AZED 3W99B 4J8UD 1AOIA 3TU4C 3AV1B 1P3AB 4EO5B 5BNXB 1KX5D 5DNND 4J8UA 2Y2JA 3AYWA 4J8WC 1P3BD 3AZLB 4M6BA 4R8PA 5AV9B 3VH5A 5KDMB 3UT9C 1EQZD 3AZJB 4H9PB 4Z66D 3LELD 3B6FD 3MGPC 5B0ZB 3AZGD 5E5AA 1KX4A 3MGRB 2FJ7A 5AVCA 2PYOD 4CAYB 5AVBC 4H9NB 5AV6C 3LZ0D 5B0YB 3LJAC 4QLCD 5F99A 3AZID 3KUYD 4ZBJC 3MGSA 1AOIB 5GXQA 4WZSB 3AYWB 3REHC 4YS3D 3W97D 3WTPE 1ZLAA 4G91C 5B2ID 3MNNA 5AY8C 4NFTA 4R8PB 2CV5C 4YS3A 3W97A 3AN2D 1P34A 3MGQA 3X1TC 2HIOD 3C1BB 1P3FC 5E5AB 4G92B 4HGAB 3VH5W 1KX4B 4J8XC 2FJ7B 5AVCB 5CPKD 3AV2C 2HIOA 1P3PA 4J8VD 4CSRA 5B2JC 5F99B 4WU9D 2Y2HA 4ZUXD 3KXBD 4KUDC 4UPKA 3MGSB 5C3IB 3AZNA 5GXQB 5CPIC 4XUJA 1JFIA 1A7WA 4X23D 1ZLAB 3C1CC 4KGCA 3MNNB 2F8NH 3AZKD 5B32A 3W97B 1HQ3A 3MGQB 1P34B 1P3MC 3MVDC 5AV8D 2BYKA 3AZHA 3AZKA 1WWSA 1R4VA 1P3KD 5DNMD 5B33A 5B24D 1P3PB 4CSRB 3TU4A 5B24A 1KU5A 3AZNB 2IO5B 4XUJB 4JJNC 3WKJC 5B40C 2F8NA 3AZEC 4KGCB 3UT9A 1PZRA 5B32B 4Z5TC 3KWQD 1HQ3B 5GSUA 4DRBA 3W96D 3LZ1D 5DNNC 5GT3B 3AZHB 4WNNA 3AZKB 5AVBA 3KWQA 5B33B 3LJAA 3RELA 1P3GD 1U35C 2NQBC 3W99D 1EQZC 3TU4B 3UTAC 4Z66C 3LELC 3B6FC 3R45A 3AZGC 3AV1D 1P3AD 1ID3C 2PYOC 2CWEA 5AY8A 3LZ0C 3AZLD 2F8NB 3AV1A 4QLCC 4AWLC 5BNXA 3AZIC 3AZFC 2F2AC 4WU8A 3UT9B 5AV9D 3X1TA 3A6NA 3X1UC 1M1AC 3AZJD 4DRAA 3REKC 5GSUB 1TZYC 3H0MC 5B0ZD 2Y2NA 4J8XA 3MGRD 4WNNB 3X1SA 5AVBB 5JRGA 5AV6B 5B2IC 3KWQB 5CPJC 5B2JA 4H9RA 3LJAB 5B0YD 3RELB 5JA4A 2HUEC 1AOID 1TAFA 1T3UA 2W8SA 3O62A 3AFAC 3AYWD 1P3OC 2BG1A 5AY8B 2Y2MA 5AV5C 2CV5B 4R8PD 4WU9C 4ZUXC 4WU8B 3KXBC 5B31G 3X1TB 3A6NB 3MVDA 3X1VC 3C1BD 4H9SC 5CP6C 1P3IA 1H3OA 2RVQD 5E5AD 4J8XB 1KX4D 2AROC 2FJ7D 5AVCD 3X1SB 5JRGB 4X23C 1S32A 3C1BA 3REJC 5B2JB 4H9RB 5JA4B 3WA9C 5F99D 3IP4C 3REIC 1BFMA 4LD9C 3MGSD 3B6GC 1TAFB 3WTPC 2UWXA 5GXQD 4JJNA 3O62B 5DNMC 3WKJA 3WAAD 5B40A 5BO0A 3EPJA 1ZLAD 5BS7C 2BYMA 3EPHA 3MNND 1M18C 4Z5TA 2Y2OA 4YM6A 4XZQA 1KX3A 3WAAA 3MVDB 3MGQD 1P34D 3AZMD 1Q9CA 2Y2PA 1P3IB 2ZY2A 1H3OB 2J8PA 1S32B 3AZMA 1P3LC 1P3PD 3NQUA 5B1LC 5FUGA 1M19D 3UTAA 3W96C 2XD1A 3AZND 1ID3A 4WJ3C 1M19A 4JJNB 2VQRA 3WKJB 4XUJD 5B40B 5BO0B 1WWIA 1P3GC 2BYMB 5B31C 4KGCD 1M1AA 4UUZA 3X1UA 4Z5TB 5B32D 4YM6B 3B0BA 4XZQB 1KX3B 1TZYA 3WAAB 5GT0A 1HQ3D 2NZDC 3B0CT 5GT3D 3AZHD 1F66C 5CPJA 5B33D 3UTBD 3AZLC 1U35B 3AZMB 2NQBB 3NQUB 5GT3A 5FUGB 5AV9C 3W98A 3UTAB 3TU4D 3AZJC 3UTBA 5B1MA 1ID3B 3MGRC 1M19B 4J8WD 1P3OA 2ZY4A 5AV5A 4NE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWL B;  5B0Y C;  2F8N D;  3AZF B;  3UT9 D;  1M1A B;  4UUZ B;  3X1U B;  4J8W A;  3X1V A;  1TZY B;  1BH8 A;  5GT0 B;  5GSU D;  5CP6 A;  2ARO A;  4J8U C;  1B67 A;  5AVB D;  3REJ A;  5AV6 D;  5CPJ B;  3MGP A;  3LJA D;  1B6W A;  3REL D;  1KX5 C;  1F1E A;  3WA9 A;  4LD9 A;  3VH6 T;  3W98 B;  2HUE B;  5AV6 A;  5B32 G;  3WTP A;  1P3B C;  3UTB B;  5B1M B;  5BNV A;  4G92 C;  1KX4 C;  5AVC C;  1P3O B;  5BS7 A;  5AV5 B;  5AY8 D;  2CV5 D;  5F99 C;  3REH A;  4WU8 D;  4J8W B;  3X1T D;  3X1V B;  3A6N D;  3MGS C;  1ULY A;  1BH8 B;  5CP6 B;  5GXQ C;  2CV5 A;  4J8X D;  2ARO B;  3KUY C;  3X1S D;  5JRG D;  3REJ B;  1P3F A;  1P3L A;  1ZLA C;  5B1L A;  3MNN C;  3MGP B;  5B2J D;  3WA9 B;  2F8N G;  4LD9 B;  4KUD D;  4YS3 C;  3W97 C;  5BT1 D;  3AV2 A;  1P34 C;  3WTP B;  5BNV B;  3O62 D;  4KUD A;  4ZBJ B;  3AN2 C;  2HIO C;  1P3P C;  1N1J A;  1M18 B;  5CPI A;  3REH B;  2NZD A;  5CPK C;  3C1C A;  4G91 B;  3MVD D;  4J8V C;  1P3I D;  1F66 A;  4XUJ C;  1P3M A;  1P3L B;  1S32 D;  1P3F B;  5B1L B;  5B32 C;  3AV2 B;  3AZH C;  3AZK C;  4JJN D;  3WKJ D;  4KUD B;  5B33 C;  5B40 D;  3B0D C;  5B31 B;  1N1J B;  5AV8 C;  5CPI B;  4Z5T D;  4YM6 D;  4XZQ D;  1P3K C;  1KX3 D;  2NZD B;  5B24 C;  3AZE A;  3C1C B;  2L5A A;  1F66 B;  1P3M B;  1KX5 A;  1U35 D;  2NQB D;  4E45 A;  5DNN A;  3UTA D;  1P3B A;  5GSU C;  1U35 A;  2NQB A;  1ID3 D;  4Z2M G;  1EQZ A;  2JSS A;  4Z66 A;  3KWQ C;  3LEL A;  3B6F A;  3AZG A;  3REL C;  3LZ1 C;  3AZF D;  2PYO A;  3V9R A;  3VH5 T;  1M1A D;  3X1U D;  3LZ0 A;  3REK D;  1TZY D;  5GT0 D;  3AZE B;  4QLC A;  3AZI A;  4J8U B;  3AZF A;  3W99 C;  3KUY A;  3REK A;  5CPJ D;  5CHL B;  3AV1 C;  1P3A C;  5DNN B;  1KX5 B;  4EO5 C;  2F8N K;  4WU8 C;  3A6N C;  3W98 D;  1P3B B;  5B2I A;  5B1M D;  4KHA A;  3AFA D;  3AN2 A;  1EQZ B;  3X1S C;  5JRG C;  1P3O D;  4Z66 B;  3NQJ A;  3LEL B;  3B6F B;  5AV5 D;  3AZG B;  5B0Z C;  3AFA A;  5CPK A;  3V9R B;  2PYO B;  5BT1 C;  3X1V D;  3LZ0 B;  4J8V A;  3B0C W;  5CP6 D;  4QLC B;  3AZI B;  4WU9 A;  4ZUX A;  3KXB A;  3VH6 A;  2ARO D;  3O62 C;  3KUY B;  3REJ D;  1AOI C;  3REK B;  3MGP D;  4H9S A;  3WA9 D;  1BH9 A;  3REI D;  4YS3 B;  4NE3 A;  4LD9 D;  3AYW C;  4X23 A;  3B6G D;  5B2I B;  3WTP D;  1P3I C;  4H9O A;  4R8P C;  4NE5 A;  3REI A;  4KHA B;  2YFV A;  3AN2 B;  2HIO B;  1S32 C;  3B6G A;  3NQJ B;  4WV4 B;  5AV8 A;  3C1B C;  1M18 D;  5E5A C;  2RVQ C;  1P3K A;  4HGA C;  5DNM A;  3AFA B;  5CPK B;  3REH D;  2FJ7 C;  4J8V B;  1M18 A;  4WU9 B;  4ZUX B;  3KXB B;  1JFI B;  1P3L D;  5C3I C;  1P3F D;  5B1L D;  3VH6 W;  1BH9 B;  4YM6 C;  4XZQ C;  1KX3 C;  3WAA C;  4X23 B;  5G49 A;  3AV2 D;  2BYK B;  1HTA A;  4H9O B;  3REI B;  2YFV B;  3B0D B;  3KSY A;  3W96 A;  3LZ1 A;  3MGQ C;  3AZM C;  3B6G B;  5AV8 B;  5B31 D;  4H9Q A;  4E44 A;  5CPI D;  2YFW A;  1P3K B;  5DNM B;  5B24 B;  2NZD D;  1P3G A;  3C1C D;  5B31 A;  3W99 A;  1M19 C;  1F66 D;  2LY8 A;  1P3A A;  1P3M D;  3AZN C;  2IO5 C;  3AZL A;  5GT0 C;  5G49 B;  4Z2M H;  5AV9 A;  5KDM A;  4KGC C;  3AZJ A;  4H9P A;  1HQ3 C;  5B0Z A;  3LZ1 B;  3W96 B;  3MGR A;  4H9Q B;  5GT3 C;  3W98 C;  2YFW B;  4CAY A;  4H9N A;  3R45 B;  3UTB C;  5B1M C;  5B0Y A;  1P3G B;  3AZE D;  3W99 B;  4J8U D;  1AOI A;  3TU4 C;  3AV1 B;  1P3A B;  4EO5 B;  5BNX B;  1KX5 D;  5DNN D;  4J8U A;  3AYW A;  4J8W C;  1P3B D;  3AZL B;  4M6B A;  4R8P A;  5AV9 B;  3VH5 A;  5KDM B;  3UT9 C;  1EQZ D;  3AZJ B;  4H9P B;  4Z66 D;  3LEL D;  3B6F D;  3MGP C;  5B0Z B;  3AZG D;  5E5A A;  1KX4 A;  3MGR B;  2FJ7 A;  5AVC A;  2PYO D;  4CAY B;  5AVB C;  4H9N B;  5AV6 C;  3LZ0 D;  5B0Y B;  3LJA C;  4QLC D;  5F99 A;  3AZI D;  3KUY D;  4ZBJ C;  3MGS A;  1AOI B;  5GXQ A;  4WZS B;  3AYW B;  3REH C;  4YS3 D;  3W97 D;  3WTP E;  1ZLA A;  4G91 C;  5B2I D;  3MNN A;  5AY8 C;  4NFT A;  4R8P B;  2CV5 C;  4YS3 A;  3W97 A;  3AN2 D;  1P34 A;  3MGQ A;  3X1T C;  2HIO D;  3C1B B;  1P3F C;  5E5A B;  4G92 B;  4HGA B;  3VH5 W;  1KX4 B;  4J8X C;  2FJ7 B;  5AVC B;  5CPK D;  3AV2 C;  2HIO A;  1P3P A;  4J8V D;  4CSR A;  5B2J C;  5F99 B;  4WU9 D;  4ZUX D;  3KXB D;  4KUD C;  3MGS B;  5C3I B;  3AZN A;  5GXQ B;  5CPI C;  4XUJ A;  1JFI A;  1A7W A;  4X23 D;  1ZLA B;  3C1C C;  4KGC A;  3MNN B;  2F8N H;  3AZK D;  5B32 A;  3W97 B;  1HQ3 A;  3MGQ B;  1P34 B;  1P3M C;  3MVD C;  5AV8 D;  2BYK A;  3AZH A;  3AZK A;  1WWS A;  1R4V A;  1P3K D;  5DNM D;  5B33 A;  5B24 D;  1P3P B;  4CSR B;  3TU4 A;  5B24 A;  1KU5 A;  3AZN B;  2IO5 B;  4XUJ B;  4JJN C;  3WKJ C;  5B40 C;  2F8N A;  3AZE C;  4KGC B;  3UT9 A;  5B32 B;  4Z5T C;  3KWQ D;  1HQ3 B;  5GSU A;  4DRB A;  3W96 D;  3LZ1 D;  5DNN C;  5GT3 B;  3AZH B;  4WNN A;  3AZK B;  5AVB A;  3KWQ A;  5B33 B;  3LJA A;  3REL A;  1P3G D;  1U35 C;  2NQB C;  3W99 D;  1EQZ C;  3TU4 B;  3UTA C;  4Z66 C;  3LEL C;  3B6F C;  3R45 A;  3AZG C;  3AV1 D;  1P3A D;  1ID3 C;  2PYO C;  2CWE A;  5AY8 A;  3LZ0 C;  3AZL D;  2F8N B;  3AV1 A;  4QLC C;  4AWL C;  5BNX A;  3AZI C;  3AZF C;  4WU8 A;  3UT9 B;  5AV9 D;  3X1T A;  3A6N A;  3X1U C;  1M1A C;  3AZJ D;  4DRA A;  3REK C;  5GSU B;  1TZY C;  5B0Z D;  4J8X A;  3MGR D;  4WNN B;  3X1S A;  5AVB B;  5JRG A;  5AV6 B;  5B2I C;  3KWQ B;  5CPJ C;  5B2J A;  4H9R A;  3LJA B;  5B0Y D;  3REL B;  5JA4 A;  2HUE C;  1AOI D;  1TAF A;  3O62 A;  3AFA C;  3AYW D;  1P3O C;  5AY8 B;  5AV5 C;  2CV5 B;  4R8P D;  4WU9 C;  4ZUX C;  4WU8 B;  3KXB C;  5B31 G;  3X1T B;  3A6N B;  3MVD A;  3X1V C;  3C1B D;  4H9S C;  5CP6 C;  1P3I A;  1H3O A;  2RVQ D;  5E5A D;  4J8X B;  1KX4 D;  2ARO C;  2FJ7 D;  5AVC D;  3X1S B;  5JRG B;  4X23 C;  1S32 A;  3C1B A;  3REJ C;  5B2J B;  4H9R B;  5JA4 B;  3WA9 C;  5F99 D;  3REI C;  1BFM A;  4LD9 C;  3MGS D;  3B6G C;  1TAF B;  3WTP C;  5GXQ D;  4JJN A;  3O62 B;  5DNM C;  3WKJ A;  3WAA D;  5B40 A;  5BO0 A;  1ZLA D;  5BS7 C;  2BYM A;  3MNN D;  1M18 C;  4Z5T A;  4YM6 A;  4XZQ A;  1KX3 A;  3WAA A;  3MVD B;  3MGQ D;  1P34 D;  3AZM D;  1Q9C A;  1P3I B;  1H3O B;  1S32 B;  3AZM A;  1P3L C;  1P3P D;  3NQU A;  5B1L C;  5FUG A;  1M19 D;  3UTA A;  3W96 C;  3AZN D;  1ID3 A;  1M19 A;  4JJN B;  3WKJ B;  4XUJ D;  5B40 B;  5BO0 B;  1WWI A;  1P3G C;  2BYM B;  5B31 C;  4KGC D;  1M1A A;  4UUZ A;  3X1U A;  4Z5T B;  5B32 D;  4YM6 B;  3B0B A;  4XZQ B;  1KX3 B;  1TZY A;  3WAA B;  5GT0 A;  1HQ3 D;  2NZD C;  3B0C T;  5GT3 D;  3AZH D;  1F66 C;  5CPJ A;  5B33 D;  3UTB D;  3AZL C;  1U35 B;  3AZM B;  2NQB B;  3NQU B;  5GT3 A;  5FUG B;  5AV9 C;  3W98 A;  3UTA B;  3TU4 D;  3AZJ C;  3UTB A;  5B1M A;  1ID3 B;  3MGR C;  1M19 B;  4J8W D;  1P3O A;  5AV5 A;  4NE6 A; 
#chains in the Genus database with same CATH topology
 4AWL B;  5B0Y C;  2F8N D;  3AZF B;  3UT9 D;  1M1A B;  4UUZ B;  3X1U B;  4J8W A;  3X1V A;  1TZY B;  1BH8 A;  5GT0 B;  5GSU D;  5CP6 A;  2ZY5 A;  2ARO A;  4J8U C;  2G5H C;  1B67 A;  5AVB D;  3REJ A;  5AV6 D;  5CPJ B;  3MGP A;  3LJA D;  1B6W A;  3REL D;  1KX5 C;  1F1E A;  3WA9 A;  4LD9 A;  3VH6 T;  3W98 B;  2HUE B;  3P5J B;  5AV6 A;  5B32 G;  3WTP A;  1P3B C;  3UTB B;  5B1M B;  5BNV A;  4G92 C;  1KX4 C;  3EPL A;  5AVC C;  1P3O B;  5BS7 A;  5AV5 B;  5AY8 D;  2CV5 D;  5F99 C;  3REH A;  4WU8 D;  4J8W B;  3X1T D;  3X1V B;  3A6N D;  3FDD A;  3MGS C;  1ULY A;  1BH8 B;  5CP6 B;  5GXQ C;  2CV5 A;  4J8X D;  2ARO B;  3KUY C;  3X1S D;  5JRG D;  3REJ B;  1P3F A;  1P3L A;  1ZLA C;  5B1L A;  3MNN C;  2DF4 C;  3MGP B;  5B2J D;  4DQY B;  3WA9 B;  2F8N G;  4LD9 B;  4KUD D;  2JE5 A;  4YS3 C;  3W97 C;  5BT1 D;  3AV2 A;  1P34 C;  3WTP B;  5BNV B;  3O62 D;  4KUD A;  4ZBJ B;  3AN2 C;  2HIO C;  1P3P C;  1N1J A;  1M18 B;  5CPI A;  3REH B;  2NZD A;  5CPK C;  3C1C A;  4G91 B;  3MVD D;  4J8V C;  3H0R C;  1P3I D;  1F66 A;  4XUJ C;  1P3M A;  1P3L B;  1S32 D;  1P3F B;  5B1L B;  5B32 C;  3AV2 B;  3A1K A;  3AZH C;  3AZK C;  4JJN D;  3WKJ D;  4KUD B;  5B33 C;  5B40 D;  3B0D C;  5B31 B;  1N1J B;  5AV8 C;  3EPK A;  5CPI B;  4Z5T D;  4YM6 D;  4XZQ D;  1P3K C;  1KX3 D;  2NZD B;  5B24 C;  3AZE A;  3C1C B;  2L5A A;  1F66 B;  1P3M B;  1KX5 A;  1U35 D;  2NQB D;  4E45 A;  5DNN A;  3UTA D;  1P3B A;  5GSU C;  1U35 A;  2NQB A;  2Y2I A;  1ID3 D;  4Z2M G;  1EQZ A;  3H0L C;  2JSS A;  4Z66 A;  3KWQ C;  3LEL A;  3B6F A;  3AZG A;  3REL C;  3LZ1 C;  3AZF D;  2PYO A;  3V9R A;  3VH5 T;  1M1A D;  3X1U D;  3LZ0 A;  3REK D;  1TZY D;  5GT0 D;  3AZE B;  4QLC A;  3AZI A;  4J8U B;  3AZF A;  3W99 C;  3KUY A;  3REK A;  5CPJ D;  2ZY3 A;  5CHL B;  3AV1 C;  1P3A C;  5DNN B;  1KX5 B;  4EO5 C;  2Y2Q A;  2F8N K;  4WU8 C;  3A6N C;  1W2E A;  1P3B B;  5B2I A;  3W98 D;  5B1M D;  4KHA A;  3AFA D;  3AN2 A;  1EQZ B;  3X1S C;  5JRG C;  1P3O D;  4Z66 B;  3NQJ A;  3LEL B;  2RIQ A;  3B6F B;  5AV5 D;  3AZG B;  2XD5 A;  5B0Z C;  3AFA A;  5CPK A;  3V9R B;  2PYO B;  5BT1 C;  3X1V D;  3AL0 C;  3LZ0 B;  4J8V A;  3B0C W;  5CP6 D;  4QLC B;  3AZI B;  4WU9 A;  4ZUX A;  3KXB A;  3VH6 A;  2ARO D;  3O62 C;  1Z2C B;  3KUY B;  3REJ D;  1AOI C;  3REK B;  3MGP D;  4H9S A;  3WA9 D;  1BH9 A;  3REI D;  2Y2K A;  4YS3 B;  4NE3 A;  4LD9 D;  3AYW C;  4X23 A;  3B6G D;  5B2I B;  2FFF B;  3WTP D;  3EG5 B;  1P3I C;  4H9O A;  4R8P C;  4NE5 A;  3REI A;  4KHA B;  2YFV A;  3AN2 B;  2HIO B;  1S32 C;  3B6G A;  3NQJ B;  4WV4 B;  5AV8 A;  3C1B C;  1M18 D;  5E5A C;  2RVQ C;  1P3K A;  4HGA C;  5DNM A;  3AFA B;  2DQN C;  3REH D;  5CPK B;  2FJ7 C;  4J8V B;  1M18 A;  4WU9 B;  4ZUX B;  3KXB B;  1JFI B;  2Y2G A;  2Y2L A;  1P3L D;  5C3I C;  1P3F D;  5B1L D;  3VH6 W;  1BH9 B;  4YM6 C;  4XZQ C;  1KX3 C;  3WAA C;  4X23 B;  5G49 A;  3AV2 D;  3A1I A;  2BYK B;  1HTA A;  4H9O B;  3REI B;  2YFV B;  3B0D B;  3KSY A;  3W96 A;  3LZ1 A;  3MGQ C;  3AZM C;  3B6G B;  5AV8 B;  5B31 D;  4H9Q A;  4E44 A;  5CPI D;  2YFW A;  2JCH A;  5DNM B;  1P3K B;  5B24 B;  2NZD D;  1P3G A;  3C1C D;  5B31 A;  3W99 A;  1M19 C;  1F66 D;  2LY8 A;  1P3A A;  1P3M D;  3AZN C;  2ZM5 A;  2IO5 C;  3AZL A;  5GT0 C;  5G49 B;  4Z2M H;  5AV9 A;  5KDM A;  4KGC C;  3KFU G;  3F6T A;  3AZJ A;  4H9P A;  1HQ3 C;  5B0Z A;  3LZ1 B;  3W96 B;  3MGR A;  2G5I C;  4H9Q B;  5GT3 C;  3W98 C;  2YFW B;  4CAY A;  4H9N A;  3R45 B;  3UTB C;  5B1M C;  5B0Y A;  1P3G B;  3AZE D;  3W99 B;  4J8U D;  1AOI A;  3TU4 C;  3AV1 B;  1P3A B;  4EO5 B;  5BNX B;  1KX5 D;  5DNN D;  4J8U A;  2Y2J A;  3AYW A;  4J8W C;  1P3B D;  3AZL B;  4M6B A;  4R8P A;  5AV9 B;  3VH5 A;  5KDM B;  3UT9 C;  1EQZ D;  3AZJ B;  4H9P B;  4Z66 D;  3LEL D;  3B6F D;  3MGP C;  5B0Z B;  3AZG D;  5E5A A;  1KX4 A;  3MGR B;  2FJ7 A;  5AVC A;  2PYO D;  4CAY B;  5AVB C;  4H9N B;  5AV6 C;  3LZ0 D;  5B0Y B;  3LJA C;  4QLC D;  5F99 A;  3AZI D;  3KUY D;  4ZBJ C;  3MGS A;  1AOI B;  5GXQ A;  4WZS B;  3AYW B;  3REH C;  4YS3 D;  3W97 D;  3WTP E;  1ZLA A;  4G91 C;  5B2I D;  3MNN A;  5AY8 C;  4NFT A;  4R8P B;  2CV5 C;  4YS3 A;  3W97 A;  3AN2 D;  1P34 A;  3MGQ A;  3X1T C;  2HIO D;  3C1B B;  1P3F C;  5E5A B;  4G92 B;  4HGA B;  3VH5 W;  1KX4 B;  4J8X C;  2FJ7 B;  5AVC B;  5CPK D;  3AV2 C;  2HIO A;  1P3P A;  4J8V D;  4CSR A;  5B2J C;  5F99 B;  4WU9 D;  2Y2H A;  4ZUX D;  3KXB D;  4KUD C;  4UPK A;  3MGS B;  5C3I B;  3AZN A;  5GXQ B;  5CPI C;  4XUJ A;  1JFI A;  1A7W A;  4X23 D;  1ZLA B;  3C1C C;  4KGC A;  3MNN B;  2F8N H;  3AZK D;  5B32 A;  3W97 B;  1HQ3 A;  3MGQ B;  1P34 B;  1P3M C;  3MVD C;  5AV8 D;  2BYK A;  3AZH A;  3AZK A;  1WWS A;  1R4V A;  1P3K D;  5DNM D;  5B33 A;  5B24 D;  1P3P B;  4CSR B;  3TU4 A;  5B24 A;  1KU5 A;  3AZN B;  2IO5 B;  4XUJ B;  4JJN C;  3WKJ C;  5B40 C;  2F8N A;  3AZE C;  4KGC B;  3UT9 A;  1PZR A;  5B32 B;  4Z5T C;  3KWQ D;  1HQ3 B;  5GSU A;  4DRB A;  3W96 D;  3LZ1 D;  5DNN C;  5GT3 B;  3AZH B;  4WNN A;  3AZK B;  5AVB A;  3KWQ A;  5B33 B;  3LJA A;  3REL A;  1P3G D;  1U35 C;  2NQB C;  3W99 D;  1EQZ C;  3TU4 B;  3UTA C;  4Z66 C;  3LEL C;  3B6F C;  3R45 A;  3AZG C;  3AV1 D;  1P3A D;  1ID3 C;  2PYO C;  2CWE A;  5AY8 A;  3LZ0 C;  3AZL D;  2F8N B;  3AV1 A;  4QLC C;  4AWL C;  5BNX A;  3AZI C;  3AZF C;  2F2A C;  4WU8 A;  3UT9 B;  5AV9 D;  3X1T A;  3A6N A;  3X1U C;  1M1A C;  3AZJ D;  4DRA A;  3REK C;  5GSU B;  1TZY C;  3H0M C;  5B0Z D;  2Y2N A;  4J8X A;  3MGR D;  4WNN B;  3X1S A;  5AVB B;  5JRG A;  5AV6 B;  5B2I C;  3KWQ B;  5CPJ C;  5B2J A;  4H9R A;  3LJA B;  5B0Y D;  3REL B;  5JA4 A;  2HUE C;  1AOI D;  1TAF A;  1T3U A;  2W8S A;  3O62 A;  3AFA C;  3AYW D;  1P3O C;  2BG1 A;  5AY8 B;  2Y2M A;  5AV5 C;  2CV5 B;  4R8P D;  4WU9 C;  4ZUX C;  4WU8 B;  3KXB C;  5B31 G;  3X1T B;  3A6N B;  3MVD A;  3X1V C;  3C1B D;  4H9S C;  5CP6 C;  1P3I A;  1H3O A;  2RVQ D;  5E5A D;  4J8X B;  1KX4 D;  2ARO C;  2FJ7 D;  5AVC D;  3X1S B;  5JRG B;  4X23 C;  1S32 A;  3C1B A;  3REJ C;  5B2J B;  4H9R B;  5JA4 B;  3WA9 C;  5F99 D;  3IP4 C;  3REI C;  1BFM A;  4LD9 C;  3MGS D;  3B6G C;  1TAF B;  3WTP C;  2UWX A;  5GXQ D;  4JJN A;  3O62 B;  5DNM C;  3WKJ A;  3WAA D;  5B40 A;  5BO0 A;  3EPJ A;  1ZLA D;  5BS7 C;  2BYM A;  3EPH A;  3MNN D;  1M18 C;  4Z5T A;  2Y2O A;  4YM6 A;  4XZQ A;  1KX3 A;  3WAA A;  3MVD B;  3MGQ D;  1P34 D;  3AZM D;  1Q9C A;  2Y2P A;  1P3I B;  2ZY2 A;  1H3O B;  2J8P A;  1S32 B;  3AZM A;  1P3L C;  1P3P D;  3NQU A;  5B1L C;  5FUG A;  1M19 D;  3UTA A;  3W96 C;  2XD1 A;  3AZN D;  1ID3 A;  4WJ3 C;  1M19 A;  4JJN B;  2VQR A;  3WKJ B;  4XUJ D;  5B40 B;  5BO0 B;  1WWI A;  1P3G C;  2BYM B;  5B31 C;  4KGC D;  1M1A A;  4UUZ A;  3X1U A;  4Z5T B;  5B32 D;  4YM6 B;  3B0B A;  4XZQ B;  1KX3 B;  1TZY A;  3WAA B;  5GT0 A;  1HQ3 D;  2NZD C;  3B0C T;  5GT3 D;  3AZH D;  1F66 C;  5CPJ A;  5B33 D;  3UTB D;  3AZL C;  1U35 B;  3AZM B;  2NQB B;  3NQU B;  5GT3 A;  5FUG B;  5AV9 C;  3W98 A;  3UTA B;  3TU4 D;  3AZJ C;  3UTB A;  5B1M A;  1ID3 B;  3MGR C;  1M19 B;  4J8W D;  1P3O A;  2ZY4 A;  5AV5 A;  4NE6 A; 
#chains in the Genus database with same CATH homology
 4AWL B;  5B0Y C;  2F8N D;  3AZF B;  3UT9 D;  1M1A B;  4UUZ B;  3X1U B;  4J8W A;  3X1V A;  1TZY B;  1BH8 A;  5GT0 B;  5GSU D;  5CP6 A;  2ZY5 A;  2ARO A;  4J8U C;  2G5H C;  1B67 A;  5AVB D;  3REJ A;  5AV6 D;  5CPJ B;  3MGP A;  3LJA D;  1B6W A;  3REL D;  1KX5 C;  1F1E A;  3WA9 A;  4LD9 A;  3VH6 T;  3W98 B;  2HUE B;  3P5J B;  5AV6 A;  5B32 G;  3WTP A;  1P3B C;  3UTB B;  5B1M B;  5BNV A;  4G92 C;  1KX4 C;  3EPL A;  5AVC C;  1P3O B;  5BS7 A;  5AV5 B;  5AY8 D;  2CV5 D;  5F99 C;  3REH A;  4WU8 D;  4J8W B;  3X1T D;  3X1V B;  3A6N D;  3FDD A;  3MGS C;  1ULY A;  1BH8 B;  5CP6 B;  5GXQ C;  2CV5 A;  4J8X D;  2ARO B;  3KUY C;  3X1S D;  5JRG D;  3REJ B;  1P3F A;  1P3L A;  1ZLA C;  5B1L A;  3MNN C;  2DF4 C;  3MGP B;  5B2J D;  4DQY B;  3WA9 B;  2F8N G;  4LD9 B;  4KUD D;  2JE5 A;  4YS3 C;  3W97 C;  5BT1 D;  3AV2 A;  1P34 C;  3WTP B;  5BNV B;  3O62 D;  4KUD A;  4ZBJ B;  3AN2 C;  2HIO C;  1P3P C;  1N1J A;  1M18 B;  5CPI A;  3REH B;  2NZD A;  5CPK C;  3C1C A;  4G91 B;  3MVD D;  4J8V C;  3H0R C;  1P3I D;  1F66 A;  4XUJ C;  1P3M A;  1P3L B;  1S32 D;  1P3F B;  5B1L B;  5B32 C;  3AV2 B;  3A1K A;  3AZH C;  3AZK C;  4JJN D;  3WKJ D;  4KUD B;  5B33 C;  5B40 D;  3B0D C;  5B31 B;  1N1J B;  5AV8 C;  3EPK A;  5CPI B;  4Z5T D;  4YM6 D;  4XZQ D;  1P3K C;  1KX3 D;  2NZD B;  5B24 C;  3AZE A;  3C1C B;  2L5A A;  1F66 B;  1P3M B;  1KX5 A;  1U35 D;  2NQB D;  4E45 A;  5DNN A;  3UTA D;  1P3B A;  5GSU C;  1U35 A;  2NQB A;  2Y2I A;  1ID3 D;  4Z2M G;  1EQZ A;  3H0L C;  2JSS A;  4Z66 A;  3KWQ C;  3LEL A;  3B6F A;  3AZG A;  3REL C;  3LZ1 C;  3AZF D;  2PYO A;  3V9R A;  3VH5 T;  1M1A D;  3X1U D;  3LZ0 A;  3REK D;  1TZY D;  5GT0 D;  3AZE B;  4QLC A;  3AZI A;  4J8U B;  3AZF A;  3W99 C;  3KUY A;  3REK A;  5CPJ D;  2ZY3 A;  5CHL B;  3AV1 C;  1P3A C;  5DNN B;  1KX5 B;  4EO5 C;  2Y2Q A;  2F8N K;  4WU8 C;  3A6N C;  1W2E A;  1P3B B;  5B2I A;  3W98 D;  5B1M D;  4KHA A;  3AFA D;  3AN2 A;  1EQZ B;  3X1S C;  5JRG C;  1P3O D;  4Z66 B;  3NQJ A;  3LEL B;  2RIQ A;  3B6F B;  5AV5 D;  3AZG B;  2XD5 A;  5B0Z C;  3AFA A;  5CPK A;  3V9R B;  2PYO B;  5BT1 C;  3X1V D;  3AL0 C;  3LZ0 B;  4J8V A;  3B0C W;  5CP6 D;  4QLC B;  3AZI B;  4WU9 A;  4ZUX A;  3KXB A;  3VH6 A;  2ARO D;  3O62 C;  1Z2C B;  3KUY B;  3REJ D;  1AOI C;  3REK B;  3MGP D;  4H9S A;  3WA9 D;  1BH9 A;  3REI D;  2Y2K A;  4YS3 B;  4NE3 A;  4LD9 D;  3AYW C;  4X23 A;  3B6G D;  5B2I B;  2FFF B;  3WTP D;  3EG5 B;  1P3I C;  4H9O A;  4R8P C;  4NE5 A;  3REI A;  4KHA B;  2YFV A;  3AN2 B;  2HIO B;  1S32 C;  3B6G A;  3NQJ B;  4WV4 B;  5AV8 A;  3C1B C;  1M18 D;  5E5A C;  2RVQ C;  1P3K A;  4HGA C;  5DNM A;  3AFA B;  2DQN C;  3REH D;  5CPK B;  2FJ7 C;  4J8V B;  1M18 A;  4WU9 B;  4ZUX B;  3KXB B;  1JFI B;  2Y2G A;  2Y2L A;  1P3L D;  5C3I C;  1P3F D;  5B1L D;  3VH6 W;  1BH9 B;  4YM6 C;  4XZQ C;  1KX3 C;  3WAA C;  4X23 B;  5G49 A;  3AV2 D;  3A1I A;  2BYK B;  1HTA A;  4H9O B;  3REI B;  2YFV B;  3B0D B;  3KSY A;  3W96 A;  3LZ1 A;  3MGQ C;  3AZM C;  3B6G B;  5AV8 B;  5B31 D;  4H9Q A;  4E44 A;  5CPI D;  2YFW A;  2JCH A;  5DNM B;  1P3K B;  5B24 B;  2NZD D;  1P3G A;  3C1C D;  5B31 A;  3W99 A;  1M19 C;  1F66 D;  2LY8 A;  1P3A A;  1P3M D;  3AZN C;  2ZM5 A;  2IO5 C;  3AZL A;  5GT0 C;  5G49 B;  4Z2M H;  5AV9 A;  5KDM A;  4KGC C;  3KFU G;  3F6T A;  3AZJ A;  4H9P A;  1HQ3 C;  5B0Z A;  3LZ1 B;  3W96 B;  3MGR A;  2G5I C;  4H9Q B;  5GT3 C;  3W98 C;  2YFW B;  4CAY A;  4H9N A;  3R45 B;  3UTB C;  5B1M C;  5B0Y A;  1P3G B;  3AZE D;  3W99 B;  4J8U D;  1AOI A;  3TU4 C;  3AV1 B;  1P3A B;  4EO5 B;  5BNX B;  1KX5 D;  5DNN D;  4J8U A;  2Y2J A;  3AYW A;  4J8W C;  1P3B D;  3AZL B;  4M6B A;  4R8P A;  5AV9 B;  3VH5 A;  5KDM B;  3UT9 C;  1EQZ D;  3AZJ B;  4H9P B;  4Z66 D;  3LEL D;  3B6F D;  3MGP C;  5B0Z B;  3AZG D;  5E5A A;  1KX4 A;  3MGR B;  2FJ7 A;  5AVC A;  2PYO D;  4CAY B;  5AVB C;  4H9N B;  5AV6 C;  3LZ0 D;  5B0Y B;  3LJA C;  4QLC D;  5F99 A;  3AZI D;  3KUY D;  4ZBJ C;  3MGS A;  1AOI B;  5GXQ A;  4WZS B;  3AYW B;  3REH C;  4YS3 D;  3W97 D;  3WTP E;  1ZLA A;  4G91 C;  5B2I D;  3MNN A;  5AY8 C;  4NFT A;  4R8P B;  2CV5 C;  4YS3 A;  3W97 A;  3AN2 D;  1P34 A;  3MGQ A;  3X1T C;  2HIO D;  3C1B B;  1P3F C;  5E5A B;  4G92 B;  4HGA B;  3VH5 W;  1KX4 B;  4J8X C;  2FJ7 B;  5AVC B;  5CPK D;  3AV2 C;  2HIO A;  1P3P A;  4J8V D;  4CSR A;  5B2J C;  5F99 B;  4WU9 D;  2Y2H A;  4ZUX D;  3KXB D;  4KUD C;  4UPK A;  3MGS B;  5C3I B;  3AZN A;  5GXQ B;  5CPI C;  4XUJ A;  1JFI A;  1A7W A;  4X23 D;  1ZLA B;  3C1C C;  4KGC A;  3MNN B;  2F8N H;  3AZK D;  5B32 A;  3W97 B;  1HQ3 A;  3MGQ B;  1P34 B;  1P3M C;  3MVD C;  5AV8 D;  2BYK A;  3AZH A;  3AZK A;  1WWS A;  1R4V A;  1P3K D;  5DNM D;  5B33 A;  5B24 D;  1P3P B;  4CSR B;  3TU4 A;  5B24 A;  1KU5 A;  3AZN B;  2IO5 B;  4XUJ B;  4JJN C;  3WKJ C;  5B40 C;  2F8N A;  3AZE C;  4KGC B;  3UT9 A;  1PZR A;  5B32 B;  4Z5T C;  3KWQ D;  1HQ3 B;  5GSU A;  4DRB A;  3W96 D;  3LZ1 D;  5DNN C;  5GT3 B;  3AZH B;  4WNN A;  3AZK B;  5AVB A;  3KWQ A;  5B33 B;  3LJA A;  3REL A;  1P3G D;  1U35 C;  2NQB C;  3W99 D;  1EQZ C;  3TU4 B;  3UTA C;  4Z66 C;  3LEL C;  3B6F C;  3R45 A;  3AZG C;  3AV1 D;  1P3A D;  1ID3 C;  2PYO C;  2CWE A;  5AY8 A;  3LZ0 C;  3AZL D;  2F8N B;  3AV1 A;  4QLC C;  4AWL C;  5BNX A;  3AZI C;  3AZF C;  2F2A C;  4WU8 A;  3UT9 B;  5AV9 D;  3X1T A;  3A6N A;  3X1U C;  1M1A C;  3AZJ D;  4DRA A;  3REK C;  5GSU B;  1TZY C;  3H0M C;  5B0Z D;  2Y2N A;  4J8X A;  3MGR D;  4WNN B;  3X1S A;  5AVB B;  5JRG A;  5AV6 B;  5B2I C;  3KWQ B;  5CPJ C;  5B2J A;  4H9R A;  3LJA B;  5B0Y D;  3REL B;  5JA4 A;  2HUE C;  1AOI D;  1TAF A;  1T3U A;  2W8S A;  3O62 A;  3AFA C;  3AYW D;  1P3O C;  2BG1 A;  5AY8 B;  2Y2M A;  5AV5 C;  2CV5 B;  4R8P D;  4WU9 C;  4ZUX C;  4WU8 B;  3KXB C;  5B31 G;  3X1T B;  3A6N B;  3MVD A;  3X1V C;  3C1B D;  4H9S C;  5CP6 C;  1P3I A;  1H3O A;  2RVQ D;  5E5A D;  4J8X B;  1KX4 D;  2ARO C;  2FJ7 D;  5AVC D;  3X1S B;  5JRG B;  4X23 C;  1S32 A;  3C1B A;  3REJ C;  5B2J B;  4H9R B;  5JA4 B;  3WA9 C;  5F99 D;  3IP4 C;  3REI C;  1BFM A;  4LD9 C;  3MGS D;  3B6G C;  1TAF B;  3WTP C;  2UWX A;  5GXQ D;  4JJN A;  3O62 B;  5DNM C;  3WKJ A;  3WAA D;  5B40 A;  5BO0 A;  3EPJ A;  1ZLA D;  5BS7 C;  2BYM A;  3EPH A;  3MNN D;  1M18 C;  4Z5T A;  2Y2O A;  4YM6 A;  4XZQ A;  1KX3 A;  3WAA A;  3MVD B;  3MGQ D;  1P34 D;  3AZM D;  1Q9C A;  2Y2P A;  1P3I B;  2ZY2 A;  1H3O B;  2J8P A;  1S32 B;  3AZM A;  1P3L C;  1P3P D;  3NQU A;  5B1L C;  5FUG A;  1M19 D;  3UTA A;  3W96 C;  2XD1 A;  3AZN D;  1ID3 A;  4WJ3 C;  1M19 A;  4JJN B;  2VQR A;  3WKJ B;  4XUJ D;  5B40 B;  5BO0 B;  1WWI A;  1P3G C;  2BYM B;  5B31 C;  4KGC D;  1M1A A;  4UUZ A;  3X1U A;  4Z5T B;  5B32 D;  4YM6 B;  3B0B A;  4XZQ B;  1KX3 B;  1TZY A;  3WAA B;  5GT0 A;  1HQ3 D;  2NZD C;  3B0C T;  5GT3 D;  3AZH D;  1F66 C;  5CPJ A;  5B33 D;  3UTB D;  3AZL C;  1U35 B;  3AZM B;  2NQB B;  3NQU B;  5GT3 A;  5FUG B;  5AV9 C;  3W98 A;  3UTA B;  3TU4 D;  3AZJ C;  3UTB A;  5B1M A;  1ID3 B;  3MGR C;  1M19 B;  4J8W D;  1P3O A;  2ZY4 A;  5AV5 A;  4NE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...