3WAAD

The nucleosome containing human h2a.z.2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaD00
5B1MD 5B2IC 4J8UA 3MGQA 4J8XD 4NE6A 3VH5A 1P3BC 4Z2MG 5GT3A 1S32A 3WAAD 2HUEB 5AVBC 5JRGC 1P3PC 1M1AD 5GT0D 5CP6B 4KGCA 5B40D 3LELB 2AROB 3WTPC 3AFAA 1TAFA 1B6WA 5GSUC 3MVDA 3O62B 2NZDB 3X1TC 4WU9A 1M19C 3KWQD 2BYMB 3MGSB 5B32A 4J8WA 4Z66C 3C1BA 3UTAA 3AZIC 3AYWB 3MGQD 3LZ0A 2FJ7A 4H9RB 1TZYB 1M18A 4YM6B 5B0ZC 4CSRA 3NQJB 1P34B 4Z5TC 5DNNA 5B32G 3UT9A 5AVCC 1BH8A 3AZNB 4JJNC 5AV6A 4H9OB 3REKD 3AFAD 3RELA 5B1LB 3AV1D 4QLCD 3B6FC 5BS7C 3W97C 3AN2A 2F8NK 5B32D 1P3KC 4XUJC 4WNNB 3AZJB 4H9QB 5AV5C 4J8VD 1P3OA 2PYOA 3W96D 5CPIA 4Z2MH 4WZSB 2CV5A 5CPKC 5B31A 2FJ7D 3WA9C 1M18D 3AV2D 3LZ1D 4H9NB 1KX4A 4CAYB 5F99D 5BNXA 1KX3A 5DNND 3UT9D 4R8PD 1ID3A 5B0YA 2YFWB 1P3IA 2HUEC 3LJAA 3MVDB 3W99B 5B31G 5DNMC 5B2IA 4EO5B 5CP6C 3UTAB 3LELC 2AROC 2PYOD 5B31D 5B2JD 3KXBC 5JRGA 3MGSC 3MGPB 3AZLA 1P3PA 1EQZB 3AYWC 5B33D 3UTBD 3B0BA 4LD9B 1KX3D 5AV8A 1P3ID 3WKJA 1M19A 4YM6C 3RELB 3LJAD 1P34C 5B2ID 3A6NC 1U35A 4H9SC 1JFIA 1P3BD 4WU8B 3TU4B 3B0DB 3VH6W 5AVBD 5B0ZA 5JRGD 1AOIC 3B6GC 1P3PD 3MGRB 4UUZB 4KUDB 5GSUD 3REJA 1F66C 2NQBA 3AZMB 1M19D 3AZID 5BT1C 4YS3A 4Z66D 5AV9A 1P3KA 3W98B 1KX5B 3AZHA 1P3LC 3WA9A 1ZLAB 5B0ZD 1HQ3A 4EO5C 1P3AB 3AZKB 5CPJB 3AZEA 5AVCD 4JJND 1A7WA 5E5AA 3X1SB 4NE5A 4XZQC 4ZUXB 4M6BA 5BO0A 4DRAA 3B6FD 3W97D 3WAAA 1EQZC 5DNMA 1P3KD 3KUYA 5AV5D 1H3OB 4LD9C 5GT0A 5B40A 5CPKD 4G91B 2HIOB 3B0CW 3WA9D 1P3FB 1N1JB 3AZFB 4KHAB 3C1CB 4X23B 3AZED 5E5AD 3TU4C 4WU8C 4HGAB 1P3GC 5JA4A 5DNMD 3MGRC 3X1VC 5B24B 3KUYD 3REHB 3X1UB 5CP6D 3LELD 5G49B 2L5AA 3REKA 2IO5B 3AV1A 4QLCA 3AZMC 4E45A 3KXBD 3B6GA 1AOIA 3V9RB 1KU5A 4NFTA 2YFVA 3AYWD 1P3MB 4G92C 3W96A 4J8VA 5B1MB 1BH9B 1KX5C 4J8XB 1F66A 4YM6D 1ZLAC 5BO0B 3AV2A 1P34D 3LZ1A 3A6ND 5AY8C 5GXQB 3AZKC 5F99A 3MNNB 4AWLB 4R8PA 3X1SC 3R45B 1P3LA 4ZUXC 1ULYA 5GT0B 1M1AB 2BYKB 3REIC 3B6GD 1AOID 3KWQB 4XZQA 5KDMA 4J8UB 3MGQB 1F66D 1P3FC 5B2JA 5BT1D 3AZGA 3AZFC 3KSYA 5C3IB 3NQUA 5GT3B 1S32B 3C1CC 5CHLB 4X23C 5B33A 3UTBA 1Q9CA 1P3LD 4HGAC 4KGCB 3VH6T 3AFAB 1TAFB 5B24C 4WU9B 4J8WB 5B32B 3C1BB 4XZQD 2IO5C 1P3BA 3O62C 4J8VB 2NZDC 2F8NA 3WTPE 5AVBA 3AZGD 3LZ0B 2FJ7B 4NE3A 1M18B 4LD9D 4CSRB 3WTPA 5GSUA 4J8XC 5DNNB 3UT9B 3X1TA 1BH8B 1TZYC 5AV6B 3AZIA 4Z66A 2F8NG 5GXQC 3AN2B 3MNNC 4AWLC 3AZNC 2JSSA 5B1LC 4WU8D 1P3OB 2PYOB 1P3GD 2F8ND 5CPIB 2CV5B 5B31B 3MGRD 5AY8A 4WV4B 4H9PA 4Z5TA 3X1VD 1BFMA 3AZJC 5AVCA 4JJNA 3WTPD 1KX4B 4J8UC 3B0CT 3B6FA 5BNXB 3AZMD 3REIA 3W97A 5BS7A 3X1TD 5B0YB 1KX3B 1P3IB 1ID3B 5C3IC 5GT3C 3VH6A 5FUGA 4XUJA 5BNVA 1S32C 4ZBJB 3LJAB 5AV5A 5B2IB 1KX5D 5CPKA 1R4VA 4KGCC 1ZLAD 3AFAC 3W99C 3MVDC 5AY8D 4Z5TD 3AZKD 4WU9C 3AZLB 5JRGB 4J8WC 1P3PB 3C1BC 3UTAC 3X1SD 4ZUXD 3REID 5AV8B 2F8NH 5GSUB 3LZ0C 3MGPC 2FJ7C 4XUJD 3WKJB 1M19B 5CP6A 3LELA 2AROA 3O62A 3UT9C 1P3FD 5AV6C 1U35B 3KXBA 3RELC 2BYMA 3MGSA 3AZFD 1JFIB 3AYWA 3AN2C 3C1CD 4E44A 5B0ZB 1P3OC 4H9RA 1TZYA 5CPIC 3B0DC 4YM6A 2CV5C 3NQJA 3REJB 1P34A 3A6NA 2NQBB 4KUDC 4YS3B 3AZNA 5AV9B 1P3KB 2AROD 4H9OA 1KX4C 5B1LA 4H9SA 3VH5W 5AV5B 3O62D 2NZDD 1ID3C 5B0YC 1F1EA 3MGSD 3AZHB 1HTAA 2CWEA 4WNNA 3W98C 3WA9B 3LJAC 4H9QA 1HQ3B 3AZEB 1TZYD 5E5AB 4H9NA 5GXQD 4CAYA 1P3AC 3AZLC 3WAAB 3MNND 5CPJC 5DNMB 3AZND 2YFWA 3KUYB 2RVQC 5B1LD 5B40B 5AV8C 3W99A 3WKJC 3KXBB 3AZJD 4J8UD 4G91C 2HIOC 1U35C 1EQZA 3MGPA 5GT3D 1S32D 5JA4B 4LD9A 3A6NB 4KGCD 3W99D 3MVDD 3REJC 3REKB 3AV1B 4QLCB 2NQBC 4WU9D 3REHC 3X1UC 4YS3C 4J8WD 1AOIB 3B6GB 5AV9C 3C1BD 3UTAD 2YFVB 4WU8A 3TU4A 3W96B 1P3GA 1EQZD 3LZ0D 3MGPD 3AZHC 1F66B 3MGRA 3X1VA 4UUZA 1P3MC 4KUDA 1HQ3C 3AV2B 5B1MC 3LZ1B 3AZEC 5F99B 3AZMA 5AV6D 5E5AC 4R8PB 3RELD 1P3LB 3W98A 3AN2D 3WAAC 3KUYC 1KX5A 1P3OD 1M1AC 5GT0C 3TU4D 5B40C 5CPID 2CV5D 4XZQB 1ZLAA 5KDMB 1P3AA 3AZKA 5CPJA 5B2JB 3KWQC 3AZGB 4KUDD 3NQUB 3X1SA 1KX4D 4ZUXA 3MGQC 1ID3D 5B33B 3UTBB 5B0YD 1B67A 3W98D 1H3OA 2HIOA 1P3FA 1N1JA 3REKC 3AZFA 3AV1C 1P3BB 4QLCC 4KHAA 1P3GB 1P3AD 2F8NB 3AZLD 3C1CA 5CPJD 5AVBB 4X23A 5B32C 3X1VB 2RVQD 3VH5T 3W96C 4J8VC 5AV8D 3WTPB 5B24A 3WKJD 3REHA 3X1TB 3X1UA 1WWIA 1M18C 3AZIB 2LY8A 3AV2C 3LZ1C 4Z66B 5G49A 4G92B 2HIOD 5F99C 2NZDA 5DNNC 4R8PC 1U35D 3V9RA 1P3MA 4X23D 1WWSA 5B1MA 1BH9A 5AY8B 4H9PB 4Z5TB 4J8XA 5AVCB 2PYOC 4JJNB 3REJD 5B31C 2NQBD 5B24D 3B6FB 3REHD 3REIB 5GXQA 3W97B 5B2JC 3X1UD 4YS3D 3MNNA 3AZGC 5AV9D 3R45A 5FUGB 4XUJB 5BNVB 1M1AA 5B33C 3UTBC 1KX3C 2BYKA 1P3IC 3AZHD 5CPKB 4DRBA 1P3MD 3KWQA 4ZBJC 3AZJA 1HQ3D
chains in the Genus database with same CATH superfamily
5B1MD 5B2IC 4J8UA 3MGQA 4J8XD 4NE6A 3VH5A 1P3BC 4Z2MG 5GT3A 1S32A 3WAAD 2HUEB 5AVBC 5JRGC 1P3PC 1M1AD 5GT0D 5CP6B 4KGCA 5B40D 3LELB 2AROB 3WTPC 3AFAA 1TAFA 1B6WA 5GSUC 3MVDA 3O62B 2NZDB 3X1TC 4WU9A 1M19C 3KWQD 2BYMB 3MGSB 5B32A 4J8WA 4Z66C 3C1BA 3UTAA 3AZIC 3AYWB 1PZRA 3MGQD 1T3UA 3LZ0A 2FJ7A 2W8SA 4H9RB 2XD5A 1TZYB 1M18A 4YM6B 3F6TA 5B0ZC 4CSRA 3NQJB 1P34B 4Z5TC 5DNNA 5B32G 3UT9A 5AVCC 1BH8A 3AZNB 4JJNC 5AV6A 4H9OB 3REKD 3AFAD 3RELA 5B1LB 3AV1D 4QLCD 3B6FC 2Y2KA 5BS7C 3W97C 3AN2A 2F8NK 2F2AC 5B32D 1P3KC 4XUJC 4WNNB 3AZJB 4H9QB 5AV5C 4J8VD 1P3OA 2PYOA 3W96D 5CPIA 4Z2MH 4WZSB 2UWXA 2CV5A 5CPKC 2ZY5A 5B31A 2FJ7D 3WA9C 1M18D 3FDDA 3AV2D 3LZ1D 4H9NB 1KX4A 4CAYB 5F99D 5BNXA 1KX3A 5DNND 3UT9D 4R8PD 1ID3A 5B0YA 2YFWB 1P3IA 2HUEC 3LJAA 3MVDB 3W99B 5B31G 5DNMC 5B2IA 4EO5B 3P5JB 5CP6C 3UTAB 3LELC 2AROC 2PYOD 5B31D 5B2JD 3KXBC 5JRGA 3MGSC 3MGPB 3AZLA 1P3PA 1EQZB 3AYWC 5B33D 3UTBD 3B0BA 4LD9B 1KX3D 5AV8A 1P3ID 3WKJA 1M19A 4YM6C 2ZM5A 3RELB 3LJAD 1P34C 5B2ID 3A6NC 2BG1A 1U35A 4H9SC 1JFIA 1W2EA 1P3BD 4WU8B 3TU4B 3KFUG 3B0DB 3VH6W 5AVBD 5B0ZA 5JRGD 1AOIC 3B6GC 1P3PD 3MGRB 4UUZB 4KUDB 2Y2GA 5GSUD 3REJA 1F66C 2NQBA 3AZMB 1M19D 3AZID 5BT1C 4YS3A 4Z66D 5AV9A 1P3KA 3W98B 1KX5B 3AZHA 1P3LC 3WA9A 1ZLAB 5B0ZD 1HQ3A 4EO5C 1P3AB 3AZKB 5CPJB 3AZEA 5AVCD 4JJND 1A7WA 5E5AA 3X1SB 4NE5A 4XZQC 4ZUXB 4M6BA 5BO0A 3H0MC 4DRAA 3B6FD 3W97D 3WAAA 1EQZC 5DNMA 1P3KD 3KUYA 5AV5D 1H3OB 4LD9C 5GT0A 5B40A 5CPKD 4G91B 2HIOB 3B0CW 3WA9D 1P3FB 1N1JB 3AZFB 4KHAB 3C1CB 4X23B 3AZED 5E5AD 3TU4C 4WU8C 4HGAB 1P3GC 5JA4A 5DNMD 3MGRC 3X1VC 5B24B 3KUYD 3REHB 3X1UB 5CP6D 1Z2CB 3LELD 4DQYB 5G49B 2L5AA 3REKA 2IO5B 3AV1A 4QLCA 2Y2MA 3AZMC 4E45A 3KXBD 3B6GA 1AOIA 3V9RB 1KU5A 4NFTA 2YFVA 3AYWD 1P3MB 4G92C 3W96A 4J8VA 5B1MB 1BH9B 1KX5C 4J8XB 1F66A 4YM6D 1ZLAC 5BO0B 3AV2A 1P34D 3LZ1A 3A6ND 5AY8C 5GXQB 3AZKC 5F99A 3MNNB 4AWLB 4R8PA 3X1SC 3R45B 1P3LA 3AL0C 4ZUXC 1ULYA 5GT0B 1M1AB 2BYKB 3REIC 3B6GD 1AOID 3KWQB 4XZQA 5KDMA 4J8UB 3MGQB 1F66D 2Y2IA 1P3FC 5B2JA 5BT1D 3AZGA 3AZFC 3KSYA 5C3IB 3NQUA 5GT3B 1S32B 3C1CC 5CHLB 4X23C 5B33A 3UTBA 1Q9CA 1P3LD 4HGAC 4KGCB 3VH6T 3AFAB 1TAFB 5B24C 2JE5A 4WU9B 4J8WB 5B32B 3C1BB 4XZQD 2IO5C 1P3BA 3O62C 4J8VB 2NZDC 2F8NA 3WTPE 3EG5B 5AVBA 3EPJA 3AZGD 3LZ0B 2FJ7B 3A1IA 4NE3A 1M18B 4LD9D 4CSRB 3WTPA 5GSUA 4J8XC 3H0RC 5DNNB 3UT9B 3X1TA 1BH8B 1TZYC 5AV6B 3AZIA 4Z66A 2F8NG 5GXQC 2J8PA 3AN2B 3MNNC 4AWLC 3AZNC 2JSSA 5B1LC 4WU8D 1P3OB 2XD1A 1P3GD 2PYOB 2F8ND 5CPIB 2CV5B 5B31B 3MGRD 5AY8A 4WV4B 4H9PA 4Z5TA 3X1VD 1BFMA 3AZJC 5AVCA 4JJNA 3WTPD 1KX4B 4J8UC 2VQRA 3B0CT 3B6FA 5BNXB 3AZMD 3REIA 3W97A 5BS7A 3X1TD 5B0YB 1KX3B 1P3IB 1ID3B 5C3IC 5GT3C 3VH6A 5FUGA 4XUJA 5BNVA 1S32C 4ZBJB 3LJAB 5AV5A 5B2IB 1KX5D 5CPKA 1R4VA 4KGCC 1ZLAD 3AFAC 3W99C 3MVDC 5AY8D 4Z5TD 2Y2QA 3AZKD 4WU9C 3AZLB 5JRGB 4J8WC 1P3PB 3C1BC 3UTAC 3X1SD 4ZUXD 3H0LC 3REID 5AV8B 2F8NH 5GSUB 3LZ0C 3MGPC 2FJ7C 2Y2PA 4XUJD 3WKJB 1M19B 5CP6A 3LELA 2AROA 3O62A 3UT9C 1P3FD 5AV6C 1U35B 2Y2HA 3KXBA 2BYMA 3MGSA 3RELC 3AZFD 1JFIB 3AYWA 3AN2C 3C1CD 4E44A 5B0ZB 2ZY4A 1P3OC 4H9RA 1TZYA 5CPIC 3B0DC 4YM6A 2CV5C 3NQJA 3REJB 1P34A 3A6NA 2Y2OA 2NQBB 4KUDC 3IP4C 3AZNA 4YS3B 5AV9B 1P3KB 2AROD 4H9OA 1KX4C 5B1LA 4H9SA 3VH5W 5AV5B 3O62D 2NZDD 1ID3C 5B0YC 1F1EA 3MGSD 3AZHB 1HTAA 2CWEA 4WNNA 3W98C 3WA9B 3LJAC 4H9QA 3A1KA 1HQ3B 2DQNC 3AZEB 1TZYD 5E5AB 4H9NA 5GXQD 4CAYA 1P3AC 3AZLC 3WAAB 3MNND 5CPJC 5DNMB 3AZND 2YFWA 3KUYB 2RVQC 5B1LD 5B40B 5AV8C 3W99A 3WKJC 3KXBB 3AZJD 4J8UD 4G91C 2HIOC 1U35C 1EQZA 3MGPA 5GT3D 1S32D 5JA4B 4LD9A 3A6NB 4KGCD 3W99D 3MVDD 3REJC 3REKB 3AV1B 4QLCB 2NQBC 4WU9D 3REHC 3X1UC 4YS3C 4J8WD 1AOIB 3B6GB 5AV9C 3C1BD 2Y2NA 3UTAD 2Y2LA 2YFVB 4WU8A 3TU4A 3W96B 1P3GA 1EQZD 3LZ0D 3MGPD 3AZHC 1F66B 3MGRA 3X1VA 4UUZA 1P3MC 4KUDA 1HQ3C 3AV2B 5B1MC 2RIQA 3LZ1B 3AZEC 2JCHA 5F99B 3AZMA 5AV6D 5E5AC 4R8PB 3RELD 1P3LB 3W98A 3AN2D 2Y2JA 3WAAC 3KUYC 1KX5A 1P3OD 1M1AC 5GT0C 2G5IC 4UPKA 3TU4D 5B40C 5CPID 2CV5D 4XZQB 1ZLAA 5KDMB 1P3AA 3AZKA 5CPJA 5B2JB 3KWQC 3AZGB 4KUDD 3NQUB 3X1SA 1KX4D 4ZUXA 3MGQC 1ID3D 5B33B 3UTBB 5B0YD 1B67A 3W98D 1H3OA 2G5HC 2ZY3A 2HIOA 3EPLA 1P3FA 1N1JA 3REKC 3AZFA 3AV1C 1P3BB 4QLCC 4KHAA 1P3GB 1P3AD 2F8NB 3AZLD 3C1CA 5CPJD 5AVBB 4X23A 5B32C 3X1VB 2RVQD 3VH5T 3W96C 4J8VC 5AV8D 3WTPB 5B24A 3WKJD 3REHA 3X1TB 3EPKA 3X1UA 1WWIA 1M18C 3AZIB 2LY8A 3AV2C 3LZ1C 4Z66B 4WJ3C 5G49A 4G92B 2HIOD 5F99C 2NZDA 2DF4C 5DNNC 4R8PC 1U35D 3V9RA 1P3MA 4X23D 1WWSA 5B1MA 1BH9A 5AY8B 4H9PB 4Z5TB 4J8XA 5AVCB 2PYOC 4JJNB 3REJD 5B31C 2NQBD 5B24D 3B6FB 3REHD 3REIB 5GXQA 3W97B 2FFFB 5B2JC 3X1UD 4YS3D 3MNNA 5AV9D 3AZGC 3R45A 5FUGB 4XUJB 5BNVB 1M1AA 5B33C 3UTBC 1KX3C 2ZY2A 2BYKA 1P3IC 3AZHD 5CPKB 3EPHA 4DRBA 1P3MD 3KWQA 4ZBJC 3AZJA 1HQ3D
chains in the Genus database with same CATH topology
5B1MD 5B2IC 4J8UA 3MGQA 4J8XD 4NE6A 3VH5A 1P3BC 4Z2MG 5GT3A 1S32A 3WAAD 2HUEB 5AVBC 5JRGC 1P3PC 1M1AD 5GT0D 5CP6B 4KGCA 5B40D 3LELB 2AROB 3WTPC 3AFAA 1TAFA 1B6WA 5GSUC 3MVDA 3O62B 2NZDB 3X1TC 4WU9A 1M19C 3KWQD 2BYMB 3MGSB 5B32A 4J8WA 4Z66C 3C1BA 3UTAA 3AZIC 3AYWB 1PZRA 3MGQD 1T3UA 3LZ0A 2FJ7A 2W8SA 4H9RB 2XD5A 1TZYB 1M18A 4YM6B 3F6TA 5B0ZC 4CSRA 3NQJB 1P34B 4Z5TC 5DNNA 5B32G 3UT9A 5AVCC 1BH8A 3AZNB 4JJNC 5AV6A 4H9OB 3REKD 3AFAD 3RELA 5B1LB 3AV1D 4QLCD 3B6FC 2Y2KA 5BS7C 3W97C 3AN2A 2F8NK 2F2AC 5B32D 1P3KC 4XUJC 4WNNB 3AZJB 4H9QB 5AV5C 4J8VD 1P3OA 2PYOA 3W96D 5CPIA 4Z2MH 4WZSB 2UWXA 2CV5A 5CPKC 2ZY5A 5B31A 2FJ7D 3WA9C 1M18D 3FDDA 3AV2D 3LZ1D 4H9NB 1KX4A 4CAYB 5F99D 5BNXA 1KX3A 5DNND 3UT9D 4R8PD 1ID3A 5B0YA 2YFWB 1P3IA 2HUEC 3LJAA 3MVDB 3W99B 5B31G 5DNMC 5B2IA 4EO5B 3P5JB 5CP6C 3UTAB 3LELC 2AROC 2PYOD 5B31D 5B2JD 3KXBC 5JRGA 3MGSC 3MGPB 3AZLA 1P3PA 1EQZB 3AYWC 5B33D 3UTBD 3B0BA 4LD9B 1KX3D 5AV8A 1P3ID 3WKJA 1M19A 4YM6C 2ZM5A 3RELB 3LJAD 1P34C 5B2ID 3A6NC 2BG1A 1U35A 4H9SC 1JFIA 1W2EA 1P3BD 4WU8B 3TU4B 3KFUG 3B0DB 3VH6W 5AVBD 5B0ZA 5JRGD 1AOIC 3B6GC 1P3PD 3MGRB 4UUZB 4KUDB 2Y2GA 5GSUD 3REJA 1F66C 2NQBA 3AZMB 1M19D 3AZID 5BT1C 4YS3A 4Z66D 5AV9A 1P3KA 3W98B 1KX5B 3AZHA 1P3LC 3WA9A 1ZLAB 5B0ZD 1HQ3A 4EO5C 1P3AB 3AZKB 5CPJB 3AZEA 5AVCD 4JJND 1A7WA 5E5AA 3X1SB 4NE5A 4XZQC 4ZUXB 4M6BA 5BO0A 3H0MC 4DRAA 3B6FD 3W97D 3WAAA 1EQZC 5DNMA 1P3KD 3KUYA 5AV5D 1H3OB 4LD9C 5GT0A 5B40A 5CPKD 4G91B 2HIOB 3B0CW 3WA9D 1P3FB 1N1JB 3AZFB 4KHAB 3C1CB 4X23B 3AZED 5E5AD 3TU4C 4WU8C 4HGAB 1P3GC 5JA4A 5DNMD 3MGRC 3X1VC 5B24B 3KUYD 3REHB 3X1UB 5CP6D 1Z2CB 3LELD 4DQYB 5G49B 2L5AA 3REKA 2IO5B 3AV1A 4QLCA 2Y2MA 3AZMC 4E45A 3KXBD 3B6GA 1AOIA 3V9RB 1KU5A 4NFTA 2YFVA 3AYWD 1P3MB 4G92C 3W96A 4J8VA 5B1MB 1BH9B 1KX5C 4J8XB 1F66A 4YM6D 1ZLAC 5BO0B 3AV2A 1P34D 3LZ1A 3A6ND 5AY8C 5GXQB 3AZKC 5F99A 3MNNB 4AWLB 4R8PA 3X1SC 3R45B 1P3LA 3AL0C 4ZUXC 1ULYA 5GT0B 1M1AB 2BYKB 3REIC 3B6GD 1AOID 3KWQB 4XZQA 5KDMA 4J8UB 3MGQB 1F66D 2Y2IA 1P3FC 5B2JA 5BT1D 3AZGA 3AZFC 3KSYA 5C3IB 3NQUA 5GT3B 1S32B 3C1CC 5CHLB 4X23C 5B33A 3UTBA 1Q9CA 1P3LD 4HGAC 4KGCB 3VH6T 3AFAB 1TAFB 5B24C 2JE5A 4WU9B 4J8WB 5B32B 3C1BB 4XZQD 2IO5C 1P3BA 3O62C 4J8VB 2NZDC 2F8NA 3WTPE 3EG5B 5AVBA 3EPJA 3AZGD 3LZ0B 2FJ7B 3A1IA 4NE3A 1M18B 4LD9D 4CSRB 3WTPA 5GSUA 4J8XC 3H0RC 5DNNB 3UT9B 3X1TA 1BH8B 1TZYC 5AV6B 3AZIA 4Z66A 2F8NG 5GXQC 2J8PA 3AN2B 3MNNC 4AWLC 3AZNC 2JSSA 5B1LC 4WU8D 1P3OB 2XD1A 1P3GD 2PYOB 2F8ND 5CPIB 2CV5B 5B31B 3MGRD 5AY8A 4WV4B 4H9PA 4Z5TA 3X1VD 1BFMA 3AZJC 5AVCA 4JJNA 3WTPD 1KX4B 4J8UC 2VQRA 3B0CT 3B6FA 5BNXB 3AZMD 3REIA 3W97A 5BS7A 3X1TD 5B0YB 1KX3B 1P3IB 1ID3B 5C3IC 5GT3C 3VH6A 5FUGA 4XUJA 5BNVA 1S32C 4ZBJB 3LJAB 5AV5A 5B2IB 1KX5D 5CPKA 1R4VA 4KGCC 1ZLAD 3AFAC 3W99C 3MVDC 5AY8D 4Z5TD 2Y2QA 3AZKD 4WU9C 3AZLB 5JRGB 4J8WC 1P3PB 3C1BC 3UTAC 3X1SD 4ZUXD 3H0LC 3REID 5AV8B 2F8NH 5GSUB 3LZ0C 3MGPC 2FJ7C 2Y2PA 4XUJD 3WKJB 1M19B 5CP6A 3LELA 2AROA 3O62A 3UT9C 1P3FD 5AV6C 1U35B 2Y2HA 3KXBA 2BYMA 3MGSA 3RELC 3AZFD 1JFIB 3AYWA 3AN2C 3C1CD 4E44A 5B0ZB 2ZY4A 1P3OC 4H9RA 1TZYA 5CPIC 3B0DC 4YM6A 2CV5C 3NQJA 3REJB 1P34A 3A6NA 2Y2OA 2NQBB 4KUDC 3IP4C 3AZNA 4YS3B 5AV9B 1P3KB 2AROD 4H9OA 1KX4C 5B1LA 4H9SA 3VH5W 5AV5B 3O62D 2NZDD 1ID3C 5B0YC 1F1EA 3MGSD 3AZHB 1HTAA 2CWEA 4WNNA 3W98C 3WA9B 3LJAC 4H9QA 3A1KA 1HQ3B 2DQNC 3AZEB 1TZYD 5E5AB 4H9NA 5GXQD 4CAYA 1P3AC 3AZLC 3WAAB 3MNND 5CPJC 5DNMB 3AZND 2YFWA 3KUYB 2RVQC 5B1LD 5B40B 5AV8C 3W99A 3WKJC 3KXBB 3AZJD 4J8UD 4G91C 2HIOC 1U35C 1EQZA 3MGPA 5GT3D 1S32D 5JA4B 4LD9A 3A6NB 4KGCD 3W99D 3MVDD 3REJC 3REKB 3AV1B 4QLCB 2NQBC 4WU9D 3REHC 3X1UC 4YS3C 4J8WD 1AOIB 3B6GB 5AV9C 3C1BD 2Y2NA 3UTAD 2Y2LA 2YFVB 4WU8A 3TU4A 3W96B 1P3GA 1EQZD 3LZ0D 3MGPD 3AZHC 1F66B 3MGRA 3X1VA 4UUZA 1P3MC 4KUDA 1HQ3C 3AV2B 5B1MC 2RIQA 3LZ1B 3AZEC 2JCHA 5F99B 3AZMA 5AV6D 5E5AC 4R8PB 3RELD 1P3LB 3W98A 3AN2D 2Y2JA 3WAAC 3KUYC 1KX5A 1P3OD 1M1AC 5GT0C 2G5IC 4UPKA 3TU4D 5B40C 5CPID 2CV5D 4XZQB 1ZLAA 5KDMB 1P3AA 3AZKA 5CPJA 5B2JB 3KWQC 3AZGB 4KUDD 3NQUB 3X1SA 1KX4D 4ZUXA 3MGQC 1ID3D 5B33B 3UTBB 5B0YD 1B67A 3W98D 1H3OA 2G5HC 2ZY3A 2HIOA 3EPLA 1P3FA 1N1JA 3REKC 3AZFA 3AV1C 1P3BB 4QLCC 4KHAA 1P3GB 1P3AD 2F8NB 3AZLD 3C1CA 5CPJD 5AVBB 4X23A 5B32C 3X1VB 2RVQD 3VH5T 3W96C 4J8VC 5AV8D 3WTPB 5B24A 3WKJD 3REHA 3X1TB 3EPKA 3X1UA 1WWIA 1M18C 3AZIB 2LY8A 3AV2C 3LZ1C 4Z66B 4WJ3C 5G49A 4G92B 2HIOD 5F99C 2NZDA 2DF4C 5DNNC 4R8PC 1U35D 3V9RA 1P3MA 4X23D 1WWSA 5B1MA 1BH9A 5AY8B 4H9PB 4Z5TB 4J8XA 5AVCB 2PYOC 4JJNB 3REJD 5B31C 2NQBD 5B24D 3B6FB 3REHD 3REIB 5GXQA 3W97B 2FFFB 5B2JC 3X1UD 4YS3D 3MNNA 5AV9D 3AZGC 3R45A 5FUGB 4XUJB 5BNVB 1M1AA 5B33C 3UTBC 1KX3C 2ZY2A 2BYKA 1P3IC 3AZHD 5CPKB 3EPHA 4DRBA 1P3MD 3KWQA 4ZBJC 3AZJA 1HQ3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M D;  5B2I C;  4J8U A;  3MGQ A;  4J8X D;  4NE6 A;  3VH5 A;  1P3B C;  4Z2M G;  5GT3 A;  1S32 A;  3WAA D;  2HUE B;  5AVB C;  5JRG C;  1P3P C;  1M1A D;  5GT0 D;  5CP6 B;  4KGC A;  5B40 D;  3LEL B;  2ARO B;  3WTP C;  3AFA A;  1TAF A;  1B6W A;  5GSU C;  3MVD A;  3O62 B;  2NZD B;  3X1T C;  4WU9 A;  1M19 C;  3KWQ D;  2BYM B;  3MGS B;  5B32 A;  4J8W A;  4Z66 C;  3C1B A;  3UTA A;  3AZI C;  3AYW B;  3MGQ D;  3LZ0 A;  2FJ7 A;  4H9R B;  1TZY B;  1M18 A;  4YM6 B;  5B0Z C;  4CSR A;  3NQJ B;  1P34 B;  4Z5T C;  5DNN A;  5B32 G;  3UT9 A;  5AVC C;  1BH8 A;  3AZN B;  4JJN C;  5AV6 A;  4H9O B;  3REK D;  3AFA D;  3REL A;  5B1L B;  3AV1 D;  4QLC D;  3B6F C;  5BS7 C;  3W97 C;  3AN2 A;  2F8N K;  5B32 D;  1P3K C;  4XUJ C;  4WNN B;  3AZJ B;  4H9Q B;  5AV5 C;  4J8V D;  1P3O A;  2PYO A;  3W96 D;  5CPI A;  4Z2M H;  4WZS B;  2CV5 A;  5CPK C;  5B31 A;  2FJ7 D;  3WA9 C;  1M18 D;  3AV2 D;  3LZ1 D;  4H9N B;  1KX4 A;  4CAY B;  5F99 D;  5BNX A;  1KX3 A;  5DNN D;  3UT9 D;  4R8P D;  1ID3 A;  5B0Y A;  2YFW B;  1P3I A;  2HUE C;  3LJA A;  3MVD B;  3W99 B;  5B31 G;  5DNM C;  5B2I A;  4EO5 B;  5CP6 C;  3UTA B;  3LEL C;  2ARO C;  2PYO D;  5B31 D;  5B2J D;  3KXB C;  5JRG A;  3MGS C;  3MGP B;  3AZL A;  1P3P A;  1EQZ B;  3AYW C;  5B33 D;  3UTB D;  3B0B A;  4LD9 B;  1KX3 D;  5AV8 A;  1P3I D;  3WKJ A;  1M19 A;  4YM6 C;  3REL B;  3LJA D;  1P34 C;  5B2I D;  3A6N C;  1U35 A;  4H9S C;  1JFI A;  1P3B D;  4WU8 B;  3TU4 B;  3B0D B;  3VH6 W;  5AVB D;  5B0Z A;  5JRG D;  1AOI C;  3B6G C;  1P3P D;  3MGR B;  4UUZ B;  4KUD B;  5GSU D;  3REJ A;  1F66 C;  2NQB A;  3AZM B;  1M19 D;  3AZI D;  5BT1 C;  4YS3 A;  4Z66 D;  5AV9 A;  1P3K A;  3W98 B;  1KX5 B;  3AZH A;  1P3L C;  3WA9 A;  1ZLA B;  5B0Z D;  1HQ3 A;  4EO5 C;  1P3A B;  3AZK B;  5CPJ B;  3AZE A;  5AVC D;  4JJN D;  1A7W A;  5E5A A;  3X1S B;  4NE5 A;  4XZQ C;  4ZUX B;  4M6B A;  5BO0 A;  4DRA A;  3B6F D;  3W97 D;  3WAA A;  1EQZ C;  5DNM A;  1P3K D;  3KUY A;  5AV5 D;  1H3O B;  4LD9 C;  5GT0 A;  5B40 A;  5CPK D;  4G91 B;  2HIO B;  3B0C W;  3WA9 D;  1P3F B;  1N1J B;  3AZF B;  4KHA B;  3C1C B;  4X23 B;  3AZE D;  5E5A D;  3TU4 C;  4WU8 C;  4HGA B;  1P3G C;  5JA4 A;  5DNM D;  3MGR C;  3X1V C;  5B24 B;  3KUY D;  3REH B;  3X1U B;  5CP6 D;  3LEL D;  5G49 B;  2L5A A;  3REK A;  2IO5 B;  3AV1 A;  4QLC A;  3AZM C;  4E45 A;  3KXB D;  3B6G A;  1AOI A;  3V9R B;  1KU5 A;  4NFT A;  2YFV A;  3AYW D;  1P3M B;  4G92 C;  3W96 A;  4J8V A;  5B1M B;  1BH9 B;  1KX5 C;  4J8X B;  1F66 A;  4YM6 D;  1ZLA C;  5BO0 B;  3AV2 A;  1P34 D;  3LZ1 A;  3A6N D;  5AY8 C;  5GXQ B;  3AZK C;  5F99 A;  3MNN B;  4AWL B;  4R8P A;  3X1S C;  3R45 B;  1P3L A;  4ZUX C;  1ULY A;  5GT0 B;  1M1A B;  2BYK B;  3REI C;  3B6G D;  1AOI D;  3KWQ B;  4XZQ A;  5KDM A;  4J8U B;  3MGQ B;  1F66 D;  1P3F C;  5B2J A;  5BT1 D;  3AZG A;  3AZF C;  3KSY A;  5C3I B;  3NQU A;  5GT3 B;  1S32 B;  3C1C C;  5CHL B;  4X23 C;  5B33 A;  3UTB A;  1Q9C A;  1P3L D;  4HGA C;  4KGC B;  3VH6 T;  3AFA B;  1TAF B;  5B24 C;  4WU9 B;  4J8W B;  5B32 B;  3C1B B;  4XZQ D;  2IO5 C;  1P3B A;  3O62 C;  4J8V B;  2NZD C;  2F8N A;  3WTP E;  5AVB A;  3AZG D;  3LZ0 B;  2FJ7 B;  4NE3 A;  1M18 B;  4LD9 D;  4CSR B;  3WTP A;  5GSU A;  4J8X C;  5DNN B;  3UT9 B;  3X1T A;  1BH8 B;  1TZY C;  5AV6 B;  3AZI A;  4Z66 A;  2F8N G;  5GXQ C;  3AN2 B;  3MNN C;  4AWL C;  3AZN C;  2JSS A;  5B1L C;  4WU8 D;  1P3O B;  2PYO B;  1P3G D;  2F8N D;  5CPI B;  2CV5 B;  5B31 B;  3MGR D;  5AY8 A;  4WV4 B;  4H9P A;  4Z5T A;  3X1V D;  1BFM A;  3AZJ C;  5AVC A;  4JJN A;  3WTP D;  1KX4 B;  4J8U C;  3B0C T;  3B6F A;  5BNX B;  3AZM D;  3REI A;  3W97 A;  5BS7 A;  3X1T D;  5B0Y B;  1KX3 B;  1P3I B;  1ID3 B;  5C3I C;  5GT3 C;  3VH6 A;  5FUG A;  4XUJ A;  5BNV A;  1S32 C;  4ZBJ B;  3LJA B;  5AV5 A;  5B2I B;  1KX5 D;  5CPK A;  1R4V A;  4KGC C;  1ZLA D;  3AFA C;  3W99 C;  3MVD C;  5AY8 D;  4Z5T D;  3AZK D;  4WU9 C;  3AZL B;  5JRG B;  4J8W C;  1P3P B;  3C1B C;  3UTA C;  3X1S D;  4ZUX D;  3REI D;  5AV8 B;  2F8N H;  5GSU B;  3LZ0 C;  3MGP C;  2FJ7 C;  4XUJ D;  3WKJ B;  1M19 B;  5CP6 A;  3LEL A;  2ARO A;  3O62 A;  3UT9 C;  1P3F D;  5AV6 C;  1U35 B;  3KXB A;  3REL C;  2BYM A;  3MGS A;  3AZF D;  1JFI B;  3AYW A;  3AN2 C;  3C1C D;  4E44 A;  5B0Z B;  1P3O C;  4H9R A;  1TZY A;  5CPI C;  3B0D C;  4YM6 A;  2CV5 C;  3NQJ A;  3REJ B;  1P34 A;  3A6N A;  2NQB B;  4KUD C;  4YS3 B;  3AZN A;  5AV9 B;  1P3K B;  2ARO D;  4H9O A;  1KX4 C;  5B1L A;  4H9S A;  3VH5 W;  5AV5 B;  3O62 D;  2NZD D;  1ID3 C;  5B0Y C;  1F1E A;  3MGS D;  3AZH B;  1HTA A;  2CWE A;  4WNN A;  3W98 C;  3WA9 B;  3LJA C;  4H9Q A;  1HQ3 B;  3AZE B;  1TZY D;  5E5A B;  4H9N A;  5GXQ D;  4CAY A;  1P3A C;  3AZL C;  3WAA B;  3MNN D;  5CPJ C;  5DNM B;  3AZN D;  2YFW A;  3KUY B;  2RVQ C;  5B1L D;  5B40 B;  5AV8 C;  3W99 A;  3WKJ C;  3KXB B;  3AZJ D;  4J8U D;  4G91 C;  2HIO C;  1U35 C;  1EQZ A;  3MGP A;  5GT3 D;  1S32 D;  5JA4 B;  4LD9 A;  3A6N B;  4KGC D;  3W99 D;  3MVD D;  3REJ C;  3REK B;  3AV1 B;  4QLC B;  2NQB C;  4WU9 D;  3REH C;  3X1U C;  4YS3 C;  4J8W D;  1AOI B;  3B6G B;  5AV9 C;  3C1B D;  3UTA D;  2YFV B;  4WU8 A;  3TU4 A;  3W96 B;  1P3G A;  1EQZ D;  3LZ0 D;  3MGP D;  3AZH C;  1F66 B;  3MGR A;  3X1V A;  4UUZ A;  1P3M C;  4KUD A;  1HQ3 C;  3AV2 B;  5B1M C;  3LZ1 B;  3AZE C;  5F99 B;  3AZM A;  5AV6 D;  5E5A C;  4R8P B;  3REL D;  1P3L B;  3W98 A;  3AN2 D;  3WAA C;  3KUY C;  1KX5 A;  1P3O D;  1M1A C;  5GT0 C;  3TU4 D;  5B40 C;  5CPI D;  2CV5 D;  4XZQ B;  1ZLA A;  5KDM B;  1P3A A;  3AZK A;  5CPJ A;  5B2J B;  3KWQ C;  3AZG B;  4KUD D;  3NQU B;  3X1S A;  1KX4 D;  4ZUX A;  3MGQ C;  1ID3 D;  5B33 B;  3UTB B;  5B0Y D;  1B67 A;  3W98 D;  1H3O A;  2HIO A;  1P3F A;  1N1J A;  3REK C;  3AZF A;  3AV1 C;  1P3B B;  4QLC C;  4KHA A;  1P3G B;  1P3A D;  2F8N B;  3AZL D;  3C1C A;  5CPJ D;  5AVB B;  4X23 A;  5B32 C;  3X1V B;  2RVQ D;  3VH5 T;  3W96 C;  4J8V C;  5AV8 D;  3WTP B;  5B24 A;  3WKJ D;  3REH A;  3X1T B;  3X1U A;  1WWI A;  1M18 C;  3AZI B;  2LY8 A;  3AV2 C;  3LZ1 C;  4Z66 B;  5G49 A;  4G92 B;  2HIO D;  5F99 C;  2NZD A;  5DNN C;  4R8P C;  1U35 D;  3V9R A;  1P3M A;  4X23 D;  1WWS A;  5B1M A;  1BH9 A;  5AY8 B;  4H9P B;  4Z5T B;  4J8X A;  5AVC B;  2PYO C;  4JJN B;  3REJ D;  5B31 C;  2NQB D;  5B24 D;  3B6F B;  3REH D;  3REI B;  5GXQ A;  3W97 B;  5B2J C;  3X1U D;  4YS3 D;  3MNN A;  3AZG C;  5AV9 D;  3R45 A;  5FUG B;  4XUJ B;  5BNV B;  1M1A A;  5B33 C;  3UTB C;  1KX3 C;  2BYK A;  1P3I C;  3AZH D;  5CPK B;  4DRB A;  1P3M D;  3KWQ A;  4ZBJ C;  3AZJ A;  1HQ3 D; 
#chains in the Genus database with same CATH topology
 5B1M D;  5B2I C;  4J8U A;  3MGQ A;  4J8X D;  4NE6 A;  3VH5 A;  1P3B C;  4Z2M G;  5GT3 A;  1S32 A;  3WAA D;  2HUE B;  5AVB C;  5JRG C;  1P3P C;  1M1A D;  5GT0 D;  5CP6 B;  4KGC A;  5B40 D;  3LEL B;  2ARO B;  3WTP C;  3AFA A;  1TAF A;  1B6W A;  5GSU C;  3MVD A;  3O62 B;  2NZD B;  3X1T C;  4WU9 A;  1M19 C;  3KWQ D;  2BYM B;  3MGS B;  5B32 A;  4J8W A;  4Z66 C;  3C1B A;  3UTA A;  3AZI C;  3AYW B;  1PZR A;  3MGQ D;  1T3U A;  3LZ0 A;  2FJ7 A;  2W8S A;  4H9R B;  2XD5 A;  1TZY B;  1M18 A;  4YM6 B;  3F6T A;  5B0Z C;  4CSR A;  3NQJ B;  1P34 B;  4Z5T C;  5DNN A;  5B32 G;  3UT9 A;  5AVC C;  1BH8 A;  3AZN B;  4JJN C;  5AV6 A;  4H9O B;  3REK D;  3AFA D;  3REL A;  5B1L B;  3AV1 D;  4QLC D;  3B6F C;  2Y2K A;  5BS7 C;  3W97 C;  3AN2 A;  2F8N K;  2F2A C;  5B32 D;  1P3K C;  4XUJ C;  4WNN B;  3AZJ B;  4H9Q B;  5AV5 C;  4J8V D;  1P3O A;  2PYO A;  3W96 D;  5CPI A;  4Z2M H;  4WZS B;  2UWX A;  2CV5 A;  5CPK C;  2ZY5 A;  5B31 A;  2FJ7 D;  3WA9 C;  1M18 D;  3FDD A;  3AV2 D;  3LZ1 D;  4H9N B;  1KX4 A;  4CAY B;  5F99 D;  5BNX A;  1KX3 A;  5DNN D;  3UT9 D;  4R8P D;  1ID3 A;  5B0Y A;  2YFW B;  1P3I A;  2HUE C;  3LJA A;  3MVD B;  3W99 B;  5B31 G;  5DNM C;  5B2I A;  4EO5 B;  3P5J B;  5CP6 C;  3UTA B;  3LEL C;  2ARO C;  2PYO D;  5B31 D;  5B2J D;  3KXB C;  5JRG A;  3MGS C;  3MGP B;  3AZL A;  1P3P A;  1EQZ B;  3AYW C;  5B33 D;  3UTB D;  3B0B A;  4LD9 B;  1KX3 D;  5AV8 A;  1P3I D;  3WKJ A;  1M19 A;  4YM6 C;  2ZM5 A;  3REL B;  3LJA D;  1P34 C;  5B2I D;  3A6N C;  2BG1 A;  1U35 A;  4H9S C;  1JFI A;  1W2E A;  1P3B D;  4WU8 B;  3TU4 B;  3KFU G;  3B0D B;  3VH6 W;  5AVB D;  5B0Z A;  5JRG D;  1AOI C;  3B6G C;  1P3P D;  3MGR B;  4UUZ B;  4KUD B;  2Y2G A;  5GSU D;  3REJ A;  1F66 C;  2NQB A;  3AZM B;  1M19 D;  3AZI D;  5BT1 C;  4YS3 A;  4Z66 D;  5AV9 A;  1P3K A;  3W98 B;  1KX5 B;  3AZH A;  1P3L C;  3WA9 A;  1ZLA B;  5B0Z D;  1HQ3 A;  4EO5 C;  1P3A B;  3AZK B;  5CPJ B;  3AZE A;  5AVC D;  4JJN D;  1A7W A;  5E5A A;  3X1S B;  4NE5 A;  4XZQ C;  4ZUX B;  4M6B A;  5BO0 A;  3H0M C;  4DRA A;  3B6F D;  3W97 D;  3WAA A;  1EQZ C;  5DNM A;  1P3K D;  3KUY A;  5AV5 D;  1H3O B;  4LD9 C;  5GT0 A;  5B40 A;  5CPK D;  4G91 B;  2HIO B;  3B0C W;  3WA9 D;  1P3F B;  1N1J B;  3AZF B;  4KHA B;  3C1C B;  4X23 B;  3AZE D;  5E5A D;  3TU4 C;  4WU8 C;  4HGA B;  1P3G C;  5JA4 A;  5DNM D;  3MGR C;  3X1V C;  5B24 B;  3KUY D;  3REH B;  3X1U B;  5CP6 D;  1Z2C B;  3LEL D;  4DQY B;  5G49 B;  2L5A A;  3REK A;  2IO5 B;  3AV1 A;  4QLC A;  2Y2M A;  3AZM C;  4E45 A;  3KXB D;  3B6G A;  1AOI A;  3V9R B;  1KU5 A;  4NFT A;  2YFV A;  3AYW D;  1P3M B;  4G92 C;  3W96 A;  4J8V A;  5B1M B;  1BH9 B;  1KX5 C;  4J8X B;  1F66 A;  4YM6 D;  1ZLA C;  5BO0 B;  3AV2 A;  1P34 D;  3LZ1 A;  3A6N D;  5AY8 C;  5GXQ B;  3AZK C;  5F99 A;  3MNN B;  4AWL B;  4R8P A;  3X1S C;  3R45 B;  1P3L A;  3AL0 C;  4ZUX C;  1ULY A;  5GT0 B;  1M1A B;  2BYK B;  3REI C;  3B6G D;  1AOI D;  3KWQ B;  4XZQ A;  5KDM A;  4J8U B;  3MGQ B;  1F66 D;  2Y2I A;  1P3F C;  5B2J A;  5BT1 D;  3AZG A;  3AZF C;  3KSY A;  5C3I B;  3NQU A;  5GT3 B;  1S32 B;  3C1C C;  5CHL B;  4X23 C;  5B33 A;  3UTB A;  1Q9C A;  1P3L D;  4HGA C;  4KGC B;  3VH6 T;  3AFA B;  1TAF B;  5B24 C;  2JE5 A;  4WU9 B;  4J8W B;  5B32 B;  3C1B B;  4XZQ D;  2IO5 C;  1P3B A;  3O62 C;  4J8V B;  2NZD C;  2F8N A;  3WTP E;  3EG5 B;  5AVB A;  3EPJ A;  3AZG D;  3LZ0 B;  2FJ7 B;  3A1I A;  4NE3 A;  1M18 B;  4LD9 D;  4CSR B;  3WTP A;  5GSU A;  4J8X C;  3H0R C;  5DNN B;  3UT9 B;  3X1T A;  1BH8 B;  1TZY C;  5AV6 B;  3AZI A;  4Z66 A;  2F8N G;  5GXQ C;  2J8P A;  3AN2 B;  3MNN C;  4AWL C;  3AZN C;  2JSS A;  5B1L C;  4WU8 D;  1P3O B;  2XD1 A;  1P3G D;  2PYO B;  2F8N D;  5CPI B;  2CV5 B;  5B31 B;  3MGR D;  5AY8 A;  4WV4 B;  4H9P A;  4Z5T A;  3X1V D;  1BFM A;  3AZJ C;  5AVC A;  4JJN A;  3WTP D;  1KX4 B;  4J8U C;  2VQR A;  3B0C T;  3B6F A;  5BNX B;  3AZM D;  3REI A;  3W97 A;  5BS7 A;  3X1T D;  5B0Y B;  1KX3 B;  1P3I B;  1ID3 B;  5C3I C;  5GT3 C;  3VH6 A;  5FUG A;  4XUJ A;  5BNV A;  1S32 C;  4ZBJ B;  3LJA B;  5AV5 A;  5B2I B;  1KX5 D;  5CPK A;  1R4V A;  4KGC C;  1ZLA D;  3AFA C;  3W99 C;  3MVD C;  5AY8 D;  4Z5T D;  2Y2Q A;  3AZK D;  4WU9 C;  3AZL B;  5JRG B;  4J8W C;  1P3P B;  3C1B C;  3UTA C;  3X1S D;  4ZUX D;  3H0L C;  3REI D;  5AV8 B;  2F8N H;  5GSU B;  3LZ0 C;  3MGP C;  2FJ7 C;  2Y2P A;  4XUJ D;  3WKJ B;  1M19 B;  5CP6 A;  3LEL A;  2ARO A;  3O62 A;  3UT9 C;  1P3F D;  5AV6 C;  1U35 B;  2Y2H A;  3KXB A;  2BYM A;  3MGS A;  3REL C;  3AZF D;  1JFI B;  3AYW A;  3AN2 C;  3C1C D;  4E44 A;  5B0Z B;  2ZY4 A;  1P3O C;  4H9R A;  1TZY A;  5CPI C;  3B0D C;  4YM6 A;  2CV5 C;  3NQJ A;  3REJ B;  1P34 A;  3A6N A;  2Y2O A;  2NQB B;  4KUD C;  3IP4 C;  3AZN A;  4YS3 B;  5AV9 B;  1P3K B;  2ARO D;  4H9O A;  1KX4 C;  5B1L A;  4H9S A;  3VH5 W;  5AV5 B;  3O62 D;  2NZD D;  1ID3 C;  5B0Y C;  1F1E A;  3MGS D;  3AZH B;  1HTA A;  2CWE A;  4WNN A;  3W98 C;  3WA9 B;  3LJA C;  4H9Q A;  3A1K A;  1HQ3 B;  2DQN C;  3AZE B;  1TZY D;  5E5A B;  4H9N A;  5GXQ D;  4CAY A;  1P3A C;  3AZL C;  3WAA B;  3MNN D;  5CPJ C;  5DNM B;  3AZN D;  2YFW A;  3KUY B;  2RVQ C;  5B1L D;  5B40 B;  5AV8 C;  3W99 A;  3WKJ C;  3KXB B;  3AZJ D;  4J8U D;  4G91 C;  2HIO C;  1U35 C;  1EQZ A;  3MGP A;  5GT3 D;  1S32 D;  5JA4 B;  4LD9 A;  3A6N B;  4KGC D;  3W99 D;  3MVD D;  3REJ C;  3REK B;  3AV1 B;  4QLC B;  2NQB C;  4WU9 D;  3REH C;  3X1U C;  4YS3 C;  4J8W D;  1AOI B;  3B6G B;  5AV9 C;  3C1B D;  2Y2N A;  3UTA D;  2Y2L A;  2YFV B;  4WU8 A;  3TU4 A;  3W96 B;  1P3G A;  1EQZ D;  3LZ0 D;  3MGP D;  3AZH C;  1F66 B;  3MGR A;  3X1V A;  4UUZ A;  1P3M C;  4KUD A;  1HQ3 C;  3AV2 B;  5B1M C;  2RIQ A;  3LZ1 B;  3AZE C;  2JCH A;  5F99 B;  3AZM A;  5AV6 D;  5E5A C;  4R8P B;  3REL D;  1P3L B;  3W98 A;  3AN2 D;  2Y2J A;  3WAA C;  3KUY C;  1KX5 A;  1P3O D;  1M1A C;  5GT0 C;  2G5I C;  4UPK A;  3TU4 D;  5B40 C;  5CPI D;  2CV5 D;  4XZQ B;  1ZLA A;  5KDM B;  1P3A A;  3AZK A;  5CPJ A;  5B2J B;  3KWQ C;  3AZG B;  4KUD D;  3NQU B;  3X1S A;  1KX4 D;  4ZUX A;  3MGQ C;  1ID3 D;  5B33 B;  3UTB B;  5B0Y D;  1B67 A;  3W98 D;  1H3O A;  2G5H C;  2ZY3 A;  2HIO A;  3EPL A;  1P3F A;  1N1J A;  3REK C;  3AZF A;  3AV1 C;  1P3B B;  4QLC C;  4KHA A;  1P3G B;  1P3A D;  2F8N B;  3AZL D;  3C1C A;  5CPJ D;  5AVB B;  4X23 A;  5B32 C;  3X1V B;  2RVQ D;  3VH5 T;  3W96 C;  4J8V C;  5AV8 D;  3WTP B;  5B24 A;  3WKJ D;  3REH A;  3X1T B;  3EPK A;  3X1U A;  1WWI A;  1M18 C;  3AZI B;  2LY8 A;  3AV2 C;  3LZ1 C;  4Z66 B;  4WJ3 C;  5G49 A;  4G92 B;  2HIO D;  5F99 C;  2NZD A;  2DF4 C;  5DNN C;  4R8P C;  1U35 D;  3V9R A;  1P3M A;  4X23 D;  1WWS A;  5B1M A;  1BH9 A;  5AY8 B;  4H9P B;  4Z5T B;  4J8X A;  5AVC B;  2PYO C;  4JJN B;  3REJ D;  5B31 C;  2NQB D;  5B24 D;  3B6F B;  3REH D;  3REI B;  5GXQ A;  3W97 B;  2FFF B;  5B2J C;  3X1U D;  4YS3 D;  3MNN A;  5AV9 D;  3AZG C;  3R45 A;  5FUG B;  4XUJ B;  5BNV B;  1M1A A;  5B33 C;  3UTB C;  1KX3 C;  2ZY2 A;  2BYK A;  1P3I C;  3AZH D;  5CPK B;  3EPH A;  4DRB A;  1P3M D;  3KWQ A;  4ZBJ C;  3AZJ A;  1HQ3 D; 
#chains in the Genus database with same CATH homology
 5B1M D;  5B2I C;  4J8U A;  3MGQ A;  4J8X D;  4NE6 A;  3VH5 A;  1P3B C;  4Z2M G;  5GT3 A;  1S32 A;  3WAA D;  2HUE B;  5AVB C;  5JRG C;  1P3P C;  1M1A D;  5GT0 D;  5CP6 B;  4KGC A;  5B40 D;  3LEL B;  2ARO B;  3WTP C;  3AFA A;  1TAF A;  1B6W A;  5GSU C;  3MVD A;  3O62 B;  2NZD B;  3X1T C;  4WU9 A;  1M19 C;  3KWQ D;  2BYM B;  3MGS B;  5B32 A;  4J8W A;  4Z66 C;  3C1B A;  3UTA A;  3AZI C;  3AYW B;  1PZR A;  3MGQ D;  1T3U A;  3LZ0 A;  2FJ7 A;  2W8S A;  4H9R B;  2XD5 A;  1TZY B;  1M18 A;  4YM6 B;  3F6T A;  5B0Z C;  4CSR A;  3NQJ B;  1P34 B;  4Z5T C;  5DNN A;  5B32 G;  3UT9 A;  5AVC C;  1BH8 A;  3AZN B;  4JJN C;  5AV6 A;  4H9O B;  3REK D;  3AFA D;  3REL A;  5B1L B;  3AV1 D;  4QLC D;  3B6F C;  2Y2K A;  5BS7 C;  3W97 C;  3AN2 A;  2F8N K;  2F2A C;  5B32 D;  1P3K C;  4XUJ C;  4WNN B;  3AZJ B;  4H9Q B;  5AV5 C;  4J8V D;  1P3O A;  2PYO A;  3W96 D;  5CPI A;  4Z2M H;  4WZS B;  2UWX A;  2CV5 A;  5CPK C;  2ZY5 A;  5B31 A;  2FJ7 D;  3WA9 C;  1M18 D;  3FDD A;  3AV2 D;  3LZ1 D;  4H9N B;  1KX4 A;  4CAY B;  5F99 D;  5BNX A;  1KX3 A;  5DNN D;  3UT9 D;  4R8P D;  1ID3 A;  5B0Y A;  2YFW B;  1P3I A;  2HUE C;  3LJA A;  3MVD B;  3W99 B;  5B31 G;  5DNM C;  5B2I A;  4EO5 B;  3P5J B;  5CP6 C;  3UTA B;  3LEL C;  2ARO C;  2PYO D;  5B31 D;  5B2J D;  3KXB C;  5JRG A;  3MGS C;  3MGP B;  3AZL A;  1P3P A;  1EQZ B;  3AYW C;  5B33 D;  3UTB D;  3B0B A;  4LD9 B;  1KX3 D;  5AV8 A;  1P3I D;  3WKJ A;  1M19 A;  4YM6 C;  2ZM5 A;  3REL B;  3LJA D;  1P34 C;  5B2I D;  3A6N C;  2BG1 A;  1U35 A;  4H9S C;  1JFI A;  1W2E A;  1P3B D;  4WU8 B;  3TU4 B;  3KFU G;  3B0D B;  3VH6 W;  5AVB D;  5B0Z A;  5JRG D;  1AOI C;  3B6G C;  1P3P D;  3MGR B;  4UUZ B;  4KUD B;  2Y2G A;  5GSU D;  3REJ A;  1F66 C;  2NQB A;  3AZM B;  1M19 D;  3AZI D;  5BT1 C;  4YS3 A;  4Z66 D;  5AV9 A;  1P3K A;  3W98 B;  1KX5 B;  3AZH A;  1P3L C;  3WA9 A;  1ZLA B;  5B0Z D;  1HQ3 A;  4EO5 C;  1P3A B;  3AZK B;  5CPJ B;  3AZE A;  5AVC D;  4JJN D;  1A7W A;  5E5A A;  3X1S B;  4NE5 A;  4XZQ C;  4ZUX B;  4M6B A;  5BO0 A;  3H0M C;  4DRA A;  3B6F D;  3W97 D;  3WAA A;  1EQZ C;  5DNM A;  1P3K D;  3KUY A;  5AV5 D;  1H3O B;  4LD9 C;  5GT0 A;  5B40 A;  5CPK D;  4G91 B;  2HIO B;  3B0C W;  3WA9 D;  1P3F B;  1N1J B;  3AZF B;  4KHA B;  3C1C B;  4X23 B;  3AZE D;  5E5A D;  3TU4 C;  4WU8 C;  4HGA B;  1P3G C;  5JA4 A;  5DNM D;  3MGR C;  3X1V C;  5B24 B;  3KUY D;  3REH B;  3X1U B;  5CP6 D;  1Z2C B;  3LEL D;  4DQY B;  5G49 B;  2L5A A;  3REK A;  2IO5 B;  3AV1 A;  4QLC A;  2Y2M A;  3AZM C;  4E45 A;  3KXB D;  3B6G A;  1AOI A;  3V9R B;  1KU5 A;  4NFT A;  2YFV A;  3AYW D;  1P3M B;  4G92 C;  3W96 A;  4J8V A;  5B1M B;  1BH9 B;  1KX5 C;  4J8X B;  1F66 A;  4YM6 D;  1ZLA C;  5BO0 B;  3AV2 A;  1P34 D;  3LZ1 A;  3A6N D;  5AY8 C;  5GXQ B;  3AZK C;  5F99 A;  3MNN B;  4AWL B;  4R8P A;  3X1S C;  3R45 B;  1P3L A;  3AL0 C;  4ZUX C;  1ULY A;  5GT0 B;  1M1A B;  2BYK B;  3REI C;  3B6G D;  1AOI D;  3KWQ B;  4XZQ A;  5KDM A;  4J8U B;  3MGQ B;  1F66 D;  2Y2I A;  1P3F C;  5B2J A;  5BT1 D;  3AZG A;  3AZF C;  3KSY A;  5C3I B;  3NQU A;  5GT3 B;  1S32 B;  3C1C C;  5CHL B;  4X23 C;  5B33 A;  3UTB A;  1Q9C A;  1P3L D;  4HGA C;  4KGC B;  3VH6 T;  3AFA B;  1TAF B;  5B24 C;  2JE5 A;  4WU9 B;  4J8W B;  5B32 B;  3C1B B;  4XZQ D;  2IO5 C;  1P3B A;  3O62 C;  4J8V B;  2NZD C;  2F8N A;  3WTP E;  3EG5 B;  5AVB A;  3EPJ A;  3AZG D;  3LZ0 B;  2FJ7 B;  3A1I A;  4NE3 A;  1M18 B;  4LD9 D;  4CSR B;  3WTP A;  5GSU A;  4J8X C;  3H0R C;  5DNN B;  3UT9 B;  3X1T A;  1BH8 B;  1TZY C;  5AV6 B;  3AZI A;  4Z66 A;  2F8N G;  5GXQ C;  2J8P A;  3AN2 B;  3MNN C;  4AWL C;  3AZN C;  2JSS A;  5B1L C;  4WU8 D;  1P3O B;  2XD1 A;  1P3G D;  2PYO B;  2F8N D;  5CPI B;  2CV5 B;  5B31 B;  3MGR D;  5AY8 A;  4WV4 B;  4H9P A;  4Z5T A;  3X1V D;  1BFM A;  3AZJ C;  5AVC A;  4JJN A;  3WTP D;  1KX4 B;  4J8U C;  2VQR A;  3B0C T;  3B6F A;  5BNX B;  3AZM D;  3REI A;  3W97 A;  5BS7 A;  3X1T D;  5B0Y B;  1KX3 B;  1P3I B;  1ID3 B;  5C3I C;  5GT3 C;  3VH6 A;  5FUG A;  4XUJ A;  5BNV A;  1S32 C;  4ZBJ B;  3LJA B;  5AV5 A;  5B2I B;  1KX5 D;  5CPK A;  1R4V A;  4KGC C;  1ZLA D;  3AFA C;  3W99 C;  3MVD C;  5AY8 D;  4Z5T D;  2Y2Q A;  3AZK D;  4WU9 C;  3AZL B;  5JRG B;  4J8W C;  1P3P B;  3C1B C;  3UTA C;  3X1S D;  4ZUX D;  3H0L C;  3REI D;  5AV8 B;  2F8N H;  5GSU B;  3LZ0 C;  3MGP C;  2FJ7 C;  2Y2P A;  4XUJ D;  3WKJ B;  1M19 B;  5CP6 A;  3LEL A;  2ARO A;  3O62 A;  3UT9 C;  1P3F D;  5AV6 C;  1U35 B;  2Y2H A;  3KXB A;  2BYM A;  3MGS A;  3REL C;  3AZF D;  1JFI B;  3AYW A;  3AN2 C;  3C1C D;  4E44 A;  5B0Z B;  2ZY4 A;  1P3O C;  4H9R A;  1TZY A;  5CPI C;  3B0D C;  4YM6 A;  2CV5 C;  3NQJ A;  3REJ B;  1P34 A;  3A6N A;  2Y2O A;  2NQB B;  4KUD C;  3IP4 C;  3AZN A;  4YS3 B;  5AV9 B;  1P3K B;  2ARO D;  4H9O A;  1KX4 C;  5B1L A;  4H9S A;  3VH5 W;  5AV5 B;  3O62 D;  2NZD D;  1ID3 C;  5B0Y C;  1F1E A;  3MGS D;  3AZH B;  1HTA A;  2CWE A;  4WNN A;  3W98 C;  3WA9 B;  3LJA C;  4H9Q A;  3A1K A;  1HQ3 B;  2DQN C;  3AZE B;  1TZY D;  5E5A B;  4H9N A;  5GXQ D;  4CAY A;  1P3A C;  3AZL C;  3WAA B;  3MNN D;  5CPJ C;  5DNM B;  3AZN D;  2YFW A;  3KUY B;  2RVQ C;  5B1L D;  5B40 B;  5AV8 C;  3W99 A;  3WKJ C;  3KXB B;  3AZJ D;  4J8U D;  4G91 C;  2HIO C;  1U35 C;  1EQZ A;  3MGP A;  5GT3 D;  1S32 D;  5JA4 B;  4LD9 A;  3A6N B;  4KGC D;  3W99 D;  3MVD D;  3REJ C;  3REK B;  3AV1 B;  4QLC B;  2NQB C;  4WU9 D;  3REH C;  3X1U C;  4YS3 C;  4J8W D;  1AOI B;  3B6G B;  5AV9 C;  3C1B D;  2Y2N A;  3UTA D;  2Y2L A;  2YFV B;  4WU8 A;  3TU4 A;  3W96 B;  1P3G A;  1EQZ D;  3LZ0 D;  3MGP D;  3AZH C;  1F66 B;  3MGR A;  3X1V A;  4UUZ A;  1P3M C;  4KUD A;  1HQ3 C;  3AV2 B;  5B1M C;  2RIQ A;  3LZ1 B;  3AZE C;  2JCH A;  5F99 B;  3AZM A;  5AV6 D;  5E5A C;  4R8P B;  3REL D;  1P3L B;  3W98 A;  3AN2 D;  2Y2J A;  3WAA C;  3KUY C;  1KX5 A;  1P3O D;  1M1A C;  5GT0 C;  2G5I C;  4UPK A;  3TU4 D;  5B40 C;  5CPI D;  2CV5 D;  4XZQ B;  1ZLA A;  5KDM B;  1P3A A;  3AZK A;  5CPJ A;  5B2J B;  3KWQ C;  3AZG B;  4KUD D;  3NQU B;  3X1S A;  1KX4 D;  4ZUX A;  3MGQ C;  1ID3 D;  5B33 B;  3UTB B;  5B0Y D;  1B67 A;  3W98 D;  1H3O A;  2G5H C;  2ZY3 A;  2HIO A;  3EPL A;  1P3F A;  1N1J A;  3REK C;  3AZF A;  3AV1 C;  1P3B B;  4QLC C;  4KHA A;  1P3G B;  1P3A D;  2F8N B;  3AZL D;  3C1C A;  5CPJ D;  5AVB B;  4X23 A;  5B32 C;  3X1V B;  2RVQ D;  3VH5 T;  3W96 C;  4J8V C;  5AV8 D;  3WTP B;  5B24 A;  3WKJ D;  3REH A;  3X1T B;  3EPK A;  3X1U A;  1WWI A;  1M18 C;  3AZI B;  2LY8 A;  3AV2 C;  3LZ1 C;  4Z66 B;  4WJ3 C;  5G49 A;  4G92 B;  2HIO D;  5F99 C;  2NZD A;  2DF4 C;  5DNN C;  4R8P C;  1U35 D;  3V9R A;  1P3M A;  4X23 D;  1WWS A;  5B1M A;  1BH9 A;  5AY8 B;  4H9P B;  4Z5T B;  4J8X A;  5AVC B;  2PYO C;  4JJN B;  3REJ D;  5B31 C;  2NQB D;  5B24 D;  3B6F B;  3REH D;  3REI B;  5GXQ A;  3W97 B;  2FFF B;  5B2J C;  3X1U D;  4YS3 D;  3MNN A;  5AV9 D;  3AZG C;  3R45 A;  5FUG B;  4XUJ B;  5BNV B;  1M1A A;  5B33 C;  3UTB C;  1KX3 C;  2ZY2 A;  2BYK A;  1P3I C;  3AZH D;  5CPK B;  3EPH A;  4DRB A;  1P3M D;  3KWQ A;  4ZBJ C;  3AZJ A;  1HQ3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...