3WKJA

The nucleosome containing human tsh2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjA00
3AZNB 3UTAA 4ZBJC 3A6NC 4R8PD 5CPJB 3C1BB 3LELB 2FJ7D 3W96B 4NFTA 1ID3B 2CV5C 1KX4A 5GT0A 3AZJD 3REKC 3B6GD 4Z5TC 3TU4C 3W97B 4NE6A 1P3PD 2RVQD 1P3LC 5B1LD 3UTBB 5GSUC 5B40C 1M1AA 1Q9CA 5AV8A 1HQ3B 3AZHB 3AZIA 4J8XC 5G49A 4XZQA 3UTAC 4ZUXB 3REHA 3W96D 5AVBA 5GT0C 2YFVB 4JJNB 1KX4C 5AV5D 1P34A 3KXBD 3AZFB 2F8ND 1P3KA 1H3OA 3WTPE 5CPID 5KDMA 5B1MB 4H9SA 3AZIC 2AROB 4WU8D 1BFMA 3WKJA 4M6BA 4EO5C 4XZQC 3W98A 1WWSA 3LJAB 1P3AC 1EQZA 4WV4B 3AN2A 3REHC 4H9NB 4KUDD 3A6NB 4KHAA 5AVBC 2BYMB 3C1CD 5B0YB 5GT3D 5AV9C 2CV5B 1P34C 5B0ZA 1F1EA 3AYWB 3MVDA 4Z5TB 1B6WA 1BH9B 4AWLC 3WTPC 3WA9C 1P3KC 4E45A 1P3LB 1P3BD 3MGRA 4J8UD 5GSUB 2NQBC 1P3OD 4WU9D 4J8WD 4YS3B 4H9OA 3W98C 3AZKA 5B32D 1EQZC 5BT1D 3UTAB 3MGQC 5AV6C 4R8PA 2FJ7A 3B6FB 3O62A 1KX4B 5GT0B 3MVDC 3AZJA 3REKD 3B6GA 3VH5W 3TU4D 4J8VA 4X23D 3MGRC 1P3LD 5B1LA 1M1AB 5AV8B 5GSUD 5B40D 5F99D 3AZKC 2CWEA 5G49B 4EO5B 4J8XD 4XZQB 4XUJD 5BS7C 2PYOD 3W99C 1WWIA 3O62C 1KX4D 3AZJC 1P34B 5AV5A 4J8VC 4CAYA 2NZDD 3B0DC 3KXBA 3B0CT 3UT9C 1P3KB 2F8NA 1F66D 1H3OB 5CPIA 3AZID 4WU8A 3WKJB 1EQZB 3AN2B 1P3AD 4KHAB 3REHD 4KUDA 5AVBD 3C1CA 5AV5C 5GT3A 5AV9D 5B0ZB 3MVDB 1KX5C 3NQJA 3WTPD 3WA9D 3MGRB 1P3BA 5B2JA 4J8UA 2NQBD 1P3OA 4WU9A 1KU5A 4H9OB 3AZKB 3W98D 1EQZD 5B32A 1AOID 3KSYA 4E44A 4R8PB 3MGQD 3C1CC 5AV6D 1P3FA 2FJ7B 4DRAA 5GT3C 3AZEC 3AZJB 3B6GB 3X1SC 4J8VB 3X1VD 3REKA 3TU4A 1HTAA 3B0DB 4X23A 5B1LB 5B2JC 2HIOD 3MGRD 1P3OC 1U35C 5B40A 5F99A 5GXQA 4XUJA 2PYOA 3X1TA 4Z2MH 3W99D 1P3FC 3O62D 5JRGA 5AV5B 3REJC 1B67A 4CAYB 1P3MA 4J8VD 3KXBB 4X23C 3REIC 2F8NB 2NZDA 3UT9D 1F66A 5CPIB 4WU8B 5F99C 5GXQC 4UUZA 4XUJC 2PYOC 3X1TC 4G92C 1P3AA 4KUDB 5JRGC 3C1CB 3AFAC 5GT3B 5B2IA 3LZ1C 5AV9A 4YM6C 1P3MC 3V9RA 3NQJB 2NZDC 1KX5D 3MNNA 1F66C 3WTPA 1P3BB 5B2JB 3WA9A 4J8UB 5BNVA 5E5AD 1P3OB 4WU9B 3WAAA 2NQBA 4J8WB 5CPKC 1JFIA 2HUEC 1N1JA 5B32B 1AOIA 4ZBJB 2F8NK 1P3IA 2IO5C 3MGPA 5B2IC 3MGQA 4H9QA 5AV6A 3AZED 3REKB 4Z66C 3MNNC 3X1SD 3TU4B 3X1VA 4X23B 5B2JD 2HIOA 3WAAC 1M19C 5B40B 4CSRA 5B31A 1ZLAC 1U35D 5F99B 1M18A 4J8XB 4XUJB 2PYOB 4WNNA 5BS7A 1AOIC 5AVCA 4G92B 1P3IC 3MGPC 1P3FD 3W99A 5JRGB 3REJD 4HGAC 3X1VC 1P3MB 2NZDB 4KGCC 3REID 2HIOC 3MGSA 1F66B 3UT9A 5B31C 1M18C 3AZIB 5GXQD 3AV2A 4UUZB 3X1UA 2HUEB 5AVCC 5B33D 1P3AB 3X1TD 3REHB 5AVBB 1TAFA 2IO5B 5JRGD 5DNNC 5B2IB 3AFAD 5AV9B 3V9RB 3AZLC 3LZ1D 1P3MD 4YM6D 3MNNB 3MGSC 4AWLB 1KX5A 1R4VA 3WTPB 3WA9B 5BNVB 5KDMB 3WAAB 2NQBB 5E5AA 3AV2C 2L5AA 1JFIB 3AZGD 3X1UC 5CPKD 3W98B 3NQUA 5B24D 1KX3A 3B0CW 1AOIB 1P3IB 3MGQB 4H9QB 5AV6B 5B2ID 5FUGA 1P3GD 5CPJA 3AZEA 3X1VB 4Z66D 3MNND 3X1SA 3AV1C 2HIOB 5CP6A 1BH8A 5E5AC 4CSRB 1M19D 3WAAD 5DNMD 1M18B 1ZLAD 1U35A 1KX3C 4WNNB 5AVCB 5BNXA 1P3ID 3W99B 3MGPD 3O62B 3AZNC 5CPJC 1ID3C 3REJA 5CHLB 4KGCD 3MGSB 5CP6C 4H9RA 3REIA 3UT9B 3LZ0A 5B31D 2LY8A 3AZFA 1M18D 3AV2B 2F8NG 1HQ3C 2AROA 4QLCD 5AVCD 5B33A 1TAFB 2YFWA 5JA4A 5C3IC 5DNND 3AFAA 4H9NA 4JJNC 3AZLD 3LZ1A 2BYMA 4YM6A 1KX5B 3MGSD 3LZ0C 3AZFC 5E5AB 1ULYA 3AZMA 3AV2D 3AZGA 3X1UD 5B1MC 4DRBA 5CPKA 2AROC 3NQUB 1S32D 5B33C 2BYKA 5B24A 4LD9A 5FUGB 5B32G 3AZEB 5B0YC 1P3GA 3B6FA 3X1SB 5BO0A 4Z66A 3AYWC 5CP6B 1A7WA 1BH8B 3AV1D 5AY8A 3AZMC 1M19A 1U35B 5DNMA 2JSSA 3AZGC 1ZLAA 4YS3C 5B24C 1KX3D 4LD9C 5BNXB 3KUYA 1P3FB 5C3IB 3AZND 5CPJD 3C1BD 3LELD 3REJB 1P3GC 3B6FC 1ID3D 2F8NH 4H9RB 3REIB 4KGCA 5CP6D 5AY8C 3W97D 3LZ0B 5DNMC 3UTBD 3R45A 1M1AC 5GXQB 5AV8C 1HQ3D 3AZHD 5B33B 3X1TB 4QLCA 3KUYC 5JA4B 2YFWB 4ZUXD 3AFAB 5DNNA 3LZ1B 4YM6B 4JJND 3AZLA 1TZYA 4G91C 4NE5A 3LZ0D 3RELA 3KWQA 3AZFD 3AZMB 3AZGB 4H9SC 5CPKB 5B1MD 3B0BA 3WKJC 2AROD 4H9PA 2BYKB 5B24B 4QLCC 3VH5T 1S32A 4LD9B 4NE3A 3VH6T 3AN2C 3LJAD 3A6ND 1P3GB 1TZYC 5BO0B 4Z66B 5B0YD 5B0ZC 2CV5D 3RELC 3AYWD 4Z5TD 3KWQC 5AY8B 3AV1A 1P3PA 1M19B 3VH6W 3AZMD 5DNMB 1ZLAB 1N1JB 1S32C 5B31G 4YS3D 4LD9D 3KUYB 3MGPB 3UTAD 4R8PC 3AZNA 2FJ7C 3B6FD 4HGAB 3W96A 3LELA 3C1BA 5GT0D 1ID3A 4G91B 3B6GC 4KGCB 5AY8D 1P3PC 4Z2MG 2RVQC 3W97A 4WZSB 5B31B 5B1LC 3R45B 3UTBA 1M1AD 5AV8D 1HQ3A 3AZHA 4QLCB 3KUYD 4XZQD 5DNNB 4ZUXA 3C1BC 3W96C 3LELC 3AZLB 1TZYB 4JJNA 2YFVA 1P34D 3VH5A 3RELB 3W97C 3KXBC 3VH6A 3KWQB 3UTBC 1P3KD 5CPIC 3X1UB 4WU8C 4H9PB 5B1MA 3AZHC 3WKJD 1S32B 4J8WA 3AN2D 4ZUXC 3LJAA 4KUDC 3A6NA 1TZYD 5B0YA 5B0ZD 2CV5A 3MVDD 3AV1B 3RELD 3AYWA 4Z5TA 3KWQD 1P3PB 1BH9A 1P3BC 1P3LA 4J8UC 4WU9C 5GSUA 4J8WC 1KX3B 3AZKD 4YS3A 5B32C 4J8XA 5BT1C 3LJAC
chains in the Genus database with same CATH superfamily
3AZNB 3UTAA 4ZBJC 3A6NC 4R8PD 5CPJB 3C1BB 3LELB 2FJ7D 3W96B 4NFTA 1ID3B 2CV5C 1KX4A 5GT0A 3AZJD 3REKC 3B6GD 4Z5TC 3TU4C 3W97B 4NE6A 1P3PD 2RVQD 1P3LC 5B1LD 3UTBB 5GSUC 5B40C 1M1AA 1Q9CA 5AV8A 1HQ3B 3AZHB 3AZIA 2Y2MA 4J8XC 5G49A 4DQYB 4XZQA 3UTAC 4ZUXB 3REHA 3W96D 5AVBA 5GT0C 2YFVB 4JJNB 1KX4C 5AV5D 1P34A 3KXBD 3AZFB 2F8ND 1P3KA 1H3OA 3WTPE 5CPID 5KDMA 5B1MB 4H9SA 3AZIC 2AROB 2VQRA 4WU8D 1BFMA 3WKJA 4M6BA 3KFUG 4EO5C 4XZQC 3W98A 1WWSA 3LJAB 1P3AC 3A1KA 1EQZA 4WV4B 3AN2A 3REHC 4H9NB 4KUDD 3A6NB 4KHAA 5AVBC 2BYMB 3FDDA 3C1CD 5B0YB 5GT3D 5AV9C 2CV5B 1P34C 5B0ZA 1F1EA 3AYWB 3MVDA 4Z5TB 1B6WA 1BH9B 4AWLC 3WTPC 3WA9C 1P3KC 4E45A 1P3LB 1P3BD 3MGRA 4J8UD 5GSUB 2NQBC 1P3OD 4WU9D 4J8WD 4YS3B 4H9OA 3W98C 3AZKA 5B32D 1EQZC 5BT1D 3UTAB 3MGQC 5AV6C 4R8PA 2FJ7A 3B6FB 3O62A 1KX4B 5GT0B 3MVDC 3AZJA 3REKD 3B6GA 3VH5W 3TU4D 4J8VA 4X23D 3MGRC 1P3LD 5B1LA 1M1AB 5AV8B 5GSUD 5B40D 5F99D 3AZKC 2CWEA 5G49B 2DQNC 4EO5B 4J8XD 4XZQB 4XUJD 5BS7C 2PYOD 2Y2HA 3W99C 1WWIA 3O62C 1KX4D 3AL0C 3AZJC 1P34B 5AV5A 4J8VC 4CAYA 2Y2OA 3B0DC 2NZDD 3KXBA 3B0CT 3UT9C 1P3KB 2F8NA 1F66D 1H3OB 5CPIA 2JCHA 3AZID 4WU8A 3WKJB 1EQZB 3AN2B 1P3AD 4KHAB 3REHD 4KUDA 5AVBD 3C1CA 5AV5C 5GT3A 5AV9D 5B0ZB 3MVDB 1KX5C 3NQJA 3WTPD 3WA9D 3MGRB 2ZY4A 1P3BA 5B2JA 4J8UA 2NQBD 1P3OA 4WU9A 1KU5A 4H9OB 3AZKB 2ZY3A 3W98D 1EQZD 5B32A 1AOID 3KSYA 4E44A 4R8PB 3MGQD 3C1CC 5AV6D 1P3FA 2FJ7B 4DRAA 5GT3C 3AZEC 3AZJB 3B6GB 3X1SC 4J8VB 3X1VD 3REKA 3TU4A 1HTAA 3B0DB 4X23A 5B1LB 5B2JC 2HIOD 3MGRD 1P3OC 1U35C 5B40A 5F99A 5GXQA 4XUJA 2PYOA 3X1TA 4Z2MH 3W99D 1P3FC 3O62D 5JRGA 5AV5B 3REJC 1B67A 4CAYB 1P3MA 4J8VD 3KXBB 4X23C 3REIC 2F8NB 2NZDA 3UT9D 1F66A 5CPIB 4WU8B 5F99C 5GXQC 4UUZA 4XUJC 2PYOC 3X1TC 4G92C 1P3AA 4KUDB 5JRGC 3C1CB 3AFAC 4UPKA 5GT3B 5B2IA 3LZ1C 5AV9A 4YM6C 1P3MC 3V9RA 3NQJB 2NZDC 1KX5D 3MNNA 1F66C 3WTPA 1P3BB 5B2JB 2XD1A 3WA9A 4J8UB 5BNVA 5E5AD 1P3OB 4WU9B 3WAAA 2NQBA 4J8WB 5CPKC 1JFIA 2HUEC 1N1JA 5B32B 1AOIA 4ZBJB 2F8NK 1P3IA 2IO5C 3MGPA 5B2IC 3MGQA 4H9QA 5AV6A 2W8SA 3AZED 3REKB 4Z66C 3MNNC 3X1SD 3TU4B 3X1VA 4X23B 5B2JD 2HIOA 2J8PA 3WAAC 1M19C 5B40B 4CSRA 5B31A 1ZLAC 1U35D 5F99B 1M18A 1T3UA 4J8XB 4XUJB 2PYOB 4WNNA 5BS7A 1AOIC 5AVCA 4G92B 1P3IC 3MGPC 3H0RC 1P3FD 3W99A 5JRGB 3REJD 4HGAC 3X1VC 1P3MB 2NZDB 4KGCC 3REID 2DF4C 2HIOC 3MGSA 1F66B 3UT9A 2Y2IA 5B31C 2Y2QA 1M18C 3AZIB 5GXQD 3AV2A 4UUZB 2ZY2A 3X1UA 2HUEB 2RIQA 5AVCC 5B33D 1P3AB 3X1TD 3REHB 5AVBB 1TAFA 2IO5B 2Y2JA 5JRGD 5DNNC 5B2IB 3AFAD 5AV9B 3V9RB 3AZLC 3LZ1D 1P3MD 4YM6D 3MNNB 3MGSC 4AWLB 1KX5A 1R4VA 3WTPB 3WA9B 5BNVB 5KDMB 3WAAB 2Y2LA 2NQBB 5E5AA 2Y2KA 3A1IA 3AV2C 2L5AA 1JFIB 3AZGD 3X1UC 5CPKD 3W98B 3NQUA 5B24D 1KX3A 3B0CW 1AOIB 1P3IB 3MGQB 4H9QB 5AV6B 5B2ID 2ZM5A 5FUGA 1P3GD 5CPJA 3AZEA 3X1VB 4Z66D 3IP4C 3MNND 3X1SA 2BG1A 3AV1C 2HIOB 5CP6A 1BH8A 5E5AC 4CSRB 1M19D 3WAAD 5DNMD 1M18B 1ZLAD 1U35A 1KX3C 4WNNB 5AVCB 3EPLA 3EPJA 5BNXA 3F6TA 1P3ID 3W99B 3MGPD 3O62B 3AZNC 5CPJC 1ID3C 3REJA 5CHLB 4KGCD 3MGSB 5CP6C 4H9RA 3REIA 3UT9B 3LZ0A 5B31D 2LY8A 3AZFA 3H0MC 1M18D 3AV2B 2F8NG 1HQ3C 2AROA 4QLCD 5AVCD 5B33A 1TAFB 2YFWA 5JA4A 5C3IC 5DNND 3AFAA 4H9NA 2JE5A 4JJNC 3AZLD 3LZ1A 2BYMA 4YM6A 2UWXA 1W2EA 1KX5B 3MGSD 3LZ0C 3AZFC 5E5AB 1ULYA 3AZMA 3AV2D 3AZGA 3X1UD 5B1MC 4DRBA 5CPKA 2AROC 3NQUB 1S32D 5B33C 2BYKA 5B24A 4LD9A 5FUGB 5B32G 3AZEB 5B0YC 1P3GA 3B6FA 3X1SB 5BO0A 4Z66A 3AYWC 5CP6B 1A7WA 1BH8B 3AV1D 5AY8A 3AZMC 1M19A 1U35B 5DNMA 2JSSA 3AZGC 1ZLAA 4YS3C 5B24C 1KX3D 4LD9C 5BNXB 3KUYA 1P3FB 5C3IB 3AZND 5CPJD 3C1BD 3LELD 3REJB 1P3GC 3B6FC 1ID3D 2F8NH 4H9RB 3REIB 4KGCA 5CP6D 5AY8C 3W97D 3LZ0B 2Y2NA 5DNMC 3UTBD 3R45A 1M1AC 5GXQB 5AV8C 1HQ3D 3AZHD 5B33B 3X1TB 2G5HC 4QLCA 3KUYC 5JA4B 2YFWB 4ZUXD 3AFAB 5DNNA 2Y2PA 3LZ1B 4YM6B 3EPHA 4JJND 3AZLA 1TZYA 4G91C 4NE5A 3LZ0D 3RELA 3KWQA 3AZFD 3AZMB 3AZGB 4H9SC 5CPKB 5B1MD 3B0BA 3WKJC 2AROD 4H9PA 2BYKB 5B24B 4QLCC 3VH5T 1S32A 4LD9B 4NE3A 3VH6T 3AN2C 3LJAD 1Z2CB 3A6ND 1P3GB 1TZYC 5BO0B 4Z66B 5B0YD 5B0ZC 2CV5D 2F2AC 3RELC 3AYWD 4Z5TD 3KWQC 5AY8B 3AV1A 1P3PA 1M19B 3VH6W 3AZMD 5DNMB 1ZLAB 3P5JB 1N1JB 1S32C 5B31G 4YS3D 4LD9D 3KUYB 3MGPB 3UTAD 4R8PC 3AZNA 2FJ7C 3B6FD 4HGAB 3W96A 3LELA 3C1BA 5GT0D 1ID3A 2ZY5A 4WJ3C 4G91B 3B6GC 4KGCB 5AY8D 1P3PC 4Z2MG 2RVQC 3W97A 4WZSB 5B31B 5B1LC 3R45B 3UTBA 1M1AD 5AV8D 1HQ3A 3AZHA 4QLCB 3KUYD 4XZQD 5DNNB 4ZUXA 3C1BC 3W96C 3LELC 3AZLB 1TZYB 4JJNA 2YFVA 1P34D 3VH5A 3RELB 2XD5A 3W97C 3KXBC 3VH6A 3KWQB 3UTBC 1P3KD 5CPIC 3X1UB 4WU8C 3EG5B 4H9PB 5B1MA 3AZHC 3WKJD 1S32B 4J8WA 3AN2D 4ZUXC 3LJAA 4KUDC 2FFFB 3A6NA 1TZYD 5B0YA 5B0ZD 2CV5A 3MVDD 3AV1B 2Y2GA 3RELD 3AYWA 4Z5TA 3KWQD 3EPKA 1P3PB 1BH9A 1P3BC 1P3LA 3H0LC 4J8UC 4WU9C 5GSUA 4J8WC 1KX3B 3AZKD 4YS3A 2G5IC 5B32C 4J8XA 5BT1C 3LJAC 1PZRA
chains in the Genus database with same CATH topology
3AZNB 3UTAA 4ZBJC 3A6NC 4R8PD 5CPJB 3C1BB 3LELB 2FJ7D 3W96B 4NFTA 1ID3B 2CV5C 1KX4A 5GT0A 3AZJD 3REKC 3B6GD 4Z5TC 3TU4C 3W97B 4NE6A 1P3PD 2RVQD 1P3LC 5B1LD 3UTBB 5GSUC 5B40C 1M1AA 1Q9CA 5AV8A 1HQ3B 3AZHB 3AZIA 2Y2MA 4J8XC 5G49A 4DQYB 4XZQA 3UTAC 4ZUXB 3REHA 3W96D 5AVBA 5GT0C 2YFVB 4JJNB 1KX4C 5AV5D 1P34A 3KXBD 3AZFB 2F8ND 1P3KA 1H3OA 3WTPE 5CPID 5KDMA 5B1MB 4H9SA 3AZIC 2AROB 2VQRA 4WU8D 1BFMA 3WKJA 4M6BA 3KFUG 4EO5C 4XZQC 3W98A 1WWSA 3LJAB 1P3AC 3A1KA 1EQZA 4WV4B 3AN2A 3REHC 4H9NB 4KUDD 3A6NB 4KHAA 5AVBC 2BYMB 3FDDA 3C1CD 5B0YB 5GT3D 5AV9C 2CV5B 1P34C 5B0ZA 1F1EA 3AYWB 3MVDA 4Z5TB 1B6WA 1BH9B 4AWLC 3WTPC 3WA9C 1P3KC 4E45A 1P3LB 1P3BD 3MGRA 4J8UD 5GSUB 2NQBC 1P3OD 4WU9D 4J8WD 4YS3B 4H9OA 3W98C 3AZKA 5B32D 1EQZC 5BT1D 3UTAB 3MGQC 5AV6C 4R8PA 2FJ7A 3B6FB 3O62A 1KX4B 5GT0B 3MVDC 3AZJA 3REKD 3B6GA 3VH5W 3TU4D 4J8VA 4X23D 3MGRC 1P3LD 5B1LA 1M1AB 5AV8B 5GSUD 5B40D 5F99D 3AZKC 2CWEA 5G49B 2DQNC 4EO5B 4J8XD 4XZQB 4XUJD 5BS7C 2PYOD 2Y2HA 3W99C 1WWIA 3O62C 1KX4D 3AL0C 3AZJC 1P34B 5AV5A 4J8VC 4CAYA 2Y2OA 3B0DC 2NZDD 3KXBA 3B0CT 3UT9C 1P3KB 2F8NA 1F66D 1H3OB 5CPIA 2JCHA 3AZID 4WU8A 3WKJB 1EQZB 3AN2B 1P3AD 4KHAB 3REHD 4KUDA 5AVBD 3C1CA 5AV5C 5GT3A 5AV9D 5B0ZB 3MVDB 1KX5C 3NQJA 3WTPD 3WA9D 3MGRB 2ZY4A 1P3BA 5B2JA 4J8UA 2NQBD 1P3OA 4WU9A 1KU5A 4H9OB 3AZKB 2ZY3A 3W98D 1EQZD 5B32A 1AOID 3KSYA 4E44A 4R8PB 3MGQD 3C1CC 5AV6D 1P3FA 2FJ7B 4DRAA 5GT3C 3AZEC 3AZJB 3B6GB 3X1SC 4J8VB 3X1VD 3REKA 3TU4A 1HTAA 3B0DB 4X23A 5B1LB 5B2JC 2HIOD 3MGRD 1P3OC 1U35C 5B40A 5F99A 5GXQA 4XUJA 2PYOA 3X1TA 4Z2MH 3W99D 1P3FC 3O62D 5JRGA 5AV5B 3REJC 1B67A 4CAYB 1P3MA 4J8VD 3KXBB 4X23C 3REIC 2F8NB 2NZDA 3UT9D 1F66A 5CPIB 4WU8B 5F99C 5GXQC 4UUZA 4XUJC 2PYOC 3X1TC 4G92C 1P3AA 4KUDB 5JRGC 3C1CB 3AFAC 4UPKA 5GT3B 5B2IA 3LZ1C 5AV9A 4YM6C 1P3MC 3V9RA 3NQJB 2NZDC 1KX5D 3MNNA 1F66C 3WTPA 1P3BB 5B2JB 2XD1A 3WA9A 4J8UB 5BNVA 5E5AD 1P3OB 4WU9B 3WAAA 2NQBA 4J8WB 5CPKC 1JFIA 2HUEC 1N1JA 5B32B 1AOIA 4ZBJB 2F8NK 1P3IA 2IO5C 3MGPA 5B2IC 3MGQA 4H9QA 5AV6A 2W8SA 3AZED 3REKB 4Z66C 3MNNC 3X1SD 3TU4B 3X1VA 4X23B 5B2JD 2HIOA 2J8PA 3WAAC 1M19C 5B40B 4CSRA 5B31A 1ZLAC 1U35D 5F99B 1M18A 1T3UA 4J8XB 4XUJB 2PYOB 4WNNA 5BS7A 1AOIC 5AVCA 4G92B 1P3IC 3MGPC 3H0RC 1P3FD 3W99A 5JRGB 3REJD 4HGAC 3X1VC 1P3MB 2NZDB 4KGCC 3REID 2DF4C 2HIOC 3MGSA 1F66B 3UT9A 2Y2IA 5B31C 2Y2QA 1M18C 3AZIB 5GXQD 3AV2A 4UUZB 2ZY2A 3X1UA 2HUEB 2RIQA 5AVCC 5B33D 1P3AB 3X1TD 3REHB 5AVBB 1TAFA 2IO5B 2Y2JA 5JRGD 5DNNC 5B2IB 3AFAD 5AV9B 3V9RB 3AZLC 3LZ1D 1P3MD 4YM6D 3MNNB 3MGSC 4AWLB 1KX5A 1R4VA 3WTPB 3WA9B 5BNVB 5KDMB 3WAAB 2Y2LA 2NQBB 5E5AA 2Y2KA 3A1IA 3AV2C 2L5AA 1JFIB 3AZGD 3X1UC 5CPKD 3W98B 3NQUA 5B24D 1KX3A 3B0CW 1AOIB 1P3IB 3MGQB 4H9QB 5AV6B 5B2ID 2ZM5A 5FUGA 1P3GD 5CPJA 3AZEA 3X1VB 4Z66D 3IP4C 3MNND 3X1SA 2BG1A 3AV1C 2HIOB 5CP6A 1BH8A 5E5AC 4CSRB 1M19D 3WAAD 5DNMD 1M18B 1ZLAD 1U35A 1KX3C 4WNNB 5AVCB 3EPLA 3EPJA 5BNXA 3F6TA 1P3ID 3W99B 3MGPD 3O62B 3AZNC 5CPJC 1ID3C 3REJA 5CHLB 4KGCD 3MGSB 5CP6C 4H9RA 3REIA 3UT9B 3LZ0A 5B31D 2LY8A 3AZFA 3H0MC 1M18D 3AV2B 2F8NG 1HQ3C 2AROA 4QLCD 5AVCD 5B33A 1TAFB 2YFWA 5JA4A 5C3IC 5DNND 3AFAA 4H9NA 2JE5A 4JJNC 3AZLD 3LZ1A 2BYMA 4YM6A 2UWXA 1W2EA 1KX5B 3MGSD 3LZ0C 3AZFC 5E5AB 1ULYA 3AZMA 3AV2D 3AZGA 3X1UD 5B1MC 4DRBA 5CPKA 2AROC 3NQUB 1S32D 5B33C 2BYKA 5B24A 4LD9A 5FUGB 5B32G 3AZEB 5B0YC 1P3GA 3B6FA 3X1SB 5BO0A 4Z66A 3AYWC 5CP6B 1A7WA 1BH8B 3AV1D 5AY8A 3AZMC 1M19A 1U35B 5DNMA 2JSSA 3AZGC 1ZLAA 4YS3C 5B24C 1KX3D 4LD9C 5BNXB 3KUYA 1P3FB 5C3IB 3AZND 5CPJD 3C1BD 3LELD 3REJB 1P3GC 3B6FC 1ID3D 2F8NH 4H9RB 3REIB 4KGCA 5CP6D 5AY8C 3W97D 3LZ0B 2Y2NA 5DNMC 3UTBD 3R45A 1M1AC 5GXQB 5AV8C 1HQ3D 3AZHD 5B33B 3X1TB 2G5HC 4QLCA 3KUYC 5JA4B 2YFWB 4ZUXD 3AFAB 5DNNA 2Y2PA 3LZ1B 4YM6B 3EPHA 4JJND 3AZLA 1TZYA 4G91C 4NE5A 3LZ0D 3RELA 3KWQA 3AZFD 3AZMB 3AZGB 4H9SC 5CPKB 5B1MD 3B0BA 3WKJC 2AROD 4H9PA 2BYKB 5B24B 4QLCC 3VH5T 1S32A 4LD9B 4NE3A 3VH6T 3AN2C 3LJAD 1Z2CB 3A6ND 1P3GB 1TZYC 5BO0B 4Z66B 5B0YD 5B0ZC 2CV5D 2F2AC 3RELC 3AYWD 4Z5TD 3KWQC 5AY8B 3AV1A 1P3PA 1M19B 3VH6W 3AZMD 5DNMB 1ZLAB 3P5JB 1N1JB 1S32C 5B31G 4YS3D 4LD9D 3KUYB 3MGPB 3UTAD 4R8PC 3AZNA 2FJ7C 3B6FD 4HGAB 3W96A 3LELA 3C1BA 5GT0D 1ID3A 2ZY5A 4WJ3C 4G91B 3B6GC 4KGCB 5AY8D 1P3PC 4Z2MG 2RVQC 3W97A 4WZSB 5B31B 5B1LC 3R45B 3UTBA 1M1AD 5AV8D 1HQ3A 3AZHA 4QLCB 3KUYD 4XZQD 5DNNB 4ZUXA 3C1BC 3W96C 3LELC 3AZLB 1TZYB 4JJNA 2YFVA 1P34D 3VH5A 3RELB 2XD5A 3W97C 3KXBC 3VH6A 3KWQB 3UTBC 1P3KD 5CPIC 3X1UB 4WU8C 3EG5B 4H9PB 5B1MA 3AZHC 3WKJD 1S32B 4J8WA 3AN2D 4ZUXC 3LJAA 4KUDC 2FFFB 3A6NA 1TZYD 5B0YA 5B0ZD 2CV5A 3MVDD 3AV1B 2Y2GA 3RELD 3AYWA 4Z5TA 3KWQD 3EPKA 1P3PB 1BH9A 1P3BC 1P3LA 3H0LC 4J8UC 4WU9C 5GSUA 4J8WC 1KX3B 3AZKD 4YS3A 2G5IC 5B32C 4J8XA 5BT1C 3LJAC 1PZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN B;  3UTA A;  4ZBJ C;  3A6N C;  4R8P D;  5CPJ B;  3C1B B;  3LEL B;  2FJ7 D;  3W96 B;  4NFT A;  1ID3 B;  2CV5 C;  1KX4 A;  5GT0 A;  3AZJ D;  3REK C;  3B6G D;  4Z5T C;  3TU4 C;  3W97 B;  4NE6 A;  1P3P D;  2RVQ D;  1P3L C;  5B1L D;  3UTB B;  5GSU C;  5B40 C;  1M1A A;  1Q9C A;  5AV8 A;  1HQ3 B;  3AZH B;  3AZI A;  4J8X C;  5G49 A;  4XZQ A;  3UTA C;  4ZUX B;  3REH A;  3W96 D;  5AVB A;  5GT0 C;  2YFV B;  4JJN B;  1KX4 C;  5AV5 D;  1P34 A;  3KXB D;  3AZF B;  2F8N D;  1P3K A;  1H3O A;  3WTP E;  5CPI D;  5KDM A;  5B1M B;  4H9S A;  3AZI C;  2ARO B;  4WU8 D;  1BFM A;  3WKJ A;  4M6B A;  4EO5 C;  4XZQ C;  3W98 A;  1WWS A;  3LJA B;  1P3A C;  1EQZ A;  4WV4 B;  3AN2 A;  3REH C;  4H9N B;  4KUD D;  3A6N B;  4KHA A;  5AVB C;  2BYM B;  3C1C D;  5B0Y B;  5GT3 D;  5AV9 C;  2CV5 B;  1P34 C;  5B0Z A;  1F1E A;  3AYW B;  3MVD A;  4Z5T B;  1B6W A;  1BH9 B;  4AWL C;  3WTP C;  3WA9 C;  1P3K C;  4E45 A;  1P3L B;  1P3B D;  3MGR A;  4J8U D;  5GSU B;  2NQB C;  1P3O D;  4WU9 D;  4J8W D;  4YS3 B;  4H9O A;  3W98 C;  3AZK A;  5B32 D;  1EQZ C;  5BT1 D;  3UTA B;  3MGQ C;  5AV6 C;  4R8P A;  2FJ7 A;  3B6F B;  3O62 A;  1KX4 B;  5GT0 B;  3MVD C;  3AZJ A;  3REK D;  3B6G A;  3VH5 W;  3TU4 D;  4J8V A;  4X23 D;  3MGR C;  1P3L D;  5B1L A;  1M1A B;  5AV8 B;  5GSU D;  5B40 D;  5F99 D;  3AZK C;  2CWE A;  5G49 B;  4EO5 B;  4J8X D;  4XZQ B;  4XUJ D;  5BS7 C;  2PYO D;  3W99 C;  1WWI A;  3O62 C;  1KX4 D;  3AZJ C;  1P34 B;  5AV5 A;  4J8V C;  4CAY A;  2NZD D;  3B0D C;  3KXB A;  3B0C T;  3UT9 C;  1P3K B;  2F8N A;  1F66 D;  1H3O B;  5CPI A;  3AZI D;  4WU8 A;  3WKJ B;  1EQZ B;  3AN2 B;  1P3A D;  4KHA B;  3REH D;  4KUD A;  5AVB D;  3C1C A;  5AV5 C;  5GT3 A;  5AV9 D;  5B0Z B;  3MVD B;  1KX5 C;  3NQJ A;  3WTP D;  3WA9 D;  3MGR B;  1P3B A;  5B2J A;  4J8U A;  2NQB D;  1P3O A;  4WU9 A;  1KU5 A;  4H9O B;  3AZK B;  3W98 D;  1EQZ D;  5B32 A;  1AOI D;  3KSY A;  4E44 A;  4R8P B;  3MGQ D;  3C1C C;  5AV6 D;  1P3F A;  2FJ7 B;  4DRA A;  5GT3 C;  3AZE C;  3AZJ B;  3B6G B;  3X1S C;  4J8V B;  3X1V D;  3REK A;  3TU4 A;  1HTA A;  3B0D B;  4X23 A;  5B1L B;  5B2J C;  2HIO D;  3MGR D;  1P3O C;  1U35 C;  5B40 A;  5F99 A;  5GXQ A;  4XUJ A;  2PYO A;  3X1T A;  4Z2M H;  3W99 D;  1P3F C;  3O62 D;  5JRG A;  5AV5 B;  3REJ C;  1B67 A;  4CAY B;  1P3M A;  4J8V D;  3KXB B;  4X23 C;  3REI C;  2F8N B;  2NZD A;  3UT9 D;  1F66 A;  5CPI B;  4WU8 B;  5F99 C;  5GXQ C;  4UUZ A;  4XUJ C;  2PYO C;  3X1T C;  4G92 C;  1P3A A;  4KUD B;  5JRG C;  3C1C B;  3AFA C;  5GT3 B;  5B2I A;  3LZ1 C;  5AV9 A;  4YM6 C;  1P3M C;  3V9R A;  3NQJ B;  2NZD C;  1KX5 D;  3MNN A;  1F66 C;  3WTP A;  1P3B B;  5B2J B;  3WA9 A;  4J8U B;  5BNV A;  5E5A D;  1P3O B;  4WU9 B;  3WAA A;  2NQB A;  4J8W B;  5CPK C;  1JFI A;  2HUE C;  1N1J A;  5B32 B;  1AOI A;  4ZBJ B;  2F8N K;  1P3I A;  2IO5 C;  3MGP A;  5B2I C;  3MGQ A;  4H9Q A;  5AV6 A;  3AZE D;  3REK B;  4Z66 C;  3MNN C;  3X1S D;  3TU4 B;  3X1V A;  4X23 B;  5B2J D;  2HIO A;  3WAA C;  1M19 C;  5B40 B;  4CSR A;  5B31 A;  1ZLA C;  1U35 D;  5F99 B;  1M18 A;  4J8X B;  4XUJ B;  2PYO B;  4WNN A;  5BS7 A;  1AOI C;  5AVC A;  4G92 B;  1P3I C;  3MGP C;  1P3F D;  3W99 A;  5JRG B;  3REJ D;  4HGA C;  3X1V C;  1P3M B;  2NZD B;  4KGC C;  3REI D;  2HIO C;  3MGS A;  1F66 B;  3UT9 A;  5B31 C;  1M18 C;  3AZI B;  5GXQ D;  3AV2 A;  4UUZ B;  3X1U A;  2HUE B;  5AVC C;  5B33 D;  1P3A B;  3X1T D;  3REH B;  5AVB B;  1TAF A;  2IO5 B;  5JRG D;  5DNN C;  5B2I B;  3AFA D;  5AV9 B;  3V9R B;  3AZL C;  3LZ1 D;  1P3M D;  4YM6 D;  3MNN B;  3MGS C;  4AWL B;  1KX5 A;  1R4V A;  3WTP B;  3WA9 B;  5BNV B;  5KDM B;  3WAA B;  2NQB B;  5E5A A;  3AV2 C;  2L5A A;  1JFI B;  3AZG D;  3X1U C;  5CPK D;  3W98 B;  3NQU A;  5B24 D;  1KX3 A;  3B0C W;  1AOI B;  1P3I B;  3MGQ B;  4H9Q B;  5AV6 B;  5B2I D;  5FUG A;  1P3G D;  5CPJ A;  3AZE A;  3X1V B;  4Z66 D;  3MNN D;  3X1S A;  3AV1 C;  2HIO B;  5CP6 A;  1BH8 A;  5E5A C;  4CSR B;  1M19 D;  3WAA D;  5DNM D;  1M18 B;  1ZLA D;  1U35 A;  1KX3 C;  4WNN B;  5AVC B;  5BNX A;  1P3I D;  3W99 B;  3MGP D;  3O62 B;  3AZN C;  5CPJ C;  1ID3 C;  3REJ A;  5CHL B;  4KGC D;  3MGS B;  5CP6 C;  4H9R A;  3REI A;  3UT9 B;  3LZ0 A;  5B31 D;  2LY8 A;  3AZF A;  1M18 D;  3AV2 B;  2F8N G;  1HQ3 C;  2ARO A;  4QLC D;  5AVC D;  5B33 A;  1TAF B;  2YFW A;  5JA4 A;  5C3I C;  5DNN D;  3AFA A;  4H9N A;  4JJN C;  3AZL D;  3LZ1 A;  2BYM A;  4YM6 A;  1KX5 B;  3MGS D;  3LZ0 C;  3AZF C;  5E5A B;  1ULY A;  3AZM A;  3AV2 D;  3AZG A;  3X1U D;  5B1M C;  4DRB A;  5CPK A;  2ARO C;  3NQU B;  1S32 D;  5B33 C;  2BYK A;  5B24 A;  4LD9 A;  5FUG B;  5B32 G;  3AZE B;  5B0Y C;  1P3G A;  3B6F A;  3X1S B;  5BO0 A;  4Z66 A;  3AYW C;  5CP6 B;  1A7W A;  1BH8 B;  3AV1 D;  5AY8 A;  3AZM C;  1M19 A;  1U35 B;  5DNM A;  2JSS A;  3AZG C;  1ZLA A;  4YS3 C;  5B24 C;  1KX3 D;  4LD9 C;  5BNX B;  3KUY A;  1P3F B;  5C3I B;  3AZN D;  5CPJ D;  3C1B D;  3LEL D;  3REJ B;  1P3G C;  3B6F C;  1ID3 D;  2F8N H;  4H9R B;  3REI B;  4KGC A;  5CP6 D;  5AY8 C;  3W97 D;  3LZ0 B;  5DNM C;  3UTB D;  3R45 A;  1M1A C;  5GXQ B;  5AV8 C;  1HQ3 D;  3AZH D;  5B33 B;  3X1T B;  4QLC A;  3KUY C;  5JA4 B;  2YFW B;  4ZUX D;  3AFA B;  5DNN A;  3LZ1 B;  4YM6 B;  4JJN D;  3AZL A;  1TZY A;  4G91 C;  4NE5 A;  3LZ0 D;  3REL A;  3KWQ A;  3AZF D;  3AZM B;  3AZG B;  4H9S C;  5CPK B;  5B1M D;  3B0B A;  3WKJ C;  2ARO D;  4H9P A;  2BYK B;  5B24 B;  4QLC C;  3VH5 T;  1S32 A;  4LD9 B;  4NE3 A;  3VH6 T;  3AN2 C;  3LJA D;  3A6N D;  1P3G B;  1TZY C;  5BO0 B;  4Z66 B;  5B0Y D;  5B0Z C;  2CV5 D;  3REL C;  3AYW D;  4Z5T D;  3KWQ C;  5AY8 B;  3AV1 A;  1P3P A;  1M19 B;  3VH6 W;  3AZM D;  5DNM B;  1ZLA B;  1N1J B;  1S32 C;  5B31 G;  4YS3 D;  4LD9 D;  3KUY B;  3MGP B;  3UTA D;  4R8P C;  3AZN A;  2FJ7 C;  3B6F D;  4HGA B;  3W96 A;  3LEL A;  3C1B A;  5GT0 D;  1ID3 A;  4G91 B;  3B6G C;  4KGC B;  5AY8 D;  1P3P C;  4Z2M G;  2RVQ C;  3W97 A;  4WZS B;  5B31 B;  5B1L C;  3R45 B;  3UTB A;  1M1A D;  5AV8 D;  1HQ3 A;  3AZH A;  4QLC B;  3KUY D;  4XZQ D;  5DNN B;  4ZUX A;  3C1B C;  3W96 C;  3LEL C;  3AZL B;  1TZY B;  4JJN A;  2YFV A;  1P34 D;  3VH5 A;  3REL B;  3W97 C;  3KXB C;  3VH6 A;  3KWQ B;  3UTB C;  1P3K D;  5CPI C;  3X1U B;  4WU8 C;  4H9P B;  5B1M A;  3AZH C;  3WKJ D;  1S32 B;  4J8W A;  3AN2 D;  4ZUX C;  3LJA A;  4KUD C;  3A6N A;  1TZY D;  5B0Y A;  5B0Z D;  2CV5 A;  3MVD D;  3AV1 B;  3REL D;  3AYW A;  4Z5T A;  3KWQ D;  1P3P B;  1BH9 A;  1P3B C;  1P3L A;  4J8U C;  4WU9 C;  5GSU A;  4J8W C;  1KX3 B;  3AZK D;  4YS3 A;  5B32 C;  4J8X A;  5BT1 C;  3LJA C; 
#chains in the Genus database with same CATH topology
 3AZN B;  3UTA A;  4ZBJ C;  3A6N C;  4R8P D;  5CPJ B;  3C1B B;  3LEL B;  2FJ7 D;  3W96 B;  4NFT A;  1ID3 B;  2CV5 C;  1KX4 A;  5GT0 A;  3AZJ D;  3REK C;  3B6G D;  4Z5T C;  3TU4 C;  3W97 B;  4NE6 A;  1P3P D;  2RVQ D;  1P3L C;  5B1L D;  3UTB B;  5GSU C;  5B40 C;  1M1A A;  1Q9C A;  5AV8 A;  1HQ3 B;  3AZH B;  3AZI A;  2Y2M A;  4J8X C;  5G49 A;  4DQY B;  4XZQ A;  3UTA C;  4ZUX B;  3REH A;  3W96 D;  5AVB A;  5GT0 C;  2YFV B;  4JJN B;  1KX4 C;  5AV5 D;  1P34 A;  3KXB D;  3AZF B;  2F8N D;  1P3K A;  1H3O A;  3WTP E;  5CPI D;  5KDM A;  5B1M B;  4H9S A;  3AZI C;  2ARO B;  2VQR A;  4WU8 D;  1BFM A;  3WKJ A;  4M6B A;  3KFU G;  4EO5 C;  4XZQ C;  3W98 A;  1WWS A;  3LJA B;  1P3A C;  3A1K A;  1EQZ A;  4WV4 B;  3AN2 A;  3REH C;  4H9N B;  4KUD D;  3A6N B;  4KHA A;  5AVB C;  2BYM B;  3FDD A;  3C1C D;  5B0Y B;  5GT3 D;  5AV9 C;  2CV5 B;  1P34 C;  5B0Z A;  1F1E A;  3AYW B;  3MVD A;  4Z5T B;  1B6W A;  1BH9 B;  4AWL C;  3WTP C;  3WA9 C;  1P3K C;  4E45 A;  1P3L B;  1P3B D;  3MGR A;  4J8U D;  5GSU B;  2NQB C;  1P3O D;  4WU9 D;  4J8W D;  4YS3 B;  4H9O A;  3W98 C;  3AZK A;  5B32 D;  1EQZ C;  5BT1 D;  3UTA B;  3MGQ C;  5AV6 C;  4R8P A;  2FJ7 A;  3B6F B;  3O62 A;  1KX4 B;  5GT0 B;  3MVD C;  3AZJ A;  3REK D;  3B6G A;  3VH5 W;  3TU4 D;  4J8V A;  4X23 D;  3MGR C;  1P3L D;  5B1L A;  1M1A B;  5AV8 B;  5GSU D;  5B40 D;  5F99 D;  3AZK C;  2CWE A;  5G49 B;  2DQN C;  4EO5 B;  4J8X D;  4XZQ B;  4XUJ D;  5BS7 C;  2PYO D;  2Y2H A;  3W99 C;  1WWI A;  3O62 C;  1KX4 D;  3AL0 C;  3AZJ C;  1P34 B;  5AV5 A;  4J8V C;  4CAY A;  2Y2O A;  3B0D C;  2NZD D;  3KXB A;  3B0C T;  3UT9 C;  1P3K B;  2F8N A;  1F66 D;  1H3O B;  5CPI A;  2JCH A;  3AZI D;  4WU8 A;  3WKJ B;  1EQZ B;  3AN2 B;  1P3A D;  4KHA B;  3REH D;  4KUD A;  5AVB D;  3C1C A;  5AV5 C;  5GT3 A;  5AV9 D;  5B0Z B;  3MVD B;  1KX5 C;  3NQJ A;  3WTP D;  3WA9 D;  3MGR B;  2ZY4 A;  1P3B A;  5B2J A;  4J8U A;  2NQB D;  1P3O A;  4WU9 A;  1KU5 A;  4H9O B;  3AZK B;  2ZY3 A;  3W98 D;  1EQZ D;  5B32 A;  1AOI D;  3KSY A;  4E44 A;  4R8P B;  3MGQ D;  3C1C C;  5AV6 D;  1P3F A;  2FJ7 B;  4DRA A;  5GT3 C;  3AZE C;  3AZJ B;  3B6G B;  3X1S C;  4J8V B;  3X1V D;  3REK A;  3TU4 A;  1HTA A;  3B0D B;  4X23 A;  5B1L B;  5B2J C;  2HIO D;  3MGR D;  1P3O C;  1U35 C;  5B40 A;  5F99 A;  5GXQ A;  4XUJ A;  2PYO A;  3X1T A;  4Z2M H;  3W99 D;  1P3F C;  3O62 D;  5JRG A;  5AV5 B;  3REJ C;  1B67 A;  4CAY B;  1P3M A;  4J8V D;  3KXB B;  4X23 C;  3REI C;  2F8N B;  2NZD A;  3UT9 D;  1F66 A;  5CPI B;  4WU8 B;  5F99 C;  5GXQ C;  4UUZ A;  4XUJ C;  2PYO C;  3X1T C;  4G92 C;  1P3A A;  4KUD B;  5JRG C;  3C1C B;  3AFA C;  4UPK A;  5GT3 B;  5B2I A;  3LZ1 C;  5AV9 A;  4YM6 C;  1P3M C;  3V9R A;  3NQJ B;  2NZD C;  1KX5 D;  3MNN A;  1F66 C;  3WTP A;  1P3B B;  5B2J B;  2XD1 A;  3WA9 A;  4J8U B;  5BNV A;  5E5A D;  1P3O B;  4WU9 B;  3WAA A;  2NQB A;  4J8W B;  5CPK C;  1JFI A;  2HUE C;  1N1J A;  5B32 B;  1AOI A;  4ZBJ B;  2F8N K;  1P3I A;  2IO5 C;  3MGP A;  5B2I C;  3MGQ A;  4H9Q A;  5AV6 A;  2W8S A;  3AZE D;  3REK B;  4Z66 C;  3MNN C;  3X1S D;  3TU4 B;  3X1V A;  4X23 B;  5B2J D;  2HIO A;  2J8P A;  3WAA C;  1M19 C;  5B40 B;  4CSR A;  5B31 A;  1ZLA C;  1U35 D;  5F99 B;  1M18 A;  1T3U A;  4J8X B;  4XUJ B;  2PYO B;  4WNN A;  5BS7 A;  1AOI C;  5AVC A;  4G92 B;  1P3I C;  3MGP C;  3H0R C;  1P3F D;  3W99 A;  5JRG B;  3REJ D;  4HGA C;  3X1V C;  1P3M B;  2NZD B;  4KGC C;  3REI D;  2DF4 C;  2HIO C;  3MGS A;  1F66 B;  3UT9 A;  2Y2I A;  5B31 C;  2Y2Q A;  1M18 C;  3AZI B;  5GXQ D;  3AV2 A;  4UUZ B;  2ZY2 A;  3X1U A;  2HUE B;  2RIQ A;  5AVC C;  5B33 D;  1P3A B;  3X1T D;  3REH B;  5AVB B;  1TAF A;  2IO5 B;  2Y2J A;  5JRG D;  5DNN C;  5B2I B;  3AFA D;  5AV9 B;  3V9R B;  3AZL C;  3LZ1 D;  1P3M D;  4YM6 D;  3MNN B;  3MGS C;  4AWL B;  1KX5 A;  1R4V A;  3WTP B;  3WA9 B;  5BNV B;  5KDM B;  3WAA B;  2Y2L A;  2NQB B;  5E5A A;  2Y2K A;  3A1I A;  3AV2 C;  2L5A A;  1JFI B;  3AZG D;  3X1U C;  5CPK D;  3W98 B;  3NQU A;  5B24 D;  1KX3 A;  3B0C W;  1AOI B;  1P3I B;  3MGQ B;  4H9Q B;  5AV6 B;  5B2I D;  2ZM5 A;  5FUG A;  1P3G D;  5CPJ A;  3AZE A;  3X1V B;  4Z66 D;  3IP4 C;  3MNN D;  3X1S A;  2BG1 A;  3AV1 C;  2HIO B;  5CP6 A;  1BH8 A;  5E5A C;  4CSR B;  1M19 D;  3WAA D;  5DNM D;  1M18 B;  1ZLA D;  1U35 A;  1KX3 C;  4WNN B;  5AVC B;  3EPL A;  3EPJ A;  5BNX A;  3F6T A;  1P3I D;  3W99 B;  3MGP D;  3O62 B;  3AZN C;  5CPJ C;  1ID3 C;  3REJ A;  5CHL B;  4KGC D;  3MGS B;  5CP6 C;  4H9R A;  3REI A;  3UT9 B;  3LZ0 A;  5B31 D;  2LY8 A;  3AZF A;  3H0M C;  1M18 D;  3AV2 B;  2F8N G;  1HQ3 C;  2ARO A;  4QLC D;  5AVC D;  5B33 A;  1TAF B;  2YFW A;  5JA4 A;  5C3I C;  5DNN D;  3AFA A;  4H9N A;  2JE5 A;  4JJN C;  3AZL D;  3LZ1 A;  2BYM A;  4YM6 A;  2UWX A;  1W2E A;  1KX5 B;  3MGS D;  3LZ0 C;  3AZF C;  5E5A B;  1ULY A;  3AZM A;  3AV2 D;  3AZG A;  3X1U D;  5B1M C;  4DRB A;  5CPK A;  2ARO C;  3NQU B;  1S32 D;  5B33 C;  2BYK A;  5B24 A;  4LD9 A;  5FUG B;  5B32 G;  3AZE B;  5B0Y C;  1P3G A;  3B6F A;  3X1S B;  5BO0 A;  4Z66 A;  3AYW C;  5CP6 B;  1A7W A;  1BH8 B;  3AV1 D;  5AY8 A;  3AZM C;  1M19 A;  1U35 B;  5DNM A;  2JSS A;  3AZG C;  1ZLA A;  4YS3 C;  5B24 C;  1KX3 D;  4LD9 C;  5BNX B;  3KUY A;  1P3F B;  5C3I B;  3AZN D;  5CPJ D;  3C1B D;  3LEL D;  3REJ B;  1P3G C;  3B6F C;  1ID3 D;  2F8N H;  4H9R B;  3REI B;  4KGC A;  5CP6 D;  5AY8 C;  3W97 D;  3LZ0 B;  2Y2N A;  5DNM C;  3UTB D;  3R45 A;  1M1A C;  5GXQ B;  5AV8 C;  1HQ3 D;  3AZH D;  5B33 B;  3X1T B;  2G5H C;  4QLC A;  3KUY C;  5JA4 B;  2YFW B;  4ZUX D;  3AFA B;  5DNN A;  2Y2P A;  3LZ1 B;  4YM6 B;  3EPH A;  4JJN D;  3AZL A;  1TZY A;  4G91 C;  4NE5 A;  3LZ0 D;  3REL A;  3KWQ A;  3AZF D;  3AZM B;  3AZG B;  4H9S C;  5CPK B;  5B1M D;  3B0B A;  3WKJ C;  2ARO D;  4H9P A;  2BYK B;  5B24 B;  4QLC C;  3VH5 T;  1S32 A;  4LD9 B;  4NE3 A;  3VH6 T;  3AN2 C;  3LJA D;  1Z2C B;  3A6N D;  1P3G B;  1TZY C;  5BO0 B;  4Z66 B;  5B0Y D;  5B0Z C;  2CV5 D;  2F2A C;  3REL C;  3AYW D;  4Z5T D;  3KWQ C;  5AY8 B;  3AV1 A;  1P3P A;  1M19 B;  3VH6 W;  3AZM D;  5DNM B;  1ZLA B;  3P5J B;  1N1J B;  1S32 C;  5B31 G;  4YS3 D;  4LD9 D;  3KUY B;  3MGP B;  3UTA D;  4R8P C;  3AZN A;  2FJ7 C;  3B6F D;  4HGA B;  3W96 A;  3LEL A;  3C1B A;  5GT0 D;  1ID3 A;  2ZY5 A;  4WJ3 C;  4G91 B;  3B6G C;  4KGC B;  5AY8 D;  1P3P C;  4Z2M G;  2RVQ C;  3W97 A;  4WZS B;  5B31 B;  5B1L C;  3R45 B;  3UTB A;  1M1A D;  5AV8 D;  1HQ3 A;  3AZH A;  4QLC B;  3KUY D;  4XZQ D;  5DNN B;  4ZUX A;  3C1B C;  3W96 C;  3LEL C;  3AZL B;  1TZY B;  4JJN A;  2YFV A;  1P34 D;  3VH5 A;  3REL B;  2XD5 A;  3W97 C;  3KXB C;  3VH6 A;  3KWQ B;  3UTB C;  1P3K D;  5CPI C;  3X1U B;  4WU8 C;  3EG5 B;  4H9P B;  5B1M A;  3AZH C;  3WKJ D;  1S32 B;  4J8W A;  3AN2 D;  4ZUX C;  3LJA A;  4KUD C;  2FFF B;  3A6N A;  1TZY D;  5B0Y A;  5B0Z D;  2CV5 A;  3MVD D;  3AV1 B;  2Y2G A;  3REL D;  3AYW A;  4Z5T A;  3KWQ D;  3EPK A;  1P3P B;  1BH9 A;  1P3B C;  1P3L A;  3H0L C;  4J8U C;  4WU9 C;  5GSU A;  4J8W C;  1KX3 B;  3AZK D;  4YS3 A;  2G5I C;  5B32 C;  4J8X A;  5BT1 C;  3LJA C;  1PZR A; 
#chains in the Genus database with same CATH homology
 3AZN B;  3UTA A;  4ZBJ C;  3A6N C;  4R8P D;  5CPJ B;  3C1B B;  3LEL B;  2FJ7 D;  3W96 B;  4NFT A;  1ID3 B;  2CV5 C;  1KX4 A;  5GT0 A;  3AZJ D;  3REK C;  3B6G D;  4Z5T C;  3TU4 C;  3W97 B;  4NE6 A;  1P3P D;  2RVQ D;  1P3L C;  5B1L D;  3UTB B;  5GSU C;  5B40 C;  1M1A A;  1Q9C A;  5AV8 A;  1HQ3 B;  3AZH B;  3AZI A;  2Y2M A;  4J8X C;  5G49 A;  4DQY B;  4XZQ A;  3UTA C;  4ZUX B;  3REH A;  3W96 D;  5AVB A;  5GT0 C;  2YFV B;  4JJN B;  1KX4 C;  5AV5 D;  1P34 A;  3KXB D;  3AZF B;  2F8N D;  1P3K A;  1H3O A;  3WTP E;  5CPI D;  5KDM A;  5B1M B;  4H9S A;  3AZI C;  2ARO B;  2VQR A;  4WU8 D;  1BFM A;  3WKJ A;  4M6B A;  3KFU G;  4EO5 C;  4XZQ C;  3W98 A;  1WWS A;  3LJA B;  1P3A C;  3A1K A;  1EQZ A;  4WV4 B;  3AN2 A;  3REH C;  4H9N B;  4KUD D;  3A6N B;  4KHA A;  5AVB C;  2BYM B;  3FDD A;  3C1C D;  5B0Y B;  5GT3 D;  5AV9 C;  2CV5 B;  1P34 C;  5B0Z A;  1F1E A;  3AYW B;  3MVD A;  4Z5T B;  1B6W A;  1BH9 B;  4AWL C;  3WTP C;  3WA9 C;  1P3K C;  4E45 A;  1P3L B;  1P3B D;  3MGR A;  4J8U D;  5GSU B;  2NQB C;  1P3O D;  4WU9 D;  4J8W D;  4YS3 B;  4H9O A;  3W98 C;  3AZK A;  5B32 D;  1EQZ C;  5BT1 D;  3UTA B;  3MGQ C;  5AV6 C;  4R8P A;  2FJ7 A;  3B6F B;  3O62 A;  1KX4 B;  5GT0 B;  3MVD C;  3AZJ A;  3REK D;  3B6G A;  3VH5 W;  3TU4 D;  4J8V A;  4X23 D;  3MGR C;  1P3L D;  5B1L A;  1M1A B;  5AV8 B;  5GSU D;  5B40 D;  5F99 D;  3AZK C;  2CWE A;  5G49 B;  2DQN C;  4EO5 B;  4J8X D;  4XZQ B;  4XUJ D;  5BS7 C;  2PYO D;  2Y2H A;  3W99 C;  1WWI A;  3O62 C;  1KX4 D;  3AL0 C;  3AZJ C;  1P34 B;  5AV5 A;  4J8V C;  4CAY A;  2Y2O A;  3B0D C;  2NZD D;  3KXB A;  3B0C T;  3UT9 C;  1P3K B;  2F8N A;  1F66 D;  1H3O B;  5CPI A;  2JCH A;  3AZI D;  4WU8 A;  3WKJ B;  1EQZ B;  3AN2 B;  1P3A D;  4KHA B;  3REH D;  4KUD A;  5AVB D;  3C1C A;  5AV5 C;  5GT3 A;  5AV9 D;  5B0Z B;  3MVD B;  1KX5 C;  3NQJ A;  3WTP D;  3WA9 D;  3MGR B;  2ZY4 A;  1P3B A;  5B2J A;  4J8U A;  2NQB D;  1P3O A;  4WU9 A;  1KU5 A;  4H9O B;  3AZK B;  2ZY3 A;  3W98 D;  1EQZ D;  5B32 A;  1AOI D;  3KSY A;  4E44 A;  4R8P B;  3MGQ D;  3C1C C;  5AV6 D;  1P3F A;  2FJ7 B;  4DRA A;  5GT3 C;  3AZE C;  3AZJ B;  3B6G B;  3X1S C;  4J8V B;  3X1V D;  3REK A;  3TU4 A;  1HTA A;  3B0D B;  4X23 A;  5B1L B;  5B2J C;  2HIO D;  3MGR D;  1P3O C;  1U35 C;  5B40 A;  5F99 A;  5GXQ A;  4XUJ A;  2PYO A;  3X1T A;  4Z2M H;  3W99 D;  1P3F C;  3O62 D;  5JRG A;  5AV5 B;  3REJ C;  1B67 A;  4CAY B;  1P3M A;  4J8V D;  3KXB B;  4X23 C;  3REI C;  2F8N B;  2NZD A;  3UT9 D;  1F66 A;  5CPI B;  4WU8 B;  5F99 C;  5GXQ C;  4UUZ A;  4XUJ C;  2PYO C;  3X1T C;  4G92 C;  1P3A A;  4KUD B;  5JRG C;  3C1C B;  3AFA C;  4UPK A;  5GT3 B;  5B2I A;  3LZ1 C;  5AV9 A;  4YM6 C;  1P3M C;  3V9R A;  3NQJ B;  2NZD C;  1KX5 D;  3MNN A;  1F66 C;  3WTP A;  1P3B B;  5B2J B;  2XD1 A;  3WA9 A;  4J8U B;  5BNV A;  5E5A D;  1P3O B;  4WU9 B;  3WAA A;  2NQB A;  4J8W B;  5CPK C;  1JFI A;  2HUE C;  1N1J A;  5B32 B;  1AOI A;  4ZBJ B;  2F8N K;  1P3I A;  2IO5 C;  3MGP A;  5B2I C;  3MGQ A;  4H9Q A;  5AV6 A;  2W8S A;  3AZE D;  3REK B;  4Z66 C;  3MNN C;  3X1S D;  3TU4 B;  3X1V A;  4X23 B;  5B2J D;  2HIO A;  2J8P A;  3WAA C;  1M19 C;  5B40 B;  4CSR A;  5B31 A;  1ZLA C;  1U35 D;  5F99 B;  1M18 A;  1T3U A;  4J8X B;  4XUJ B;  2PYO B;  4WNN A;  5BS7 A;  1AOI C;  5AVC A;  4G92 B;  1P3I C;  3MGP C;  3H0R C;  1P3F D;  3W99 A;  5JRG B;  3REJ D;  4HGA C;  3X1V C;  1P3M B;  2NZD B;  4KGC C;  3REI D;  2DF4 C;  2HIO C;  3MGS A;  1F66 B;  3UT9 A;  2Y2I A;  5B31 C;  2Y2Q A;  1M18 C;  3AZI B;  5GXQ D;  3AV2 A;  4UUZ B;  2ZY2 A;  3X1U A;  2HUE B;  2RIQ A;  5AVC C;  5B33 D;  1P3A B;  3X1T D;  3REH B;  5AVB B;  1TAF A;  2IO5 B;  2Y2J A;  5JRG D;  5DNN C;  5B2I B;  3AFA D;  5AV9 B;  3V9R B;  3AZL C;  3LZ1 D;  1P3M D;  4YM6 D;  3MNN B;  3MGS C;  4AWL B;  1KX5 A;  1R4V A;  3WTP B;  3WA9 B;  5BNV B;  5KDM B;  3WAA B;  2Y2L A;  2NQB B;  5E5A A;  2Y2K A;  3A1I A;  3AV2 C;  2L5A A;  1JFI B;  3AZG D;  3X1U C;  5CPK D;  3W98 B;  3NQU A;  5B24 D;  1KX3 A;  3B0C W;  1AOI B;  1P3I B;  3MGQ B;  4H9Q B;  5AV6 B;  5B2I D;  2ZM5 A;  5FUG A;  1P3G D;  5CPJ A;  3AZE A;  3X1V B;  4Z66 D;  3IP4 C;  3MNN D;  3X1S A;  2BG1 A;  3AV1 C;  2HIO B;  5CP6 A;  1BH8 A;  5E5A C;  4CSR B;  1M19 D;  3WAA D;  5DNM D;  1M18 B;  1ZLA D;  1U35 A;  1KX3 C;  4WNN B;  5AVC B;  3EPL A;  3EPJ A;  5BNX A;  3F6T A;  1P3I D;  3W99 B;  3MGP D;  3O62 B;  3AZN C;  5CPJ C;  1ID3 C;  3REJ A;  5CHL B;  4KGC D;  3MGS B;  5CP6 C;  4H9R A;  3REI A;  3UT9 B;  3LZ0 A;  5B31 D;  2LY8 A;  3AZF A;  3H0M C;  1M18 D;  3AV2 B;  2F8N G;  1HQ3 C;  2ARO A;  4QLC D;  5AVC D;  5B33 A;  1TAF B;  2YFW A;  5JA4 A;  5C3I C;  5DNN D;  3AFA A;  4H9N A;  2JE5 A;  4JJN C;  3AZL D;  3LZ1 A;  2BYM A;  4YM6 A;  2UWX A;  1W2E A;  1KX5 B;  3MGS D;  3LZ0 C;  3AZF C;  5E5A B;  1ULY A;  3AZM A;  3AV2 D;  3AZG A;  3X1U D;  5B1M C;  4DRB A;  5CPK A;  2ARO C;  3NQU B;  1S32 D;  5B33 C;  2BYK A;  5B24 A;  4LD9 A;  5FUG B;  5B32 G;  3AZE B;  5B0Y C;  1P3G A;  3B6F A;  3X1S B;  5BO0 A;  4Z66 A;  3AYW C;  5CP6 B;  1A7W A;  1BH8 B;  3AV1 D;  5AY8 A;  3AZM C;  1M19 A;  1U35 B;  5DNM A;  2JSS A;  3AZG C;  1ZLA A;  4YS3 C;  5B24 C;  1KX3 D;  4LD9 C;  5BNX B;  3KUY A;  1P3F B;  5C3I B;  3AZN D;  5CPJ D;  3C1B D;  3LEL D;  3REJ B;  1P3G C;  3B6F C;  1ID3 D;  2F8N H;  4H9R B;  3REI B;  4KGC A;  5CP6 D;  5AY8 C;  3W97 D;  3LZ0 B;  2Y2N A;  5DNM C;  3UTB D;  3R45 A;  1M1A C;  5GXQ B;  5AV8 C;  1HQ3 D;  3AZH D;  5B33 B;  3X1T B;  2G5H C;  4QLC A;  3KUY C;  5JA4 B;  2YFW B;  4ZUX D;  3AFA B;  5DNN A;  2Y2P A;  3LZ1 B;  4YM6 B;  3EPH A;  4JJN D;  3AZL A;  1TZY A;  4G91 C;  4NE5 A;  3LZ0 D;  3REL A;  3KWQ A;  3AZF D;  3AZM B;  3AZG B;  4H9S C;  5CPK B;  5B1M D;  3B0B A;  3WKJ C;  2ARO D;  4H9P A;  2BYK B;  5B24 B;  4QLC C;  3VH5 T;  1S32 A;  4LD9 B;  4NE3 A;  3VH6 T;  3AN2 C;  3LJA D;  1Z2C B;  3A6N D;  1P3G B;  1TZY C;  5BO0 B;  4Z66 B;  5B0Y D;  5B0Z C;  2CV5 D;  2F2A C;  3REL C;  3AYW D;  4Z5T D;  3KWQ C;  5AY8 B;  3AV1 A;  1P3P A;  1M19 B;  3VH6 W;  3AZM D;  5DNM B;  1ZLA B;  3P5J B;  1N1J B;  1S32 C;  5B31 G;  4YS3 D;  4LD9 D;  3KUY B;  3MGP B;  3UTA D;  4R8P C;  3AZN A;  2FJ7 C;  3B6F D;  4HGA B;  3W96 A;  3LEL A;  3C1B A;  5GT0 D;  1ID3 A;  2ZY5 A;  4WJ3 C;  4G91 B;  3B6G C;  4KGC B;  5AY8 D;  1P3P C;  4Z2M G;  2RVQ C;  3W97 A;  4WZS B;  5B31 B;  5B1L C;  3R45 B;  3UTB A;  1M1A D;  5AV8 D;  1HQ3 A;  3AZH A;  4QLC B;  3KUY D;  4XZQ D;  5DNN B;  4ZUX A;  3C1B C;  3W96 C;  3LEL C;  3AZL B;  1TZY B;  4JJN A;  2YFV A;  1P34 D;  3VH5 A;  3REL B;  2XD5 A;  3W97 C;  3KXB C;  3VH6 A;  3KWQ B;  3UTB C;  1P3K D;  5CPI C;  3X1U B;  4WU8 C;  3EG5 B;  4H9P B;  5B1M A;  3AZH C;  3WKJ D;  1S32 B;  4J8W A;  3AN2 D;  4ZUX C;  3LJA A;  4KUD C;  2FFF B;  3A6N A;  1TZY D;  5B0Y A;  5B0Z D;  2CV5 A;  3MVD D;  3AV1 B;  2Y2G A;  3REL D;  3AYW A;  4Z5T A;  3KWQ D;  3EPK A;  1P3P B;  1BH9 A;  1P3B C;  1P3L A;  3H0L C;  4J8U C;  4WU9 C;  5GSU A;  4J8W C;  1KX3 B;  3AZK D;  4YS3 A;  2G5I C;  5B32 C;  4J8X A;  5BT1 C;  3LJA C;  1PZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...