3WKJB

The nucleosome containing human tsh2b
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjB00
3REJC 1ID3B 3KUYC 3X1SB 4XZQB 5AV8C 3TU4D 1P3MB 5B1LB 3REID 2FJ7A 2HIOD 4Z2MH 3B6FA 4J8UA 5B24B 3AZKD 3LJAC 5AV9C 3REKD 1P3KD 2LY8A 1M18D 2YFVB 5CPKA 4H9QB 3O62B 1P3IB 5CP6C 5AY8C 2NQBA 3LZ1B 3WA9C 3LELC 3C1CB 1KX5B 3UT9D 4ZBJC 3AZFA 2FJ7C 5E5AD 3VH6A 3B6FC 4JJNC 5FUGA 4J8UC 5BT1C 5DNMA 4H9NA 2F8NH 4KUDC 4XZQC 3W96C 5B31B 5GXQB 2NQBC 1TZYA 1M1AA 1P3AA 4WU9B 1AOIA 2YFWB 4E45A 5B32D 5AVBD 4YS3A 5GSUB 1P3LD 5B0ZB 5AV6D 3WKJD 5GT0A 5AV5D 3UTAA 1S32D 5G49B 3X1UA 4UUZB 5JRGB 4H9SA 3B0CT 3X1SD 1P3MD 3A6NA 5B1LD 5B0YB 1M1AC 1KX4A 4YS3C 5AVCC 3AZHC 1P3BC 1P3OB 4Z66A 4J8WA 4CSRA 3X1VB 3AZNB 3B6GA 4LD9D 3UTAC 3O62D 5B31C 1P3ID 3C1BA 3AZLA 3AZIB 3LZ1D 3AZEA 3C1CD 3X1UC 1N1JB 4YM6B 5F99B 1KX5D 1KX3A 4ZUXB 4H9SC 3W98A 2AROA 1M19A 3X1TA 1KX4C 1R4VA 3AZJA 1BH8A 3AZGB 3KWQC 1P3FA 3AFAA 1BH9B 3MGSB 1P3GD 4R8PD 3AZLC 5GXQD 3W97A 5DNNB 3TU4B 3AZEC 1P3PB 4WU9D 2CV5B 1KX3C 4KGCA 3MGQB 3W98C 2HIOB 5C3IB 2AROC 5B0ZD 3AV1A 3REHC 2NZDB 5B2JB 3WTPA 4XUJB 5CPIA 5JRGD 4ZUXC 3WTPE 3NQUB 4KHAB 3UTBA 1B67A 3MGPA 3AZKA 4X23C 5B0YD 5CPJA 3MGRC 2HUEB 1F66C 3AN2C 1EQZB 5B40A 4J8XA 3MVDC 1HQ3B 4EO5C 3LZ0B 3X1VD 3AZND 5BNVA 4WNNA 3AZID 4DRBA 5AV8A 5KDMA 5CPIC 4YM6D 3AV2A 3REIC 4Z5TD 5B2IB 3WAAB 5E5AA 3UTBC 4H9PB 3RELB 5AVBB 3AZKC 4WU8B 3AZMB 3LJAA 2F8NA 5AV9A 5B1MB 3REKC 1P3KC 4J8VB 3VH5T 3AZGD 1M18C 5B40C 1S32B 5AY8A 4G91C 3WA9A 3LELA 3MGSD 5B32A 3UT9C 5DNND 1P3PD 3AV2C 2CV5D 3MGQD 5E5AC 4JJNA 1ID3A 4KUDA 5CHLB 2NZDD 3X1SA 5B2JD 4XZQA 3AYWD 2IO5C 3W96A 4XUJD 5GT3D 4LD9B 4QLCB 5B32C 4NE3A 5AVBC 5B24A 1P3LC 1U35D 5AV6C 4G92C 3WKJC 4HGAC 1EQZD 3B0CW 5AV5C 5CPKB 1HQ3D 3LZ0D 3W99D 1ID3C 3V9RB 1P34D 5BO0B 3X1SC 1P3MC 1P3GB 5B1LC 4R8PB 2RVQD 4DRAA 3AZFB 5B2ID 3WAAD 3RELD 5B24C 1WWSA 3REJD 3AZMD 4WU8D 5DNMB 4H9NB 5AVCA 3AZHA 1P3BA 1ULYA 5B1MD 3KUYD 4J8VD 4LD9C 5B31A 3O62C 1P3IC 3LZ1C 1TZYB 3C1CC 4WU9A 1P3AB 2YFWA 1KX5C 1AOIB 5GSUA 5B0ZA 1HTAA 5B33B 5BNXB 5G49A 3KWQA 1JFIA 3A6NB 4R8PC 2FJ7D 5GXQC 4WU9C 4QLCD 4J8UD 4Z5TB 5GSUC 5B0ZC 1P3OA 4Z66B 4J8WB 3B6GB 3REHA 5CPKD 3B0DB 2BYMA 1H3OB 3C1BB 1N1JA 5F99A 4YM6A 5JRGC 4ZUXA 3MNNB 2BYKB 3NQJA 4X23A 5B0YC 3MGRA 3AZFD 1M19B 2PYOB 1F66A 3X1TB 3B0BA 3AN2A 4H9RA 3AZJB 1BH8B 1A7WA 5DNMD 3MVDA 4WV4B 1P3FB 3AFAB 1P3OC 3X1VC 3AZNC 3MGSA 3AZIC 3KXBB 5DNNA 1TZYD 5BS7C 3TU4A 3AYWB 5GT3B 5F99C 4YM6C 1P3AD 1P3PA 1M1AD 3REIA 1AOID 1BFMA 4YS3D 4KGCB 3MGQA 2HIOA 1ZLAB 3VH5W 1WWIA 3AV1B 4M6BA 1TAFB 2L5AA 5GT0D 3UTAD 2NZDA 5B33D 1U35B 3REKA 1P3KA 5B2JA 3WTPB 1M18A 3AZGC 3NQUA 3W99B 3A6ND 3MGPB 3MGSC 1P34B 3UT9A 5CPJB 5DNNC 4Z2MG 3TU4C 1P3PC 2CV5C 4AWLB 1EQZA 4J8XB 3MGQC 2HIOC 5C3IC 4Z66D 4J8WD 3REJB 2CWEA 3B6GD 2NZDC 3C1BD 3AZLD 4NFTA 3KUYB 5JA4A 5B2JC 3AYWC 4XUJC 3MNND 3W98D 3WAAA 5AVBA 1M19D 1P3LA 3LJAB 3R45B 2F8NB 4H9OA 2PYOD 5AV9B 2HUEC 5B1MA 3X1TD 4CAYB 5AV6A 4NE6A 3WKJA 3AZJD 1EQZC 5AV5A 1S32A 2F8NG 5CP6B 5AY8B 1HQ3C 1KU5A 1P3FD 3AFAD 3WA9B 3LZ0C 3LELB 1P34C 3KXBD 3W97D 1P3MA 5B1LA 5B32G 2RVQC 2FJ7B 4KGCD 5B2IC 1ZLAD 3WAAC 3AV1D 4JJNB 4J8UB 3RELC 3B6FB 3AZMC 4WU8C 3VH5A 4KUDB 3VH6T 5B1MC 4WZSB 4J8VC 3WTPD 3W96B 4LD9A 2YFVA 5CPID 4H9QA 3O62A 1S32C 1P3IA 2NQBB 3LZ1A 3C1CA 3UTBD 1KX5A 4QLCA 3MGPD 5CPJD 5B40D 4J8XD 5FUGB 3V9RA 1F1EA 5BO0A 5AV8D 3AV2D 1P3GA 4R8PA 5GXQA 1M1AB 4QLCC 4YS3B 3LJAD 2F8ND 5AVCB 5AV9D 3AZHB 1P3BB 5GT0B 3UTAB 5CPKC 5CP6D 5AY8D 3WA9D 3LELD 3X1UB 4UUZA 5B31G 5JRGA 1P3GC 5B0YA 3AZFC 5B33A 1KX4B 5BNXA 3B6FD 4JJND 5BT1D 1ID3D 3KWQB 5DNMC 4KUDD 1JFIB 2JSSA 4XZQD 4CSRB 3X1VA 3W96D 3AZNA 3AZLB 3AZIA 2NQBD 5BS7A 1TZYC 3AZEB 1P3AC 1AOIC 1KX3B 5B24D 4Z5TA 3W98B 2AROB 5GT0C 3REHB 5B33C 1H3OA 2BYMB 1Q9CA 3AZGA 3MNNA 1BH9A 2BYKA 3A6NC 3NQJB 4X23B 3MGRB 3W97B 2PYOA 1F66B 2CV5A 3AN2B 4H9RB 4Z5TC 3MVDB 5AVCD 3AZHD 1P3BD 4EO5B 4Z66C 4J8WC 3B6GC 5B31D 3B0DC 3C1BC 3KXBA 3AYWA 4XUJA 5GT3A 3X1UD 5CPIB 3REIB 5GSUD 3MNNC 1ZLAA 4KHAA 3UTBB 3AZKB 1TAFA 1M19C 2PYOC 1KX4D 3X1TC 1U35A 3REKB 1P3KB 3AZJC 1M18B 5B40B 1B6WA 3KWQD 1HQ3A 4G91B 1P3FC 3LZ0A 3AFAC 3W99A 5BNVB 1P34A 3UT9B 4WNNB 3KXBC 5AV8B 3AZED 5KDMB 3W97C 5GT3C 3AV2B 1KX3D 3VH6W 5B2IA 4KGCC 1ZLAC 2AROD 5E5AB 2F8NK 4H9PA 3RELA 3AV1C 1P3OD 3REJA 4WU8A 3AZMA 3REHD 1U35C 3KUYA 5JA4B 4J8VA 2IO5B 3WTPC 5F99D 4ZUXD 4NE5A 3W99C 5B32B 3MGPC 4X23D 5CPJC 3MGRD 1P3LB 3R45A 4H9OB 1F66D 4CAYA 3KSYA 5AV6B 4E44A 4AWLC 4ZBJB 4HGAB 4G92B 3AN2D 3WKJB 5AV5B 4J8XC 5CP6A 3MVDD
chains in the Genus database with same CATH superfamily
3REJC 1ID3B 3KUYC 3X1SB 4XZQB 5AV8C 3TU4D 1P3MB 5B1LB 3REID 2FJ7A 2HIOD 4Z2MH 3AL0C 3B6FA 2FFFB 4J8UA 5B24B 3AZKD 3LJAC 5AV9C 3REKD 1P3KD 2LY8A 1M18D 2YFVB 5CPKA 2XD1A 4H9QB 3O62B 5CP6C 5AY8C 1P3IB 2BG1A 2NQBA 3LZ1B 3WA9C 3LELC 3C1CB 1KX5B 3UT9D 2Y2NA 4ZBJC 3AZFA 2FJ7C 5E5AD 3VH6A 3B6FC 4JJNC 5FUGA 4J8UC 5BT1C 4DQYB 5DNMA 4H9NA 2F8NH 4KUDC 4XZQC 3W96C 5B31B 5GXQB 2NQBC 1TZYA 1M1AA 1P3AA 4WU9B 1AOIA 2YFWB 4E45A 2Y2KA 5B32D 2Y2JA 5AVBD 5GSUB 4YS3A 1P3LD 5B0ZB 3IP4C 5AV6D 3WKJD 5GT0A 5AV5D 3UTAA 1S32D 5G49B 3X1UA 4UUZB 5JRGB 4H9SA 3B0CT 3X1SD 1P3MD 3A6NA 5B1LD 5B0YB 1M1AC 1KX4A 4YS3C 5AVCC 3AZHC 1P3BC 1P3OB 4Z66A 4J8WA 4CSRA 3X1VB 3H0LC 3AZNB 3B6GA 4LD9D 3UTAC 3O62D 5B31C 1P3ID 3C1BA 3AZLA 3AZIB 3LZ1D 3AZEA 3C1CD 3X1UC 1N1JB 4YM6B 5F99B 1KX5D 1KX3A 4ZUXB 4H9SC 3W98A 2AROA 2Y2QA 1M19A 2ZY3A 3X1TA 1KX4C 1R4VA 3AZJA 1BH8A 3AZGB 3KWQC 1P3FA 3AFAA 1BH9B 3MGSB 1P3GD 4R8PD 2UWXA 5GXQD 3AZLC 3W97A 5DNNB 3TU4B 3AZEC 1P3PB 4WU9D 2CV5B 1KX3C 4KGCA 3EG5B 3MGQB 2HIOB 3W98C 5C3IB 2AROC 2ZY2A 5B0ZD 3AV1A 2W8SA 3REHC 2NZDB 5B2JB 3WTPA 4XUJB 5CPIA 3FDDA 5JRGD 4ZUXC 3WTPE 3NQUB 4KHAB 3UTBA 1B67A 3MGPA 3AZKA 4X23C 5B0YD 5CPJA 3MGRC 2HUEB 1F66C 3AN2C 1EQZB 5B40A 3EPLA 4J8XA 3MVDC 1HQ3B 4EO5C 3LZ0B 3X1VD 3AZND 2Y2GA 5BNVA 4WNNA 3AZID 4DRBA 5AV8A 5KDMA 5CPIC 4YM6D 3AV2A 3REIC 4Z5TD 5B2IB 3WAAB 5E5AA 3UTBC 4H9PB 3RELB 5AVBB 3AZKC 4WU8B 3AZMB 3LJAA 2F8NA 5AV9A 3A1KA 5B1MB 2ZY5A 3REKC 1P3KC 4J8VB 3VH5T 3AZGD 1M18C 5B40C 1S32B 5AY8A 2JCHA 4G91C 3WA9A 3LELA 3MGSD 5B32A 3UT9C 5DNND 1P3PD 3AV2C 2CV5D 3MGQD 5E5AC 4JJNA 1ID3A 2J8PA 4KUDA 5CHLB 2NZDD 3X1SA 5B2JD 4XZQA 3AYWD 2IO5C 3W96A 4XUJD 5GT3D 4LD9B 4QLCB 5B32C 4NE3A 5AVBC 5B24A 1P3LC 1U35D 5AV6C 4G92C 3WKJC 4HGAC 1EQZD 3B0CW 5AV5C 5CPKB 2VQRA 1HQ3D 3LZ0D 3W99D 1ID3C 3V9RB 1P34D 5BO0B 3X1SC 1P3MC 1P3GB 5B1LC 4R8PB 2RVQD 4DRAA 3AZFB 5B2ID 3WAAD 3RELD 5B24C 1WWSA 3REJD 3AZMD 4WU8D 3EPHA 5DNMB 4H9NB 5AVCA 3AZHA 1P3BA 1ULYA 5B1MD 3KUYD 4J8VD 4LD9C 5B31A 3O62C 1P3IC 3LZ1C 1TZYB 3C1CC 4WU9A 1P3AB 2YFWA 1KX5C 1AOIB 5GSUA 5B0ZA 1HTAA 3H0RC 5B33B 5BNXB 5G49A 3KWQA 1JFIA 3A6NB 4R8PC 2FJ7D 5GXQC 4WU9C 4QLCD 4J8UD 4Z5TB 5GSUC 1Z2CB 5B0ZC 2ZM5A 1P3OA 4Z66B 4J8WB 3B6GB 3REHA 5CPKD 3B0DB 2BYMA 1H3OB 3C1BB 1N1JA 5F99A 4YM6A 5JRGC 4ZUXA 3MNNB 2Y2HA 2BYKB 3NQJA 4X23A 5B0YC 3MGRA 3AZFD 1M19B 2JE5A 2PYOB 1F66A 3X1TB 3B0BA 3AN2A 4H9RA 3AZJB 1BH8B 1A7WA 5DNMD 3MVDA 4WV4B 2Y2PA 1P3FB 3AFAB 1P3OC 3X1VC 3AZNC 3MGSA 3AZIC 3KXBB 5DNNA 1TZYD 5BS7C 3TU4A 3AYWB 5GT3B 5F99C 4YM6C 1P3AD 1P3PA 1M1AD 3REIA 1AOID 1BFMA 4YS3D 4KGCB 3MGQA 2HIOA 1T3UA 1ZLAB 3VH5W 1WWIA 3AV1B 4M6BA 1TAFB 2L5AA 5GT0D 3UTAD 2NZDA 5B33D 1U35B 3REKA 1P3KA 5B2JA 3WTPB 1M18A 3AZGC 3NQUA 3W99B 3A6ND 3MGPB 3MGSC 1P34B 3UT9A 5CPJB 5DNNC 4Z2MG 3TU4C 1P3PC 2RIQA 2CV5C 4AWLB 1EQZA 4J8XB 3MGQC 2HIOC 5C3IC 4Z66D 4J8WD 3REJB 2CWEA 3B6GD 2NZDC 3C1BD 3AZLD 4NFTA 3KUYB 5JA4A 5B2JC 3AYWC 4XUJC 2Y2LA 3MNND 3W98D 3WAAA 5AVBA 1M19D 1P3LA 3LJAB 3R45B 2F8NB 4H9OA 2PYOD 5AV9B 2HUEC 5B1MA 3X1TD 4CAYB 5AV6A 4NE6A 3WKJA 3AZJD 1EQZC 5AV5A 1S32A 2F8NG 5CP6B 5AY8B 1HQ3C 1KU5A 1P3FD 3AFAD 3WA9B 3LZ0C 3LELB 2ZY4A 1P34C 3KXBD 3W97D 1P3MA 5B1LA 5B32G 2G5IC 2RVQC 2FJ7B 4KGCD 5B2IC 1ZLAD 3WAAC 3AV1D 4JJNB 4J8UB 3RELC 3B6FB 3AZMC 4WU8C 3VH5A 4KUDB 3VH6T 5B1MC 4WZSB 4J8VC 3WTPD 3W96B 4LD9A 2YFVA 5CPID 4H9QA 3O62A 1S32C 1P3IA 2NQBB 3LZ1A 3C1CA 3UTBD 1KX5A 4QLCA 3MGPD 3EPJA 5CPJD 3H0MC 5B40D 4J8XD 5FUGB 3V9RA 1F1EA 5BO0A 3KFUG 5AV8D 3AV2D 1P3GA 4R8PA 1PZRA 5GXQA 1W2EA 1M1AB 4QLCC 4YS3B 3LJAD 2F8ND 5AVCB 5AV9D 2G5HC 3AZHB 1P3BB 5GT0B 3UTAB 5CPKC 5CP6D 5AY8D 3WA9D 3LELD 3X1UB 4UUZA 5B31G 5JRGA 4WJ3C 1P3GC 5B0YA 3AZFC 5B33A 1KX4B 5BNXA 3B6FD 4JJND 5BT1D 1ID3D 2Y2OA 3KWQB 5DNMC 4KUDD 1JFIB 2JSSA 4XZQD 4CSRB 3X1VA 3W96D 3AZNA 3AZLB 3AZIA 2NQBD 5BS7A 1TZYC 3AZEB 1P3AC 1AOIC 1KX3B 5B24D 2Y2MA 4Z5TA 3W98B 2AROB 5GT0C 3REHB 5B33C 1H3OA 2BYMB 2XD5A 1Q9CA 3AZGA 3MNNA 1BH9A 2BYKA 3A6NC 3NQJB 4X23B 3MGRB 3W97B 2PYOA 1F66B 2CV5A 3P5JB 3AN2B 4H9RB 4Z5TC 3MVDB 5AVCD 3AZHD 3A1IA 1P3BD 4EO5B 4Z66C 4J8WC 3B6GC 5B31D 3B0DC 3C1BC 2DF4C 3KXBA 3AYWA 4XUJA 5GT3A 3X1UD 5CPIB 3REIB 5GSUD 3MNNC 1ZLAA 4KHAA 2DQNC 3UTBB 3AZKB 1TAFA 1M19C 2PYOC 1KX4D 3X1TC 1U35A 3REKB 1P3KB 3AZJC 1M18B 5B40B 1B6WA 3KWQD 1HQ3A 4G91B 1P3FC 3LZ0A 3AFAC 3W99A 3F6TA 5BNVB 1P34A 3UT9B 4WNNB 4UPKA 5AV8B 3KXBC 5KDMB 3AZED 3W97C 5GT3C 3AV2B 1KX3D 3VH6W 5B2IA 4KGCC 1ZLAC 2AROD 5E5AB 2F8NK 4H9PA 3RELA 3AV1C 1P3OD 3REJA 4WU8A 3AZMA 3REHD 1U35C 3KUYA 5JA4B 4J8VA 2IO5B 3WTPC 5F99D 4ZUXD 4NE5A 2F2AC 3W99C 5B32B 3MGPC 4X23D 5CPJC 3MGRD 1P3LB 3R45A 4H9OB 1F66D 4CAYA 3KSYA 5AV6B 4E44A 4AWLC 4ZBJB 4HGAB 4G92B 3EPKA 3AN2D 3WKJB 5AV5B 4J8XC 5CP6A 3MVDD 2Y2IA
chains in the Genus database with same CATH topology
3REJC 1ID3B 3KUYC 3X1SB 4XZQB 5AV8C 3TU4D 1P3MB 5B1LB 3REID 2FJ7A 2HIOD 4Z2MH 3AL0C 3B6FA 2FFFB 4J8UA 5B24B 3AZKD 3LJAC 5AV9C 3REKD 1P3KD 2LY8A 1M18D 2YFVB 5CPKA 2XD1A 4H9QB 3O62B 5CP6C 5AY8C 1P3IB 2BG1A 2NQBA 3LZ1B 3WA9C 3LELC 3C1CB 1KX5B 3UT9D 2Y2NA 4ZBJC 3AZFA 2FJ7C 5E5AD 3VH6A 3B6FC 4JJNC 5FUGA 4J8UC 5BT1C 4DQYB 5DNMA 4H9NA 2F8NH 4KUDC 4XZQC 3W96C 5B31B 5GXQB 2NQBC 1TZYA 1M1AA 1P3AA 4WU9B 1AOIA 2YFWB 4E45A 2Y2KA 5B32D 2Y2JA 5AVBD 5GSUB 4YS3A 1P3LD 5B0ZB 3IP4C 5AV6D 3WKJD 5GT0A 5AV5D 3UTAA 1S32D 5G49B 3X1UA 4UUZB 5JRGB 4H9SA 3B0CT 3X1SD 1P3MD 3A6NA 5B1LD 5B0YB 1M1AC 1KX4A 4YS3C 5AVCC 3AZHC 1P3BC 1P3OB 4Z66A 4J8WA 4CSRA 3X1VB 3H0LC 3AZNB 3B6GA 4LD9D 3UTAC 3O62D 5B31C 1P3ID 3C1BA 3AZLA 3AZIB 3LZ1D 3AZEA 3C1CD 3X1UC 1N1JB 4YM6B 5F99B 1KX5D 1KX3A 4ZUXB 4H9SC 3W98A 2AROA 2Y2QA 1M19A 2ZY3A 3X1TA 1KX4C 1R4VA 3AZJA 1BH8A 3AZGB 3KWQC 1P3FA 3AFAA 1BH9B 3MGSB 1P3GD 4R8PD 2UWXA 5GXQD 3AZLC 3W97A 5DNNB 3TU4B 3AZEC 1P3PB 4WU9D 2CV5B 1KX3C 4KGCA 3EG5B 3MGQB 2HIOB 3W98C 5C3IB 2AROC 2ZY2A 5B0ZD 3AV1A 2W8SA 3REHC 2NZDB 5B2JB 3WTPA 4XUJB 5CPIA 3FDDA 5JRGD 4ZUXC 3WTPE 3NQUB 4KHAB 3UTBA 1B67A 3MGPA 3AZKA 4X23C 5B0YD 5CPJA 3MGRC 2HUEB 1F66C 3AN2C 1EQZB 5B40A 3EPLA 4J8XA 3MVDC 1HQ3B 4EO5C 3LZ0B 3X1VD 3AZND 2Y2GA 5BNVA 4WNNA 3AZID 4DRBA 5AV8A 5KDMA 5CPIC 4YM6D 3AV2A 3REIC 4Z5TD 5B2IB 3WAAB 5E5AA 3UTBC 4H9PB 3RELB 5AVBB 3AZKC 4WU8B 3AZMB 3LJAA 2F8NA 5AV9A 3A1KA 5B1MB 2ZY5A 3REKC 1P3KC 4J8VB 3VH5T 3AZGD 1M18C 5B40C 1S32B 5AY8A 2JCHA 4G91C 3WA9A 3LELA 3MGSD 5B32A 3UT9C 5DNND 1P3PD 3AV2C 2CV5D 3MGQD 5E5AC 4JJNA 1ID3A 2J8PA 4KUDA 5CHLB 2NZDD 3X1SA 5B2JD 4XZQA 3AYWD 2IO5C 3W96A 4XUJD 5GT3D 4LD9B 4QLCB 5B32C 4NE3A 5AVBC 5B24A 1P3LC 1U35D 5AV6C 4G92C 3WKJC 4HGAC 1EQZD 3B0CW 5AV5C 5CPKB 2VQRA 1HQ3D 3LZ0D 3W99D 1ID3C 3V9RB 1P34D 5BO0B 3X1SC 1P3MC 1P3GB 5B1LC 4R8PB 2RVQD 4DRAA 3AZFB 5B2ID 3WAAD 3RELD 5B24C 1WWSA 3REJD 3AZMD 4WU8D 3EPHA 5DNMB 4H9NB 5AVCA 3AZHA 1P3BA 1ULYA 5B1MD 3KUYD 4J8VD 4LD9C 5B31A 3O62C 1P3IC 3LZ1C 1TZYB 3C1CC 4WU9A 1P3AB 2YFWA 1KX5C 1AOIB 5GSUA 5B0ZA 1HTAA 3H0RC 5B33B 5BNXB 5G49A 3KWQA 1JFIA 3A6NB 4R8PC 2FJ7D 5GXQC 4WU9C 4QLCD 4J8UD 4Z5TB 5GSUC 1Z2CB 5B0ZC 2ZM5A 1P3OA 4Z66B 4J8WB 3B6GB 3REHA 5CPKD 3B0DB 2BYMA 1H3OB 3C1BB 1N1JA 5F99A 4YM6A 5JRGC 4ZUXA 3MNNB 2Y2HA 2BYKB 3NQJA 4X23A 5B0YC 3MGRA 3AZFD 1M19B 2JE5A 2PYOB 1F66A 3X1TB 3B0BA 3AN2A 4H9RA 3AZJB 1BH8B 1A7WA 5DNMD 3MVDA 4WV4B 2Y2PA 1P3FB 3AFAB 1P3OC 3X1VC 3AZNC 3MGSA 3AZIC 3KXBB 5DNNA 1TZYD 5BS7C 3TU4A 3AYWB 5GT3B 5F99C 4YM6C 1P3AD 1P3PA 1M1AD 3REIA 1AOID 1BFMA 4YS3D 4KGCB 3MGQA 2HIOA 1T3UA 1ZLAB 3VH5W 1WWIA 3AV1B 4M6BA 1TAFB 2L5AA 5GT0D 3UTAD 2NZDA 5B33D 1U35B 3REKA 1P3KA 5B2JA 3WTPB 1M18A 3AZGC 3NQUA 3W99B 3A6ND 3MGPB 3MGSC 1P34B 3UT9A 5CPJB 5DNNC 4Z2MG 3TU4C 1P3PC 2RIQA 2CV5C 4AWLB 1EQZA 4J8XB 3MGQC 2HIOC 5C3IC 4Z66D 4J8WD 3REJB 2CWEA 3B6GD 2NZDC 3C1BD 3AZLD 4NFTA 3KUYB 5JA4A 5B2JC 3AYWC 4XUJC 2Y2LA 3MNND 3W98D 3WAAA 5AVBA 1M19D 1P3LA 3LJAB 3R45B 2F8NB 4H9OA 2PYOD 5AV9B 2HUEC 5B1MA 3X1TD 4CAYB 5AV6A 4NE6A 3WKJA 3AZJD 1EQZC 5AV5A 1S32A 2F8NG 5CP6B 5AY8B 1HQ3C 1KU5A 1P3FD 3AFAD 3WA9B 3LZ0C 3LELB 2ZY4A 1P34C 3KXBD 3W97D 1P3MA 5B1LA 5B32G 2G5IC 2RVQC 2FJ7B 4KGCD 5B2IC 1ZLAD 3WAAC 3AV1D 4JJNB 4J8UB 3RELC 3B6FB 3AZMC 4WU8C 3VH5A 4KUDB 3VH6T 5B1MC 4WZSB 4J8VC 3WTPD 3W96B 4LD9A 2YFVA 5CPID 4H9QA 3O62A 1S32C 1P3IA 2NQBB 3LZ1A 3C1CA 3UTBD 1KX5A 4QLCA 3MGPD 3EPJA 5CPJD 3H0MC 5B40D 4J8XD 5FUGB 3V9RA 1F1EA 5BO0A 3KFUG 5AV8D 3AV2D 1P3GA 4R8PA 1PZRA 5GXQA 1W2EA 1M1AB 4QLCC 4YS3B 3LJAD 2F8ND 5AVCB 5AV9D 2G5HC 3AZHB 1P3BB 5GT0B 3UTAB 5CPKC 5CP6D 5AY8D 3WA9D 3LELD 3X1UB 4UUZA 5B31G 5JRGA 4WJ3C 1P3GC 5B0YA 3AZFC 5B33A 1KX4B 5BNXA 3B6FD 4JJND 5BT1D 1ID3D 2Y2OA 3KWQB 5DNMC 4KUDD 1JFIB 2JSSA 4XZQD 4CSRB 3X1VA 3W96D 3AZNA 3AZLB 3AZIA 2NQBD 5BS7A 1TZYC 3AZEB 1P3AC 1AOIC 1KX3B 5B24D 2Y2MA 4Z5TA 3W98B 2AROB 5GT0C 3REHB 5B33C 1H3OA 2BYMB 2XD5A 1Q9CA 3AZGA 3MNNA 1BH9A 2BYKA 3A6NC 3NQJB 4X23B 3MGRB 3W97B 2PYOA 1F66B 2CV5A 3P5JB 3AN2B 4H9RB 4Z5TC 3MVDB 5AVCD 3AZHD 3A1IA 1P3BD 4EO5B 4Z66C 4J8WC 3B6GC 5B31D 3B0DC 3C1BC 2DF4C 3KXBA 3AYWA 4XUJA 5GT3A 3X1UD 5CPIB 3REIB 5GSUD 3MNNC 1ZLAA 4KHAA 2DQNC 3UTBB 3AZKB 1TAFA 1M19C 2PYOC 1KX4D 3X1TC 1U35A 3REKB 1P3KB 3AZJC 1M18B 5B40B 1B6WA 3KWQD 1HQ3A 4G91B 1P3FC 3LZ0A 3AFAC 3W99A 3F6TA 5BNVB 1P34A 3UT9B 4WNNB 4UPKA 5AV8B 3KXBC 5KDMB 3AZED 3W97C 5GT3C 3AV2B 1KX3D 3VH6W 5B2IA 4KGCC 1ZLAC 2AROD 5E5AB 2F8NK 4H9PA 3RELA 3AV1C 1P3OD 3REJA 4WU8A 3AZMA 3REHD 1U35C 3KUYA 5JA4B 4J8VA 2IO5B 3WTPC 5F99D 4ZUXD 4NE5A 2F2AC 3W99C 5B32B 3MGPC 4X23D 5CPJC 3MGRD 1P3LB 3R45A 4H9OB 1F66D 4CAYA 3KSYA 5AV6B 4E44A 4AWLC 4ZBJB 4HGAB 4G92B 3EPKA 3AN2D 3WKJB 5AV5B 4J8XC 5CP6A 3MVDD 2Y2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REJ C;  1ID3 B;  3KUY C;  3X1S B;  4XZQ B;  5AV8 C;  3TU4 D;  1P3M B;  5B1L B;  3REI D;  2FJ7 A;  2HIO D;  4Z2M H;  3B6F A;  4J8U A;  5B24 B;  3AZK D;  3LJA C;  5AV9 C;  3REK D;  1P3K D;  2LY8 A;  1M18 D;  2YFV B;  5CPK A;  4H9Q B;  3O62 B;  1P3I B;  5CP6 C;  5AY8 C;  2NQB A;  3LZ1 B;  3WA9 C;  3LEL C;  3C1C B;  1KX5 B;  3UT9 D;  4ZBJ C;  3AZF A;  2FJ7 C;  5E5A D;  3VH6 A;  3B6F C;  4JJN C;  5FUG A;  4J8U C;  5BT1 C;  5DNM A;  4H9N A;  2F8N H;  4KUD C;  4XZQ C;  3W96 C;  5B31 B;  5GXQ B;  2NQB C;  1TZY A;  1M1A A;  1P3A A;  4WU9 B;  1AOI A;  2YFW B;  4E45 A;  5B32 D;  5AVB D;  4YS3 A;  5GSU B;  1P3L D;  5B0Z B;  5AV6 D;  3WKJ D;  5GT0 A;  5AV5 D;  3UTA A;  1S32 D;  5G49 B;  3X1U A;  4UUZ B;  5JRG B;  4H9S A;  3B0C T;  3X1S D;  1P3M D;  3A6N A;  5B1L D;  5B0Y B;  1M1A C;  1KX4 A;  4YS3 C;  5AVC C;  3AZH C;  1P3B C;  1P3O B;  4Z66 A;  4J8W A;  4CSR A;  3X1V B;  3AZN B;  3B6G A;  4LD9 D;  3UTA C;  3O62 D;  5B31 C;  1P3I D;  3C1B A;  3AZL A;  3AZI B;  3LZ1 D;  3AZE A;  3C1C D;  3X1U C;  1N1J B;  4YM6 B;  5F99 B;  1KX5 D;  1KX3 A;  4ZUX B;  4H9S C;  3W98 A;  2ARO A;  1M19 A;  3X1T A;  1KX4 C;  1R4V A;  3AZJ A;  1BH8 A;  3AZG B;  3KWQ C;  1P3F A;  3AFA A;  1BH9 B;  3MGS B;  1P3G D;  4R8P D;  3AZL C;  5GXQ D;  3W97 A;  5DNN B;  3TU4 B;  3AZE C;  1P3P B;  4WU9 D;  2CV5 B;  1KX3 C;  4KGC A;  3MGQ B;  3W98 C;  2HIO B;  5C3I B;  2ARO C;  5B0Z D;  3AV1 A;  3REH C;  2NZD B;  5B2J B;  3WTP A;  4XUJ B;  5CPI A;  5JRG D;  4ZUX C;  3WTP E;  3NQU B;  4KHA B;  3UTB A;  1B67 A;  3MGP A;  3AZK A;  4X23 C;  5B0Y D;  5CPJ A;  3MGR C;  2HUE B;  1F66 C;  3AN2 C;  1EQZ B;  5B40 A;  4J8X A;  3MVD C;  1HQ3 B;  4EO5 C;  3LZ0 B;  3X1V D;  3AZN D;  5BNV A;  4WNN A;  3AZI D;  4DRB A;  5AV8 A;  5KDM A;  5CPI C;  4YM6 D;  3AV2 A;  3REI C;  4Z5T D;  5B2I B;  3WAA B;  5E5A A;  3UTB C;  4H9P B;  3REL B;  5AVB B;  3AZK C;  4WU8 B;  3AZM B;  3LJA A;  2F8N A;  5AV9 A;  5B1M B;  3REK C;  1P3K C;  4J8V B;  3VH5 T;  3AZG D;  1M18 C;  5B40 C;  1S32 B;  5AY8 A;  4G91 C;  3WA9 A;  3LEL A;  3MGS D;  5B32 A;  3UT9 C;  5DNN D;  1P3P D;  3AV2 C;  2CV5 D;  3MGQ D;  5E5A C;  4JJN A;  1ID3 A;  4KUD A;  5CHL B;  2NZD D;  3X1S A;  5B2J D;  4XZQ A;  3AYW D;  2IO5 C;  3W96 A;  4XUJ D;  5GT3 D;  4LD9 B;  4QLC B;  5B32 C;  4NE3 A;  5AVB C;  5B24 A;  1P3L C;  1U35 D;  5AV6 C;  4G92 C;  3WKJ C;  4HGA C;  1EQZ D;  3B0C W;  5AV5 C;  5CPK B;  1HQ3 D;  3LZ0 D;  3W99 D;  1ID3 C;  3V9R B;  1P34 D;  5BO0 B;  3X1S C;  1P3M C;  1P3G B;  5B1L C;  4R8P B;  2RVQ D;  4DRA A;  3AZF B;  5B2I D;  3WAA D;  3REL D;  5B24 C;  1WWS A;  3REJ D;  3AZM D;  4WU8 D;  5DNM B;  4H9N B;  5AVC A;  3AZH A;  1P3B A;  1ULY A;  5B1M D;  3KUY D;  4J8V D;  4LD9 C;  5B31 A;  3O62 C;  1P3I C;  3LZ1 C;  1TZY B;  3C1C C;  4WU9 A;  1P3A B;  2YFW A;  1KX5 C;  1AOI B;  5GSU A;  5B0Z A;  1HTA A;  5B33 B;  5BNX B;  5G49 A;  3KWQ A;  1JFI A;  3A6N B;  4R8P C;  2FJ7 D;  5GXQ C;  4WU9 C;  4QLC D;  4J8U D;  4Z5T B;  5GSU C;  5B0Z C;  1P3O A;  4Z66 B;  4J8W B;  3B6G B;  3REH A;  5CPK D;  3B0D B;  2BYM A;  1H3O B;  3C1B B;  1N1J A;  5F99 A;  4YM6 A;  5JRG C;  4ZUX A;  3MNN B;  2BYK B;  3NQJ A;  4X23 A;  5B0Y C;  3MGR A;  3AZF D;  1M19 B;  2PYO B;  1F66 A;  3X1T B;  3B0B A;  3AN2 A;  4H9R A;  3AZJ B;  1BH8 B;  1A7W A;  5DNM D;  3MVD A;  4WV4 B;  1P3F B;  3AFA B;  1P3O C;  3X1V C;  3AZN C;  3MGS A;  3AZI C;  3KXB B;  5DNN A;  1TZY D;  5BS7 C;  3TU4 A;  3AYW B;  5GT3 B;  5F99 C;  4YM6 C;  1P3A D;  1P3P A;  1M1A D;  3REI A;  1AOI D;  1BFM A;  4YS3 D;  4KGC B;  3MGQ A;  2HIO A;  1ZLA B;  3VH5 W;  1WWI A;  3AV1 B;  4M6B A;  1TAF B;  2L5A A;  5GT0 D;  3UTA D;  2NZD A;  5B33 D;  1U35 B;  3REK A;  1P3K A;  5B2J A;  3WTP B;  1M18 A;  3AZG C;  3NQU A;  3W99 B;  3A6N D;  3MGP B;  3MGS C;  1P34 B;  3UT9 A;  5CPJ B;  5DNN C;  4Z2M G;  3TU4 C;  1P3P C;  2CV5 C;  4AWL B;  1EQZ A;  4J8X B;  3MGQ C;  2HIO C;  5C3I C;  4Z66 D;  4J8W D;  3REJ B;  2CWE A;  3B6G D;  2NZD C;  3C1B D;  3AZL D;  4NFT A;  3KUY B;  5JA4 A;  5B2J C;  3AYW C;  4XUJ C;  3MNN D;  3W98 D;  3WAA A;  5AVB A;  1M19 D;  1P3L A;  3LJA B;  3R45 B;  2F8N B;  4H9O A;  2PYO D;  5AV9 B;  2HUE C;  5B1M A;  3X1T D;  4CAY B;  5AV6 A;  4NE6 A;  3WKJ A;  3AZJ D;  1EQZ C;  5AV5 A;  1S32 A;  2F8N G;  5CP6 B;  5AY8 B;  1HQ3 C;  1KU5 A;  1P3F D;  3AFA D;  3WA9 B;  3LZ0 C;  3LEL B;  1P34 C;  3KXB D;  3W97 D;  1P3M A;  5B1L A;  5B32 G;  2RVQ C;  2FJ7 B;  4KGC D;  5B2I C;  1ZLA D;  3WAA C;  3AV1 D;  4JJN B;  4J8U B;  3REL C;  3B6F B;  3AZM C;  4WU8 C;  3VH5 A;  4KUD B;  3VH6 T;  5B1M C;  4WZS B;  4J8V C;  3WTP D;  3W96 B;  4LD9 A;  2YFV A;  5CPI D;  4H9Q A;  3O62 A;  1S32 C;  1P3I A;  2NQB B;  3LZ1 A;  3C1C A;  3UTB D;  1KX5 A;  4QLC A;  3MGP D;  5CPJ D;  5B40 D;  4J8X D;  5FUG B;  3V9R A;  1F1E A;  5BO0 A;  5AV8 D;  3AV2 D;  1P3G A;  4R8P A;  5GXQ A;  1M1A B;  4QLC C;  4YS3 B;  3LJA D;  2F8N D;  5AVC B;  5AV9 D;  3AZH B;  1P3B B;  5GT0 B;  3UTA B;  5CPK C;  5CP6 D;  5AY8 D;  3WA9 D;  3LEL D;  3X1U B;  4UUZ A;  5B31 G;  5JRG A;  1P3G C;  5B0Y A;  3AZF C;  5B33 A;  1KX4 B;  5BNX A;  3B6F D;  4JJN D;  5BT1 D;  1ID3 D;  3KWQ B;  5DNM C;  4KUD D;  1JFI B;  2JSS A;  4XZQ D;  4CSR B;  3X1V A;  3W96 D;  3AZN A;  3AZL B;  3AZI A;  2NQB D;  5BS7 A;  1TZY C;  3AZE B;  1P3A C;  1AOI C;  1KX3 B;  5B24 D;  4Z5T A;  3W98 B;  2ARO B;  5GT0 C;  3REH B;  5B33 C;  1H3O A;  2BYM B;  1Q9C A;  3AZG A;  3MNN A;  1BH9 A;  2BYK A;  3A6N C;  3NQJ B;  4X23 B;  3MGR B;  3W97 B;  2PYO A;  1F66 B;  2CV5 A;  3AN2 B;  4H9R B;  4Z5T C;  3MVD B;  5AVC D;  3AZH D;  1P3B D;  4EO5 B;  4Z66 C;  4J8W C;  3B6G C;  5B31 D;  3B0D C;  3C1B C;  3KXB A;  3AYW A;  4XUJ A;  5GT3 A;  3X1U D;  5CPI B;  3REI B;  5GSU D;  3MNN C;  1ZLA A;  4KHA A;  3UTB B;  3AZK B;  1TAF A;  1M19 C;  2PYO C;  1KX4 D;  3X1T C;  1U35 A;  3REK B;  1P3K B;  3AZJ C;  1M18 B;  5B40 B;  1B6W A;  3KWQ D;  1HQ3 A;  4G91 B;  1P3F C;  3LZ0 A;  3AFA C;  3W99 A;  5BNV B;  1P34 A;  3UT9 B;  4WNN B;  3KXB C;  5AV8 B;  3AZE D;  5KDM B;  3W97 C;  5GT3 C;  3AV2 B;  1KX3 D;  3VH6 W;  5B2I A;  4KGC C;  1ZLA C;  2ARO D;  5E5A B;  2F8N K;  4H9P A;  3REL A;  3AV1 C;  1P3O D;  3REJ A;  4WU8 A;  3AZM A;  3REH D;  1U35 C;  3KUY A;  5JA4 B;  4J8V A;  2IO5 B;  3WTP C;  5F99 D;  4ZUX D;  4NE5 A;  3W99 C;  5B32 B;  3MGP C;  4X23 D;  5CPJ C;  3MGR D;  1P3L B;  3R45 A;  4H9O B;  1F66 D;  4CAY A;  3KSY A;  5AV6 B;  4E44 A;  4AWL C;  4ZBJ B;  4HGA B;  4G92 B;  3AN2 D;  3WKJ B;  5AV5 B;  4J8X C;  5CP6 A;  3MVD D; 
#chains in the Genus database with same CATH topology
 3REJ C;  1ID3 B;  3KUY C;  3X1S B;  4XZQ B;  5AV8 C;  3TU4 D;  1P3M B;  5B1L B;  3REI D;  2FJ7 A;  2HIO D;  4Z2M H;  3AL0 C;  3B6F A;  2FFF B;  4J8U A;  5B24 B;  3AZK D;  3LJA C;  5AV9 C;  3REK D;  1P3K D;  2LY8 A;  1M18 D;  2YFV B;  5CPK A;  2XD1 A;  4H9Q B;  3O62 B;  5CP6 C;  5AY8 C;  1P3I B;  2BG1 A;  2NQB A;  3LZ1 B;  3WA9 C;  3LEL C;  3C1C B;  1KX5 B;  3UT9 D;  2Y2N A;  4ZBJ C;  3AZF A;  2FJ7 C;  5E5A D;  3VH6 A;  3B6F C;  4JJN C;  5FUG A;  4J8U C;  5BT1 C;  4DQY B;  5DNM A;  4H9N A;  2F8N H;  4KUD C;  4XZQ C;  3W96 C;  5B31 B;  5GXQ B;  2NQB C;  1TZY A;  1M1A A;  1P3A A;  4WU9 B;  1AOI A;  2YFW B;  4E45 A;  2Y2K A;  5B32 D;  2Y2J A;  5AVB D;  5GSU B;  4YS3 A;  1P3L D;  5B0Z B;  3IP4 C;  5AV6 D;  3WKJ D;  5GT0 A;  5AV5 D;  3UTA A;  1S32 D;  5G49 B;  3X1U A;  4UUZ B;  5JRG B;  4H9S A;  3B0C T;  3X1S D;  1P3M D;  3A6N A;  5B1L D;  5B0Y B;  1M1A C;  1KX4 A;  4YS3 C;  5AVC C;  3AZH C;  1P3B C;  1P3O B;  4Z66 A;  4J8W A;  4CSR A;  3X1V B;  3H0L C;  3AZN B;  3B6G A;  4LD9 D;  3UTA C;  3O62 D;  5B31 C;  1P3I D;  3C1B A;  3AZL A;  3AZI B;  3LZ1 D;  3AZE A;  3C1C D;  3X1U C;  1N1J B;  4YM6 B;  5F99 B;  1KX5 D;  1KX3 A;  4ZUX B;  4H9S C;  3W98 A;  2ARO A;  2Y2Q A;  1M19 A;  2ZY3 A;  3X1T A;  1KX4 C;  1R4V A;  3AZJ A;  1BH8 A;  3AZG B;  3KWQ C;  1P3F A;  3AFA A;  1BH9 B;  3MGS B;  1P3G D;  4R8P D;  2UWX A;  5GXQ D;  3AZL C;  3W97 A;  5DNN B;  3TU4 B;  3AZE C;  1P3P B;  4WU9 D;  2CV5 B;  1KX3 C;  4KGC A;  3EG5 B;  3MGQ B;  2HIO B;  3W98 C;  5C3I B;  2ARO C;  2ZY2 A;  5B0Z D;  3AV1 A;  2W8S A;  3REH C;  2NZD B;  5B2J B;  3WTP A;  4XUJ B;  5CPI A;  3FDD A;  5JRG D;  4ZUX C;  3WTP E;  3NQU B;  4KHA B;  3UTB A;  1B67 A;  3MGP A;  3AZK A;  4X23 C;  5B0Y D;  5CPJ A;  3MGR C;  2HUE B;  1F66 C;  3AN2 C;  1EQZ B;  5B40 A;  3EPL A;  4J8X A;  3MVD C;  1HQ3 B;  4EO5 C;  3LZ0 B;  3X1V D;  3AZN D;  2Y2G A;  5BNV A;  4WNN A;  3AZI D;  4DRB A;  5AV8 A;  5KDM A;  5CPI C;  4YM6 D;  3AV2 A;  3REI C;  4Z5T D;  5B2I B;  3WAA B;  5E5A A;  3UTB C;  4H9P B;  3REL B;  5AVB B;  3AZK C;  4WU8 B;  3AZM B;  3LJA A;  2F8N A;  5AV9 A;  3A1K A;  5B1M B;  2ZY5 A;  3REK C;  1P3K C;  4J8V B;  3VH5 T;  3AZG D;  1M18 C;  5B40 C;  1S32 B;  5AY8 A;  2JCH A;  4G91 C;  3WA9 A;  3LEL A;  3MGS D;  5B32 A;  3UT9 C;  5DNN D;  1P3P D;  3AV2 C;  2CV5 D;  3MGQ D;  5E5A C;  4JJN A;  1ID3 A;  2J8P A;  4KUD A;  5CHL B;  2NZD D;  3X1S A;  5B2J D;  4XZQ A;  3AYW D;  2IO5 C;  3W96 A;  4XUJ D;  5GT3 D;  4LD9 B;  4QLC B;  5B32 C;  4NE3 A;  5AVB C;  5B24 A;  1P3L C;  1U35 D;  5AV6 C;  4G92 C;  3WKJ C;  4HGA C;  1EQZ D;  3B0C W;  5AV5 C;  5CPK B;  2VQR A;  1HQ3 D;  3LZ0 D;  3W99 D;  1ID3 C;  3V9R B;  1P34 D;  5BO0 B;  3X1S C;  1P3M C;  1P3G B;  5B1L C;  4R8P B;  2RVQ D;  4DRA A;  3AZF B;  5B2I D;  3WAA D;  3REL D;  5B24 C;  1WWS A;  3REJ D;  3AZM D;  4WU8 D;  3EPH A;  5DNM B;  4H9N B;  5AVC A;  3AZH A;  1P3B A;  1ULY A;  5B1M D;  3KUY D;  4J8V D;  4LD9 C;  5B31 A;  3O62 C;  1P3I C;  3LZ1 C;  1TZY B;  3C1C C;  4WU9 A;  1P3A B;  2YFW A;  1KX5 C;  1AOI B;  5GSU A;  5B0Z A;  1HTA A;  3H0R C;  5B33 B;  5BNX B;  5G49 A;  3KWQ A;  1JFI A;  3A6N B;  4R8P C;  2FJ7 D;  5GXQ C;  4WU9 C;  4QLC D;  4J8U D;  4Z5T B;  5GSU C;  1Z2C B;  5B0Z C;  2ZM5 A;  1P3O A;  4Z66 B;  4J8W B;  3B6G B;  3REH A;  5CPK D;  3B0D B;  2BYM A;  1H3O B;  3C1B B;  1N1J A;  5F99 A;  4YM6 A;  5JRG C;  4ZUX A;  3MNN B;  2Y2H A;  2BYK B;  3NQJ A;  4X23 A;  5B0Y C;  3MGR A;  3AZF D;  1M19 B;  2JE5 A;  2PYO B;  1F66 A;  3X1T B;  3B0B A;  3AN2 A;  4H9R A;  3AZJ B;  1BH8 B;  1A7W A;  5DNM D;  3MVD A;  4WV4 B;  2Y2P A;  1P3F B;  3AFA B;  1P3O C;  3X1V C;  3AZN C;  3MGS A;  3AZI C;  3KXB B;  5DNN A;  1TZY D;  5BS7 C;  3TU4 A;  3AYW B;  5GT3 B;  5F99 C;  4YM6 C;  1P3A D;  1P3P A;  1M1A D;  3REI A;  1AOI D;  1BFM A;  4YS3 D;  4KGC B;  3MGQ A;  2HIO A;  1T3U A;  1ZLA B;  3VH5 W;  1WWI A;  3AV1 B;  4M6B A;  1TAF B;  2L5A A;  5GT0 D;  3UTA D;  2NZD A;  5B33 D;  1U35 B;  3REK A;  1P3K A;  5B2J A;  3WTP B;  1M18 A;  3AZG C;  3NQU A;  3W99 B;  3A6N D;  3MGP B;  3MGS C;  1P34 B;  3UT9 A;  5CPJ B;  5DNN C;  4Z2M G;  3TU4 C;  1P3P C;  2RIQ A;  2CV5 C;  4AWL B;  1EQZ A;  4J8X B;  3MGQ C;  2HIO C;  5C3I C;  4Z66 D;  4J8W D;  3REJ B;  2CWE A;  3B6G D;  2NZD C;  3C1B D;  3AZL D;  4NFT A;  3KUY B;  5JA4 A;  5B2J C;  3AYW C;  4XUJ C;  2Y2L A;  3MNN D;  3W98 D;  3WAA A;  5AVB A;  1M19 D;  1P3L A;  3LJA B;  3R45 B;  2F8N B;  4H9O A;  2PYO D;  5AV9 B;  2HUE C;  5B1M A;  3X1T D;  4CAY B;  5AV6 A;  4NE6 A;  3WKJ A;  3AZJ D;  1EQZ C;  5AV5 A;  1S32 A;  2F8N G;  5CP6 B;  5AY8 B;  1HQ3 C;  1KU5 A;  1P3F D;  3AFA D;  3WA9 B;  3LZ0 C;  3LEL B;  2ZY4 A;  1P34 C;  3KXB D;  3W97 D;  1P3M A;  5B1L A;  5B32 G;  2G5I C;  2RVQ C;  2FJ7 B;  4KGC D;  5B2I C;  1ZLA D;  3WAA C;  3AV1 D;  4JJN B;  4J8U B;  3REL C;  3B6F B;  3AZM C;  4WU8 C;  3VH5 A;  4KUD B;  3VH6 T;  5B1M C;  4WZS B;  4J8V C;  3WTP D;  3W96 B;  4LD9 A;  2YFV A;  5CPI D;  4H9Q A;  3O62 A;  1S32 C;  1P3I A;  2NQB B;  3LZ1 A;  3C1C A;  3UTB D;  1KX5 A;  4QLC A;  3MGP D;  3EPJ A;  5CPJ D;  3H0M C;  5B40 D;  4J8X D;  5FUG B;  3V9R A;  1F1E A;  5BO0 A;  3KFU G;  5AV8 D;  3AV2 D;  1P3G A;  4R8P A;  1PZR A;  5GXQ A;  1W2E A;  1M1A B;  4QLC C;  4YS3 B;  3LJA D;  2F8N D;  5AVC B;  5AV9 D;  2G5H C;  3AZH B;  1P3B B;  5GT0 B;  3UTA B;  5CPK C;  5CP6 D;  5AY8 D;  3WA9 D;  3LEL D;  3X1U B;  4UUZ A;  5B31 G;  5JRG A;  4WJ3 C;  1P3G C;  5B0Y A;  3AZF C;  5B33 A;  1KX4 B;  5BNX A;  3B6F D;  4JJN D;  5BT1 D;  1ID3 D;  2Y2O A;  3KWQ B;  5DNM C;  4KUD D;  1JFI B;  2JSS A;  4XZQ D;  4CSR B;  3X1V A;  3W96 D;  3AZN A;  3AZL B;  3AZI A;  2NQB D;  5BS7 A;  1TZY C;  3AZE B;  1P3A C;  1AOI C;  1KX3 B;  5B24 D;  2Y2M A;  4Z5T A;  3W98 B;  2ARO B;  5GT0 C;  3REH B;  5B33 C;  1H3O A;  2BYM B;  2XD5 A;  1Q9C A;  3AZG A;  3MNN A;  1BH9 A;  2BYK A;  3A6N C;  3NQJ B;  4X23 B;  3MGR B;  3W97 B;  2PYO A;  1F66 B;  2CV5 A;  3P5J B;  3AN2 B;  4H9R B;  4Z5T C;  3MVD B;  5AVC D;  3AZH D;  3A1I A;  1P3B D;  4EO5 B;  4Z66 C;  4J8W C;  3B6G C;  5B31 D;  3B0D C;  3C1B C;  2DF4 C;  3KXB A;  3AYW A;  4XUJ A;  5GT3 A;  3X1U D;  5CPI B;  3REI B;  5GSU D;  3MNN C;  1ZLA A;  4KHA A;  2DQN C;  3UTB B;  3AZK B;  1TAF A;  1M19 C;  2PYO C;  1KX4 D;  3X1T C;  1U35 A;  3REK B;  1P3K B;  3AZJ C;  1M18 B;  5B40 B;  1B6W A;  3KWQ D;  1HQ3 A;  4G91 B;  1P3F C;  3LZ0 A;  3AFA C;  3W99 A;  3F6T A;  5BNV B;  1P34 A;  3UT9 B;  4WNN B;  4UPK A;  5AV8 B;  3KXB C;  5KDM B;  3AZE D;  3W97 C;  5GT3 C;  3AV2 B;  1KX3 D;  3VH6 W;  5B2I A;  4KGC C;  1ZLA C;  2ARO D;  5E5A B;  2F8N K;  4H9P A;  3REL A;  3AV1 C;  1P3O D;  3REJ A;  4WU8 A;  3AZM A;  3REH D;  1U35 C;  3KUY A;  5JA4 B;  4J8V A;  2IO5 B;  3WTP C;  5F99 D;  4ZUX D;  4NE5 A;  2F2A C;  3W99 C;  5B32 B;  3MGP C;  4X23 D;  5CPJ C;  3MGR D;  1P3L B;  3R45 A;  4H9O B;  1F66 D;  4CAY A;  3KSY A;  5AV6 B;  4E44 A;  4AWL C;  4ZBJ B;  4HGA B;  4G92 B;  3EPK A;  3AN2 D;  3WKJ B;  5AV5 B;  4J8X C;  5CP6 A;  3MVD D;  2Y2I A; 
#chains in the Genus database with same CATH homology
 3REJ C;  1ID3 B;  3KUY C;  3X1S B;  4XZQ B;  5AV8 C;  3TU4 D;  1P3M B;  5B1L B;  3REI D;  2FJ7 A;  2HIO D;  4Z2M H;  3AL0 C;  3B6F A;  2FFF B;  4J8U A;  5B24 B;  3AZK D;  3LJA C;  5AV9 C;  3REK D;  1P3K D;  2LY8 A;  1M18 D;  2YFV B;  5CPK A;  2XD1 A;  4H9Q B;  3O62 B;  5CP6 C;  5AY8 C;  1P3I B;  2BG1 A;  2NQB A;  3LZ1 B;  3WA9 C;  3LEL C;  3C1C B;  1KX5 B;  3UT9 D;  2Y2N A;  4ZBJ C;  3AZF A;  2FJ7 C;  5E5A D;  3VH6 A;  3B6F C;  4JJN C;  5FUG A;  4J8U C;  5BT1 C;  4DQY B;  5DNM A;  4H9N A;  2F8N H;  4KUD C;  4XZQ C;  3W96 C;  5B31 B;  5GXQ B;  2NQB C;  1TZY A;  1M1A A;  1P3A A;  4WU9 B;  1AOI A;  2YFW B;  4E45 A;  2Y2K A;  5B32 D;  2Y2J A;  5AVB D;  5GSU B;  4YS3 A;  1P3L D;  5B0Z B;  3IP4 C;  5AV6 D;  3WKJ D;  5GT0 A;  5AV5 D;  3UTA A;  1S32 D;  5G49 B;  3X1U A;  4UUZ B;  5JRG B;  4H9S A;  3B0C T;  3X1S D;  1P3M D;  3A6N A;  5B1L D;  5B0Y B;  1M1A C;  1KX4 A;  4YS3 C;  5AVC C;  3AZH C;  1P3B C;  1P3O B;  4Z66 A;  4J8W A;  4CSR A;  3X1V B;  3H0L C;  3AZN B;  3B6G A;  4LD9 D;  3UTA C;  3O62 D;  5B31 C;  1P3I D;  3C1B A;  3AZL A;  3AZI B;  3LZ1 D;  3AZE A;  3C1C D;  3X1U C;  1N1J B;  4YM6 B;  5F99 B;  1KX5 D;  1KX3 A;  4ZUX B;  4H9S C;  3W98 A;  2ARO A;  2Y2Q A;  1M19 A;  2ZY3 A;  3X1T A;  1KX4 C;  1R4V A;  3AZJ A;  1BH8 A;  3AZG B;  3KWQ C;  1P3F A;  3AFA A;  1BH9 B;  3MGS B;  1P3G D;  4R8P D;  2UWX A;  5GXQ D;  3AZL C;  3W97 A;  5DNN B;  3TU4 B;  3AZE C;  1P3P B;  4WU9 D;  2CV5 B;  1KX3 C;  4KGC A;  3EG5 B;  3MGQ B;  2HIO B;  3W98 C;  5C3I B;  2ARO C;  2ZY2 A;  5B0Z D;  3AV1 A;  2W8S A;  3REH C;  2NZD B;  5B2J B;  3WTP A;  4XUJ B;  5CPI A;  3FDD A;  5JRG D;  4ZUX C;  3WTP E;  3NQU B;  4KHA B;  3UTB A;  1B67 A;  3MGP A;  3AZK A;  4X23 C;  5B0Y D;  5CPJ A;  3MGR C;  2HUE B;  1F66 C;  3AN2 C;  1EQZ B;  5B40 A;  3EPL A;  4J8X A;  3MVD C;  1HQ3 B;  4EO5 C;  3LZ0 B;  3X1V D;  3AZN D;  2Y2G A;  5BNV A;  4WNN A;  3AZI D;  4DRB A;  5AV8 A;  5KDM A;  5CPI C;  4YM6 D;  3AV2 A;  3REI C;  4Z5T D;  5B2I B;  3WAA B;  5E5A A;  3UTB C;  4H9P B;  3REL B;  5AVB B;  3AZK C;  4WU8 B;  3AZM B;  3LJA A;  2F8N A;  5AV9 A;  3A1K A;  5B1M B;  2ZY5 A;  3REK C;  1P3K C;  4J8V B;  3VH5 T;  3AZG D;  1M18 C;  5B40 C;  1S32 B;  5AY8 A;  2JCH A;  4G91 C;  3WA9 A;  3LEL A;  3MGS D;  5B32 A;  3UT9 C;  5DNN D;  1P3P D;  3AV2 C;  2CV5 D;  3MGQ D;  5E5A C;  4JJN A;  1ID3 A;  2J8P A;  4KUD A;  5CHL B;  2NZD D;  3X1S A;  5B2J D;  4XZQ A;  3AYW D;  2IO5 C;  3W96 A;  4XUJ D;  5GT3 D;  4LD9 B;  4QLC B;  5B32 C;  4NE3 A;  5AVB C;  5B24 A;  1P3L C;  1U35 D;  5AV6 C;  4G92 C;  3WKJ C;  4HGA C;  1EQZ D;  3B0C W;  5AV5 C;  5CPK B;  2VQR A;  1HQ3 D;  3LZ0 D;  3W99 D;  1ID3 C;  3V9R B;  1P34 D;  5BO0 B;  3X1S C;  1P3M C;  1P3G B;  5B1L C;  4R8P B;  2RVQ D;  4DRA A;  3AZF B;  5B2I D;  3WAA D;  3REL D;  5B24 C;  1WWS A;  3REJ D;  3AZM D;  4WU8 D;  3EPH A;  5DNM B;  4H9N B;  5AVC A;  3AZH A;  1P3B A;  1ULY A;  5B1M D;  3KUY D;  4J8V D;  4LD9 C;  5B31 A;  3O62 C;  1P3I C;  3LZ1 C;  1TZY B;  3C1C C;  4WU9 A;  1P3A B;  2YFW A;  1KX5 C;  1AOI B;  5GSU A;  5B0Z A;  1HTA A;  3H0R C;  5B33 B;  5BNX B;  5G49 A;  3KWQ A;  1JFI A;  3A6N B;  4R8P C;  2FJ7 D;  5GXQ C;  4WU9 C;  4QLC D;  4J8U D;  4Z5T B;  5GSU C;  1Z2C B;  5B0Z C;  2ZM5 A;  1P3O A;  4Z66 B;  4J8W B;  3B6G B;  3REH A;  5CPK D;  3B0D B;  2BYM A;  1H3O B;  3C1B B;  1N1J A;  5F99 A;  4YM6 A;  5JRG C;  4ZUX A;  3MNN B;  2Y2H A;  2BYK B;  3NQJ A;  4X23 A;  5B0Y C;  3MGR A;  3AZF D;  1M19 B;  2JE5 A;  2PYO B;  1F66 A;  3X1T B;  3B0B A;  3AN2 A;  4H9R A;  3AZJ B;  1BH8 B;  1A7W A;  5DNM D;  3MVD A;  4WV4 B;  2Y2P A;  1P3F B;  3AFA B;  1P3O C;  3X1V C;  3AZN C;  3MGS A;  3AZI C;  3KXB B;  5DNN A;  1TZY D;  5BS7 C;  3TU4 A;  3AYW B;  5GT3 B;  5F99 C;  4YM6 C;  1P3A D;  1P3P A;  1M1A D;  3REI A;  1AOI D;  1BFM A;  4YS3 D;  4KGC B;  3MGQ A;  2HIO A;  1T3U A;  1ZLA B;  3VH5 W;  1WWI A;  3AV1 B;  4M6B A;  1TAF B;  2L5A A;  5GT0 D;  3UTA D;  2NZD A;  5B33 D;  1U35 B;  3REK A;  1P3K A;  5B2J A;  3WTP B;  1M18 A;  3AZG C;  3NQU A;  3W99 B;  3A6N D;  3MGP B;  3MGS C;  1P34 B;  3UT9 A;  5CPJ B;  5DNN C;  4Z2M G;  3TU4 C;  1P3P C;  2RIQ A;  2CV5 C;  4AWL B;  1EQZ A;  4J8X B;  3MGQ C;  2HIO C;  5C3I C;  4Z66 D;  4J8W D;  3REJ B;  2CWE A;  3B6G D;  2NZD C;  3C1B D;  3AZL D;  4NFT A;  3KUY B;  5JA4 A;  5B2J C;  3AYW C;  4XUJ C;  2Y2L A;  3MNN D;  3W98 D;  3WAA A;  5AVB A;  1M19 D;  1P3L A;  3LJA B;  3R45 B;  2F8N B;  4H9O A;  2PYO D;  5AV9 B;  2HUE C;  5B1M A;  3X1T D;  4CAY B;  5AV6 A;  4NE6 A;  3WKJ A;  3AZJ D;  1EQZ C;  5AV5 A;  1S32 A;  2F8N G;  5CP6 B;  5AY8 B;  1HQ3 C;  1KU5 A;  1P3F D;  3AFA D;  3WA9 B;  3LZ0 C;  3LEL B;  2ZY4 A;  1P34 C;  3KXB D;  3W97 D;  1P3M A;  5B1L A;  5B32 G;  2G5I C;  2RVQ C;  2FJ7 B;  4KGC D;  5B2I C;  1ZLA D;  3WAA C;  3AV1 D;  4JJN B;  4J8U B;  3REL C;  3B6F B;  3AZM C;  4WU8 C;  3VH5 A;  4KUD B;  3VH6 T;  5B1M C;  4WZS B;  4J8V C;  3WTP D;  3W96 B;  4LD9 A;  2YFV A;  5CPI D;  4H9Q A;  3O62 A;  1S32 C;  1P3I A;  2NQB B;  3LZ1 A;  3C1C A;  3UTB D;  1KX5 A;  4QLC A;  3MGP D;  3EPJ A;  5CPJ D;  3H0M C;  5B40 D;  4J8X D;  5FUG B;  3V9R A;  1F1E A;  5BO0 A;  3KFU G;  5AV8 D;  3AV2 D;  1P3G A;  4R8P A;  1PZR A;  5GXQ A;  1W2E A;  1M1A B;  4QLC C;  4YS3 B;  3LJA D;  2F8N D;  5AVC B;  5AV9 D;  2G5H C;  3AZH B;  1P3B B;  5GT0 B;  3UTA B;  5CPK C;  5CP6 D;  5AY8 D;  3WA9 D;  3LEL D;  3X1U B;  4UUZ A;  5B31 G;  5JRG A;  4WJ3 C;  1P3G C;  5B0Y A;  3AZF C;  5B33 A;  1KX4 B;  5BNX A;  3B6F D;  4JJN D;  5BT1 D;  1ID3 D;  2Y2O A;  3KWQ B;  5DNM C;  4KUD D;  1JFI B;  2JSS A;  4XZQ D;  4CSR B;  3X1V A;  3W96 D;  3AZN A;  3AZL B;  3AZI A;  2NQB D;  5BS7 A;  1TZY C;  3AZE B;  1P3A C;  1AOI C;  1KX3 B;  5B24 D;  2Y2M A;  4Z5T A;  3W98 B;  2ARO B;  5GT0 C;  3REH B;  5B33 C;  1H3O A;  2BYM B;  2XD5 A;  1Q9C A;  3AZG A;  3MNN A;  1BH9 A;  2BYK A;  3A6N C;  3NQJ B;  4X23 B;  3MGR B;  3W97 B;  2PYO A;  1F66 B;  2CV5 A;  3P5J B;  3AN2 B;  4H9R B;  4Z5T C;  3MVD B;  5AVC D;  3AZH D;  3A1I A;  1P3B D;  4EO5 B;  4Z66 C;  4J8W C;  3B6G C;  5B31 D;  3B0D C;  3C1B C;  2DF4 C;  3KXB A;  3AYW A;  4XUJ A;  5GT3 A;  3X1U D;  5CPI B;  3REI B;  5GSU D;  3MNN C;  1ZLA A;  4KHA A;  2DQN C;  3UTB B;  3AZK B;  1TAF A;  1M19 C;  2PYO C;  1KX4 D;  3X1T C;  1U35 A;  3REK B;  1P3K B;  3AZJ C;  1M18 B;  5B40 B;  1B6W A;  3KWQ D;  1HQ3 A;  4G91 B;  1P3F C;  3LZ0 A;  3AFA C;  3W99 A;  3F6T A;  5BNV B;  1P34 A;  3UT9 B;  4WNN B;  4UPK A;  5AV8 B;  3KXB C;  5KDM B;  3AZE D;  3W97 C;  5GT3 C;  3AV2 B;  1KX3 D;  3VH6 W;  5B2I A;  4KGC C;  1ZLA C;  2ARO D;  5E5A B;  2F8N K;  4H9P A;  3REL A;  3AV1 C;  1P3O D;  3REJ A;  4WU8 A;  3AZM A;  3REH D;  1U35 C;  3KUY A;  5JA4 B;  4J8V A;  2IO5 B;  3WTP C;  5F99 D;  4ZUX D;  4NE5 A;  2F2A C;  3W99 C;  5B32 B;  3MGP C;  4X23 D;  5CPJ C;  3MGR D;  1P3L B;  3R45 A;  4H9O B;  1F66 D;  4CAY A;  3KSY A;  5AV6 B;  4E44 A;  4AWL C;  4ZBJ B;  4HGA B;  4G92 B;  3EPK A;  3AN2 D;  3WKJ B;  5AV5 B;  4J8X C;  5CP6 A;  3MVD D;  2Y2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...