3WKJD

The nucleosome containing human tsh2b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjD00
4XUJA 5AV8B 3UT9A 3C1BA 3WTPB 5GT0D 4HGAB 4WZSB 3RELD 3NQJA 4AWLB 3UTAD 2F8ND 3C1CB 3AYWD 3TU4B 1H3OB 3AZKB 2PYOA 5FUGA 5BO0B 5GXQA 3AZHA 4YS3B 2CV5C 3X1TC 2AROD 1KX4A 2FJ7B 3AZMD 4Z66A 1P3MA 3W98C 1F66D 1ULYA 5DNMB 5B33B 3LELD 4J8UC 5AVBD 3MVDB 1M18C 1N1JB 5GT3B 4WU8A 3O62B 1P3PD 1HQ3D 3W99D 5B1LA 5CPIB 1ZLAC 1P3FC 4J8VA 1TAFB 3X1VC 3AZFA 3A6NA 5B2JA 5CP6D 1KX3D 4KGCA 5AVCB 5F99D 1JFIB 3REHC 3AZID 1S32B 3W96D 5B0YB 3V9RB 3LZ1A 4H9OB 4JJND 5JRGD 4NFTA 3W97A 3KUYD 4H9QB 3AZEC 5JA4B 4J8XD 1WWIA 1U35A 5AY8D 1ID3D 3VH5T 1P34B 3WA9B 3LZ0C 3KWQC 1P3KB 3MNND 2NZDD 3MGQB 5GT0C 5B24A 4H9NA 3RELC 4KUDD 3MGPD 3UTAC 3C1CD 1P3IA 5E5AD 3AYWC 4YS3D 3AZJD 3X1UC 3REJB 5BS7A 1KX5B 5B2IB 5B32B 4H9PB 3REKD 2FJ7D 1P3LA 2AROC 5DNMA 4X23B 3AZMC 1M1AA 4R8PC 4M6BA 5DNND 2HUEB 1P3OB 1F66C 3AV1D 1P3GD 3MVDA 5GT3A 3O62A 1M19B 1HTAA 3LJAA 1P3PC 4XZQB 1HQ3C 1TZYB 3W99C 5GSUB 3X1SA 5CPJD 4J8WB 5KDMB 2LY8A 3UTBC 5CP6C 4EO5B 4LD9B 3KXBB 4H9SC 1JFIA 3VH6T 3UT9B 5B1MD 3AFAA 1S32A 3C1BB 3NQJB 3W96C 3X1TD 5B0YD 2PYOB 3B6GA 5FUGB 5GXQB 3AZHB 3AV2A 3R45A 3REIB 3MGRA 5BNVA 5B0ZB 3W98D 5JRGC 1KX4B 1F1EA 4H9QA 3MGSA 3KUYC 2F8NK 4Z5TC 5B40A 3AZLB 4WU8B 4J8XC 5B1LB 1P34D 1ID3C 3WA9D 1P3KA 4QLCC 3AN2D 4J8VB 5B31C 4ZUXD 5AV8C 2NZDC 5AV9B 3AZGA 3AZFB 3A6NB 4AWLC 5B2JB 3MGPC 1P3BD 1WWSA 3C1CC 3TU4C 3AZKC 4KGCB 5E5AC 1EQZD 5B31G 4YS3C 3AZJC 5B2ID 1R4VA 2FJ7C 4G92B 2NQBD 4X23D 1P3OD 5DNNC 5AV6B 3LZ1B 5B33C 1ZLAA 4Z2MG 1M19D 1KU5A 1B6WA 5GSUD 5CPIC 2YFVA 5KDMA 5CPJC 5CPKB 2IO5B 1U35B 1Q9CA 4LD9D 3KXBD 4XUJD 5AVCC 2F8NH 5B1MC 5B24B 4H9NB 3X1UD 3REIA 1P3IB 5GXQD 5B0ZA 5B0YC 4R8PD 1KX4D 1P3LB 4Z66D 1P3MD 1M1AB 3VH5A 4H9RA 3AZLA 4WU9B 3AZNA 2RVQC 3LJAB 5B1LD 1P34C 3WA9C 3RELA 3AN2C 3X1SB 5AV9A 3UTBD 4ZUXC 2F8NA 4G91C 3AYWA 3A6ND 3MGQC 5B2JD 1P3BC 3B6FB 3NQUA 3AFAB 1EQZC 3WKJD 3REJC 1KX5C 5B2IC 5B32C 3LELA 2NQBC 1B67A 5AV6A 5AVBA 4YM6A 4X23C 3B6GB 1P3OC 3AV2B 1HQ3A 4KHAB 3R45B 3MGRB 5BNVB 1M19C 3W97D 5B32G 1TZYC 4Z5TD 3MGSB 5GSUC 3WAAB 5CPKA 5B40B 3VH6A 4J8WC 5AV5B 1KX3A 4QLCD 5B31D 3B0DB 5F99A 5AV8D 3B0CW 3AZIA 4EO5C 3WTPD 3KXBC 4LD9C 4XUJC 1P3AA 3AZGB 3TU4D 3AZKD 4JJNA 1P3ID 2PYOC 5GXQC 3AZHC 3KUYA 4J8UB 1KX4C 5DNMD 4Z66C 1P3MC 5B33D 4NE3A 1M18B 4J8XA 1M1AD 4WU9A 5AY8A 3MVDD 5GT3D 5C3IC 1ZLAB 3O62D 5BT1D 5CPID 3MNNA 4WU8C 5B1LC 4WNNB 3X1VB 2YFVB 4J8VC 4KUDA 2BYKB 5E5AA 3AZFC 3A6NC 3B6FA 5B2JC 4DRAA 3REHB 5AVCD 3REKA 4KGCC 3AFAD 1S32D 2HIOA 4E45A 3WKJC 3AV1A 1P3GA 4G92C 4KHAA 3AV2D 1AOIA 3LZ1C 3MGRD 4ZBJB 3W97C 3WAAA 2RVQD 4H9RB 5AV5A 3LZ0B 3KWQB 5B40D 3AZNB 2IO5C 1U35C 5B1MA 1P3KD 3RELB 3UTAB 3MGQD 2CV5A 3WTPC 2F8NB 1A7WA 4HGAC 3AZGD 3AYWB 3X1TA 5B24C 3W98A 2AROB 3REJD 1P3IC 1KX5D 4J8UA 5B32D 3NQUB 1M18A 3LELB 1BH9A 1P3LC 5AVBB 5DNMC 4YM6B 1M1AC 1P3FA 1HQ3B 3MVDC 5GT3C 3O62C 4XZQD 5BT1C 1TZYD 4WNNA 3X1VA 3LJAC 2BYKA 4J8WD 5BNXB 5CP6B 1KX3B 3REHA 5F99B 3UT9D 3AZIB 3C1BD 3W96B 3B0CT 2BYMB 1P3AB 3AFAC 1S32C 2PYOD 3AZHD 4JJNB 5JRGB 3REID 4NE6A 3B6GC 5B0ZD 3AZEA 3AV2C 3KUYB 3MGRC 4J8XB 3MGSC 5AY8B 3LZ0A 3KWQA 3AZLD 5G49B 4WU8D 5B40C 3MNNB 2NZDB 5GT0A 4J8VD 3B0DC 3UTAA 1P3KC 5AV9D 4KUDB 3MGPB 3AZFD 3X1UA 3AZGC 5E5AB 3AZJB 2AROA 4KGCD 3AZMA 4R8PA 3REKB 1F66A 2HIOB 2YFWB 5DNNB 3AV1B 1P3GB 1P3PA 5AV6D 2HUEC 4YM6D 3LZ1D 3W99A 2CWEA 1AOIB 4CAYA 4UUZA 4XZQC 3UTBA 5CPJB 5BNXA 5CP6A 5CPKD 1BH8A 1U35D 4H9SA 2L5AA 5B1MB 3WKJA 3W96A 2BYMA 3UT9C 3C1BC 2CV5B 1P3AD 4Z2MH 5B24D 3WTPE 3X1TB 5JRGA 3W98B 3REIC 5B0ZC 4Z5TA 1P3LD 1BH9B 4ZBJC 1ID3A 5G49A 4QLCA 4WU9D 1P3FB 1BFMA 5B31A 3AZLC 3LJAD 3B0BA 5AV8A 3AN2B 2NZDA 3AZNC 4ZUXB 3WTPA 4G91B 3X1SD 3MGPA 3C1CA 5AV9C 1H3OA 3TU4A 3AZKA 1P3BB 5BO0A 3AZJA 4YS3A 4DRBA 1EQZB 3B6FD 2FJ7A 2NQBB 2YFWA 5DNNA 2HIOD 5B33A 2F8NG 1N1JA 3LELC 3B6GD 4WV4B 5AVBC 5AV6C 4YM6C 5CPIA 1AOID 3AZEB 5CPJA 1TAFA 4CSRB 3MGSD 3WAAD 5AV5D 5CPKC 5AVCA 4XUJB 1KX3C 5GT0B 3KSYA 5F99C 5CHLB 3AZIC 2CV5D 5B0YA 3V9RA 3X1UB 4H9OA 1P3AC 4E44A 3AZMB 4R8PB 4JJNC 1F66B 1P3MB 4Z66B 4J8UD 5BS7C 1M18D 5C3IB 3VH5W 5JA4A 2JSSA 1P3PB 1P34A 1ZLAD 3WA9A 1P3FD 3W99B 3AN2A 5AY8C 4WU9C 4CAYB 4ZUXA 4UUZB 3X1VD 3MGQA 3UTBB 3MNNC 3X1SC 1P3BA 1BH8B 4KUDC 1EQZA 3REHD 3REJA 1KX5A 4NE5A 5B2IA 5B32A 4H9PA 3B6FC 3WKJB 2NQBA 4X23A 3REKC 1P3OA 2HIOC 1M19A 3AV1C 1P3GC 4XZQA 1TZYA 5GSUA 3W97B 3AZED 1AOIC 4Z5TB 4CSRA 4J8WA 1ID3B 3WAAC 4QLCB 3LZ0D 3KWQD 3VH6W 3AZND 5B31B 4LD9A 3KXBA 5AV5C
chains in the Genus database with same CATH superfamily
2UWXA 4XUJA 5AV8B 3UT9A 3C1BA 3WTPB 5GT0D 4HGAB 4WZSB 3RELD 3NQJA 4AWLB 3UTAD 2F8ND 3C1CB 3AYWD 3TU4B 1H3OB 3AZKB 2PYOA 5FUGA 5BO0B 5GXQA 3AZHA 4YS3B 2CV5C 3X1TC 2AROD 1KX4A 2FJ7B 3AZMD 4Z66A 1P3MA 3W98C 1F66D 1ULYA 5DNMB 5B33B 3LELD 4J8UC 2Y2PA 5AVBD 3MVDB 1M18C 1N1JB 5GT3B 4WU8A 3O62B 1P3PD 1HQ3D 3W99D 5B1LA 5CPIB 1ZLAC 1P3FC 4J8VA 1TAFB 3X1VC 3AZFA 3A6NA 5B2JA 5CP6D 1KX3D 4KGCA 5AVCB 5F99D 1JFIB 3REHC 3AZID 1S32B 3W96D 5B0YB 3V9RB 3LZ1A 4H9OB 4JJND 5JRGD 4NFTA 3W97A 2XD1A 3KUYD 4H9QB 3FDDA 3AZEC 5JA4B 4J8XD 1WWIA 1U35A 5AY8D 1ID3D 3VH5T 1P34B 3WA9B 3LZ0C 3KWQC 1P3KB 3MNND 2NZDD 3MGQB 5GT0C 5B24A 4H9NA 3RELC 4KUDD 3MGPD 3UTAC 3C1CD 1P3IA 1T3UA 5E5AD 3AYWC 4YS3D 3AZJD 3X1UC 3REJB 5BS7A 1KX5B 5B2IB 5B32B 4H9PB 3REKD 2FJ7D 1P3LA 2AROC 5DNMA 4X23B 3AZMC 1M1AA 4R8PC 4M6BA 5DNND 2HUEB 1P3OB 1F66C 3KFUG 3AV1D 1P3GD 3MVDA 5GT3A 3O62A 1M19B 1HTAA 2BG1A 3LJAA 1P3PC 4XZQB 1HQ3C 1TZYB 3W99C 5GSUB 3X1SA 5CPJD 4J8WB 5KDMB 2LY8A 3UTBC 5CP6C 4EO5B 4LD9B 3KXBB 4H9SC 1JFIA 3VH6T 3UT9B 5B1MD 3AFAA 1S32A 3C1BB 3NQJB 3W96C 3X1TD 5B0YD 2PYOB 3B6GA 5FUGB 5GXQB 3AZHB 3AV2A 3R45A 3REIB 3MGRA 5BNVA 5B0ZB 3W98D 5JRGC 1KX4B 1F1EA 4H9QA 3MGSA 3KUYC 2F8NK 3H0RC 4Z5TC 5B40A 3AZLB 2DF4C 4WU8B 4J8XC 5B1LB 1P34D 1ID3C 3WA9D 1P3KA 4QLCC 3AN2D 4J8VB 5B31C 4ZUXD 5AV8C 2NZDC 5AV9B 3AZGA 3AZFB 3A6NB 4AWLC 5B2JB 3MGPC 1P3BD 1WWSA 3C1CC 3EPLA 3TU4C 3AZKC 4KGCB 5E5AC 1EQZD 5B31G 4YS3C 3AZJC 5B2ID 1R4VA 2FJ7C 4G92B 2NQBD 4X23D 1P3OD 5DNNC 5AV6B 2Y2NA 3H0MC 3LZ1B 5B33C 4Z2MG 1ZLAA 1M19D 2JE5A 1KU5A 1B6WA 5GSUD 5CPIC 2YFVA 5KDMA 5CPJC 5CPKB 2IO5B 1U35B 1Q9CA 4LD9D 3KXBD 4XUJD 5AVCC 2F8NH 5B1MC 5B24B 4H9NB 2J8PA 3X1UD 3REIA 1P3IB 5GXQD 5B0ZA 5B0YC 4R8PD 1KX4D 1P3LB 4Z66D 1P3MD 1M1AB 3VH5A 4H9RA 3AZLA 4WU9B 3AZNA 2RVQC 3LJAB 5B1LD 1P34C 3WA9C 3RELA 3AN2C 3X1SB 3A1IA 5AV9A 2Y2HA 1Z2CB 4ZUXC 3UTBD 2F8NA 2JCHA 4G91C 3AYWA 3A6ND 3MGQC 5B2JD 1P3BC 3B6FB 2ZY3A 3NQUA 3AFAB 1EQZC 3WKJD 3REJC 1KX5C 5B2IC 5B32C 3LELA 2NQBC 1B67A 5AV6A 5AVBA 4YM6A 4X23C 3B6GB 1P3OC 3AV2B 1HQ3A 4KHAB 3R45B 3MGRB 5BNVB 1M19C 3W97D 5B32G 1TZYC 4Z5TD 3MGSB 5GSUC 3WAAB 5CPKA 5B40B 3VH6A 4J8WC 5AV5B 1KX3A 4QLCD 5B31D 3B0DB 3EPHA 5F99A 5AV8D 3B0CW 3AZIA 4EO5C 3WTPD 3KXBC 4LD9C 4XUJC 1P3AA 3AZGB 2FFFB 3TU4D 3AZKD 4JJNA 1P3ID 2Y2JA 2PYOC 5GXQC 3AZHC 3KUYA 4WJ3C 4J8UB 1KX4C 5DNMD 4Z66C 1P3MC 5B33D 2F2AC 4NE3A 4J8XA 1M18B 1M1AD 4WU9A 5AY8A 3MVDD 5GT3D 5C3IC 1ZLAB 3O62D 5BT1D 5CPID 3MNNA 4WU8C 5B1LC 4WNNB 3X1VB 2YFVB 4J8VC 2Y2KA 4KUDA 2BYKB 5E5AA 3AZFC 1PZRA 3A6NC 4UPKA 3B6FA 5B2JC 4DRAA 3REHB 5AVCD 3REKA 4KGCC 3AFAD 1S32D 2HIOA 4E45A 3WKJC 3AV1A 1P3GA 4G92C 2RIQA 4KHAA 3AV2D 1AOIA 3LZ1C 3MGRD 4ZBJB 3W97C 3WAAA 3IP4C 2RVQD 4H9RB 5AV5A 3LZ0B 3KWQB 2Y2LA 5B40D 3AZNB 2IO5C 1U35C 5B1MA 1P3KD 3RELB 2VQRA 3MGQD 3EPJA 3UTAB 2CV5A 3WTPC 2F8NB 1A7WA 4HGAC 3AZGD 2Y2MA 3AYWB 3X1TA 5B24C 3W98A 2AROB 3REJD 1P3IC 1KX5D 4J8UA 5B32D 3NQUB 1M18A 3LELB 1BH9A 1P3LC 5AVBB 5DNMC 4YM6B 1M1AC 3F6TA 1P3FA 1HQ3B 3MVDC 5GT3C 3O62C 4XZQD 5BT1C 1TZYD 4WNNA 3X1VA 3LJAC 2BYKA 3A1KA 4J8WD 2Y2OA 5BNXB 5CP6B 1KX3B 3REHA 5F99B 2ZM5A 3UT9D 3AZIB 3C1BD 3W96B 3B0CT 2BYMB 1P3AB 3AFAC 1S32C 2PYOD 3AZHD 4JJNB 5JRGB 3REID 4NE6A 3B6GC 5B0ZD 3AZEA 3AV2C 3KUYB 3MGRC 3P5JB 4J8XB 3MGSC 5AY8B 3LZ0A 3KWQA 3AZLD 5G49B 4WU8D 5B40C 3MNNB 2NZDB 5GT0A 4J8VD 3B0DC 3UTAA 3EG5B 1P3KC 5AV9D 4KUDB 3MGPB 3AZFD 4DQYB 3X1UA 3AZGC 5E5AB 3AZJB 2ZY2A 2AROA 4KGCD 2W8SA 3AZMA 2ZY4A 4R8PA 3REKB 1F66A 2HIOB 2YFWB 5DNNB 3AV1B 1P3GB 1P3PA 5AV6D 2HUEC 4YM6D 3LZ1D 3W99A 2CWEA 1AOIB 4CAYA 4UUZA 4XZQC 3UTBA 5CPJB 5BNXA 5CP6A 5CPKD 3H0LC 1BH8A 4H9SA 1U35D 2L5AA 5B1MB 3WKJA 3W96A 2BYMA 3UT9C 3C1BC 2CV5B 1P3AD 4Z2MH 5B24D 3WTPE 3X1TB 3AL0C 5JRGA 3W98B 3REIC 5B0ZC 4Z5TA 1P3LD 1BH9B 4ZBJC 1ID3A 5G49A 4QLCA 4WU9D 1P3FB 1BFMA 5B31A 3AZLC 3LJAD 3B0BA 5AV8A 3AN2B 2NZDA 3AZNC 4ZUXB 3WTPA 1W2EA 4G91B 3X1SD 3MGPA 3C1CA 5AV9C 1H3OA 3TU4A 3AZKA 1P3BB 5BO0A 3AZJA 4YS3A 4DRBA 1EQZB 3B6FD 2FJ7A 2G5HC 2Y2GA 2NQBB 2YFWA 5DNNA 2HIOD 5B33A 2F8NG 1N1JA 3LELC 3B6GD 2G5IC 2DQNC 4WV4B 5AVBC 5AV6C 4YM6C 5CPIA 1AOID 3AZEB 5CPJA 1TAFA 3EPKA 4CSRB 3MGSD 3WAAD 5AV5D 5CPKC 5AVCA 4XUJB 1KX3C 5GT0B 3KSYA 5F99C 5CHLB 3AZIC 2CV5D 5B0YA 3V9RA 3X1UB 4H9OA 1P3AC 2Y2IA 4E44A 3AZMB 2Y2QA 4R8PB 4JJNC 1F66B 1P3MB 4Z66B 4J8UD 5BS7C 1M18D 5C3IB 3VH5W 5JA4A 2JSSA 1P3PB 1P34A 1ZLAD 3WA9A 1P3FD 3W99B 3AN2A 5AY8C 4WU9C 4CAYB 4ZUXA 4UUZB 3X1VD 3MGQA 3UTBB 3MNNC 3X1SC 2XD5A 1P3BA 1BH8B 4KUDC 1EQZA 3REHD 3REJA 1KX5A 4NE5A 5B2IA 5B32A 4H9PA 2ZY5A 3B6FC 3WKJB 2NQBA 4X23A 3REKC 1P3OA 2HIOC 1M19A 3AV1C 1P3GC 4XZQA 1TZYA 5GSUA 3W97B 3AZED 1AOIC 4Z5TB 4CSRA 4J8WA 1ID3B 3WAAC 4QLCB 3LZ0D 3KWQD 3VH6W 3AZND 5B31B 4LD9A 3KXBA 5AV5C
chains in the Genus database with same CATH topology
2UWXA 4XUJA 5AV8B 3UT9A 3C1BA 3WTPB 5GT0D 4HGAB 4WZSB 3RELD 3NQJA 4AWLB 3UTAD 2F8ND 3C1CB 3AYWD 3TU4B 1H3OB 3AZKB 2PYOA 5FUGA 5BO0B 5GXQA 3AZHA 4YS3B 2CV5C 3X1TC 2AROD 1KX4A 2FJ7B 3AZMD 4Z66A 1P3MA 3W98C 1F66D 1ULYA 5DNMB 5B33B 3LELD 4J8UC 2Y2PA 5AVBD 3MVDB 1M18C 1N1JB 5GT3B 4WU8A 3O62B 1P3PD 1HQ3D 3W99D 5B1LA 5CPIB 1ZLAC 1P3FC 4J8VA 1TAFB 3X1VC 3AZFA 3A6NA 5B2JA 5CP6D 1KX3D 4KGCA 5AVCB 5F99D 1JFIB 3REHC 3AZID 1S32B 3W96D 5B0YB 3V9RB 3LZ1A 4H9OB 4JJND 5JRGD 4NFTA 3W97A 2XD1A 3KUYD 4H9QB 3FDDA 3AZEC 5JA4B 4J8XD 1WWIA 1U35A 5AY8D 1ID3D 3VH5T 1P34B 3WA9B 3LZ0C 3KWQC 1P3KB 3MNND 2NZDD 3MGQB 5GT0C 5B24A 4H9NA 3RELC 4KUDD 3MGPD 3UTAC 3C1CD 1P3IA 1T3UA 5E5AD 3AYWC 4YS3D 3AZJD 3X1UC 3REJB 5BS7A 1KX5B 5B2IB 5B32B 4H9PB 3REKD 2FJ7D 1P3LA 2AROC 5DNMA 4X23B 3AZMC 1M1AA 4R8PC 4M6BA 5DNND 2HUEB 1P3OB 1F66C 3KFUG 3AV1D 1P3GD 3MVDA 5GT3A 3O62A 1M19B 1HTAA 2BG1A 3LJAA 1P3PC 4XZQB 1HQ3C 1TZYB 3W99C 5GSUB 3X1SA 5CPJD 4J8WB 5KDMB 2LY8A 3UTBC 5CP6C 4EO5B 4LD9B 3KXBB 4H9SC 1JFIA 3VH6T 3UT9B 5B1MD 3AFAA 1S32A 3C1BB 3NQJB 3W96C 3X1TD 5B0YD 2PYOB 3B6GA 5FUGB 5GXQB 3AZHB 3AV2A 3R45A 3REIB 3MGRA 5BNVA 5B0ZB 3W98D 5JRGC 1KX4B 1F1EA 4H9QA 3MGSA 3KUYC 2F8NK 3H0RC 4Z5TC 5B40A 3AZLB 2DF4C 4WU8B 4J8XC 5B1LB 1P34D 1ID3C 3WA9D 1P3KA 4QLCC 3AN2D 4J8VB 5B31C 4ZUXD 5AV8C 2NZDC 5AV9B 3AZGA 3AZFB 3A6NB 4AWLC 5B2JB 3MGPC 1P3BD 1WWSA 3C1CC 3EPLA 3TU4C 3AZKC 4KGCB 5E5AC 1EQZD 5B31G 4YS3C 3AZJC 5B2ID 1R4VA 2FJ7C 4G92B 2NQBD 4X23D 1P3OD 5DNNC 5AV6B 2Y2NA 3H0MC 3LZ1B 5B33C 4Z2MG 1ZLAA 1M19D 2JE5A 1KU5A 1B6WA 5GSUD 5CPIC 2YFVA 5KDMA 5CPJC 5CPKB 2IO5B 1U35B 1Q9CA 4LD9D 3KXBD 4XUJD 5AVCC 2F8NH 5B1MC 5B24B 4H9NB 2J8PA 3X1UD 3REIA 1P3IB 5GXQD 5B0ZA 5B0YC 4R8PD 1KX4D 1P3LB 4Z66D 1P3MD 1M1AB 3VH5A 4H9RA 3AZLA 4WU9B 3AZNA 2RVQC 3LJAB 5B1LD 1P34C 3WA9C 3RELA 3AN2C 3X1SB 3A1IA 5AV9A 2Y2HA 1Z2CB 4ZUXC 3UTBD 2F8NA 2JCHA 4G91C 3AYWA 3A6ND 3MGQC 5B2JD 1P3BC 3B6FB 2ZY3A 3NQUA 3AFAB 1EQZC 3WKJD 3REJC 1KX5C 5B2IC 5B32C 3LELA 2NQBC 1B67A 5AV6A 5AVBA 4YM6A 4X23C 3B6GB 1P3OC 3AV2B 1HQ3A 4KHAB 3R45B 3MGRB 5BNVB 1M19C 3W97D 5B32G 1TZYC 4Z5TD 3MGSB 5GSUC 3WAAB 5CPKA 5B40B 3VH6A 4J8WC 5AV5B 1KX3A 4QLCD 5B31D 3B0DB 3EPHA 5F99A 5AV8D 3B0CW 3AZIA 4EO5C 3WTPD 3KXBC 4LD9C 4XUJC 1P3AA 3AZGB 2FFFB 3TU4D 3AZKD 4JJNA 1P3ID 2Y2JA 2PYOC 5GXQC 3AZHC 3KUYA 4WJ3C 4J8UB 1KX4C 5DNMD 4Z66C 1P3MC 5B33D 2F2AC 4NE3A 4J8XA 1M18B 1M1AD 4WU9A 5AY8A 3MVDD 5GT3D 5C3IC 1ZLAB 3O62D 5BT1D 5CPID 3MNNA 4WU8C 5B1LC 4WNNB 3X1VB 2YFVB 4J8VC 2Y2KA 4KUDA 2BYKB 5E5AA 3AZFC 1PZRA 3A6NC 4UPKA 3B6FA 5B2JC 4DRAA 3REHB 5AVCD 3REKA 4KGCC 3AFAD 1S32D 2HIOA 4E45A 3WKJC 3AV1A 1P3GA 4G92C 2RIQA 4KHAA 3AV2D 1AOIA 3LZ1C 3MGRD 4ZBJB 3W97C 3WAAA 3IP4C 2RVQD 4H9RB 5AV5A 3LZ0B 3KWQB 2Y2LA 5B40D 3AZNB 2IO5C 1U35C 5B1MA 1P3KD 3RELB 2VQRA 3MGQD 3EPJA 3UTAB 2CV5A 3WTPC 2F8NB 1A7WA 4HGAC 3AZGD 2Y2MA 3AYWB 3X1TA 5B24C 3W98A 2AROB 3REJD 1P3IC 1KX5D 4J8UA 5B32D 3NQUB 1M18A 3LELB 1BH9A 1P3LC 5AVBB 5DNMC 4YM6B 1M1AC 3F6TA 1P3FA 1HQ3B 3MVDC 5GT3C 3O62C 4XZQD 5BT1C 1TZYD 4WNNA 3X1VA 3LJAC 2BYKA 3A1KA 4J8WD 2Y2OA 5BNXB 5CP6B 1KX3B 3REHA 5F99B 2ZM5A 3UT9D 3AZIB 3C1BD 3W96B 3B0CT 2BYMB 1P3AB 3AFAC 1S32C 2PYOD 3AZHD 4JJNB 5JRGB 3REID 4NE6A 3B6GC 5B0ZD 3AZEA 3AV2C 3KUYB 3MGRC 3P5JB 4J8XB 3MGSC 5AY8B 3LZ0A 3KWQA 3AZLD 5G49B 4WU8D 5B40C 3MNNB 2NZDB 5GT0A 4J8VD 3B0DC 3UTAA 3EG5B 1P3KC 5AV9D 4KUDB 3MGPB 3AZFD 4DQYB 3X1UA 3AZGC 5E5AB 3AZJB 2ZY2A 2AROA 4KGCD 2W8SA 3AZMA 2ZY4A 4R8PA 3REKB 1F66A 2HIOB 2YFWB 5DNNB 3AV1B 1P3GB 1P3PA 5AV6D 2HUEC 4YM6D 3LZ1D 3W99A 2CWEA 1AOIB 4CAYA 4UUZA 4XZQC 3UTBA 5CPJB 5BNXA 5CP6A 5CPKD 3H0LC 1BH8A 4H9SA 1U35D 2L5AA 5B1MB 3WKJA 3W96A 2BYMA 3UT9C 3C1BC 2CV5B 1P3AD 4Z2MH 5B24D 3WTPE 3X1TB 3AL0C 5JRGA 3W98B 3REIC 5B0ZC 4Z5TA 1P3LD 1BH9B 4ZBJC 1ID3A 5G49A 4QLCA 4WU9D 1P3FB 1BFMA 5B31A 3AZLC 3LJAD 3B0BA 5AV8A 3AN2B 2NZDA 3AZNC 4ZUXB 3WTPA 1W2EA 4G91B 3X1SD 3MGPA 3C1CA 5AV9C 1H3OA 3TU4A 3AZKA 1P3BB 5BO0A 3AZJA 4YS3A 4DRBA 1EQZB 3B6FD 2FJ7A 2G5HC 2Y2GA 2NQBB 2YFWA 5DNNA 2HIOD 5B33A 2F8NG 1N1JA 3LELC 3B6GD 2G5IC 2DQNC 4WV4B 5AVBC 5AV6C 4YM6C 5CPIA 1AOID 3AZEB 5CPJA 1TAFA 3EPKA 4CSRB 3MGSD 3WAAD 5AV5D 5CPKC 5AVCA 4XUJB 1KX3C 5GT0B 3KSYA 5F99C 5CHLB 3AZIC 2CV5D 5B0YA 3V9RA 3X1UB 4H9OA 1P3AC 2Y2IA 4E44A 3AZMB 2Y2QA 4R8PB 4JJNC 1F66B 1P3MB 4Z66B 4J8UD 5BS7C 1M18D 5C3IB 3VH5W 5JA4A 2JSSA 1P3PB 1P34A 1ZLAD 3WA9A 1P3FD 3W99B 3AN2A 5AY8C 4WU9C 4CAYB 4ZUXA 4UUZB 3X1VD 3MGQA 3UTBB 3MNNC 3X1SC 2XD5A 1P3BA 1BH8B 4KUDC 1EQZA 3REHD 3REJA 1KX5A 4NE5A 5B2IA 5B32A 4H9PA 2ZY5A 3B6FC 3WKJB 2NQBA 4X23A 3REKC 1P3OA 2HIOC 1M19A 3AV1C 1P3GC 4XZQA 1TZYA 5GSUA 3W97B 3AZED 1AOIC 4Z5TB 4CSRA 4J8WA 1ID3B 3WAAC 4QLCB 3LZ0D 3KWQD 3VH6W 3AZND 5B31B 4LD9A 3KXBA 5AV5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ A;  5AV8 B;  3UT9 A;  3C1B A;  3WTP B;  5GT0 D;  4HGA B;  4WZS B;  3REL D;  3NQJ A;  4AWL B;  3UTA D;  2F8N D;  3C1C B;  3AYW D;  3TU4 B;  1H3O B;  3AZK B;  2PYO A;  5FUG A;  5BO0 B;  5GXQ A;  3AZH A;  4YS3 B;  2CV5 C;  3X1T C;  2ARO D;  1KX4 A;  2FJ7 B;  3AZM D;  4Z66 A;  1P3M A;  3W98 C;  1F66 D;  1ULY A;  5DNM B;  5B33 B;  3LEL D;  4J8U C;  5AVB D;  3MVD B;  1M18 C;  1N1J B;  5GT3 B;  4WU8 A;  3O62 B;  1P3P D;  1HQ3 D;  3W99 D;  5B1L A;  5CPI B;  1ZLA C;  1P3F C;  4J8V A;  1TAF B;  3X1V C;  3AZF A;  3A6N A;  5B2J A;  5CP6 D;  1KX3 D;  4KGC A;  5AVC B;  5F99 D;  1JFI B;  3REH C;  3AZI D;  1S32 B;  3W96 D;  5B0Y B;  3V9R B;  3LZ1 A;  4H9O B;  4JJN D;  5JRG D;  4NFT A;  3W97 A;  3KUY D;  4H9Q B;  3AZE C;  5JA4 B;  4J8X D;  1WWI A;  1U35 A;  5AY8 D;  1ID3 D;  3VH5 T;  1P34 B;  3WA9 B;  3LZ0 C;  3KWQ C;  1P3K B;  3MNN D;  2NZD D;  3MGQ B;  5GT0 C;  5B24 A;  4H9N A;  3REL C;  4KUD D;  3MGP D;  3UTA C;  3C1C D;  1P3I A;  5E5A D;  3AYW C;  4YS3 D;  3AZJ D;  3X1U C;  3REJ B;  5BS7 A;  1KX5 B;  5B2I B;  5B32 B;  4H9P B;  3REK D;  2FJ7 D;  1P3L A;  2ARO C;  5DNM A;  4X23 B;  3AZM C;  1M1A A;  4R8P C;  4M6B A;  5DNN D;  2HUE B;  1P3O B;  1F66 C;  3AV1 D;  1P3G D;  3MVD A;  5GT3 A;  3O62 A;  1M19 B;  1HTA A;  3LJA A;  1P3P C;  4XZQ B;  1HQ3 C;  1TZY B;  3W99 C;  5GSU B;  3X1S A;  5CPJ D;  4J8W B;  5KDM B;  2LY8 A;  3UTB C;  5CP6 C;  4EO5 B;  4LD9 B;  3KXB B;  4H9S C;  1JFI A;  3VH6 T;  3UT9 B;  5B1M D;  3AFA A;  1S32 A;  3C1B B;  3NQJ B;  3W96 C;  3X1T D;  5B0Y D;  2PYO B;  3B6G A;  5FUG B;  5GXQ B;  3AZH B;  3AV2 A;  3R45 A;  3REI B;  3MGR A;  5BNV A;  5B0Z B;  3W98 D;  5JRG C;  1KX4 B;  1F1E A;  4H9Q A;  3MGS A;  3KUY C;  2F8N K;  4Z5T C;  5B40 A;  3AZL B;  4WU8 B;  4J8X C;  5B1L B;  1P34 D;  1ID3 C;  3WA9 D;  1P3K A;  4QLC C;  3AN2 D;  4J8V B;  5B31 C;  4ZUX D;  5AV8 C;  2NZD C;  5AV9 B;  3AZG A;  3AZF B;  3A6N B;  4AWL C;  5B2J B;  3MGP C;  1P3B D;  1WWS A;  3C1C C;  3TU4 C;  3AZK C;  4KGC B;  5E5A C;  1EQZ D;  5B31 G;  4YS3 C;  3AZJ C;  5B2I D;  1R4V A;  2FJ7 C;  4G92 B;  2NQB D;  4X23 D;  1P3O D;  5DNN C;  5AV6 B;  3LZ1 B;  5B33 C;  1ZLA A;  4Z2M G;  1M19 D;  1KU5 A;  1B6W A;  5GSU D;  5CPI C;  2YFV A;  5KDM A;  5CPJ C;  5CPK B;  2IO5 B;  1U35 B;  1Q9C A;  4LD9 D;  3KXB D;  4XUJ D;  5AVC C;  2F8N H;  5B1M C;  5B24 B;  4H9N B;  3X1U D;  3REI A;  1P3I B;  5GXQ D;  5B0Z A;  5B0Y C;  4R8P D;  1KX4 D;  1P3L B;  4Z66 D;  1P3M D;  1M1A B;  3VH5 A;  4H9R A;  3AZL A;  4WU9 B;  3AZN A;  2RVQ C;  3LJA B;  5B1L D;  1P34 C;  3WA9 C;  3REL A;  3AN2 C;  3X1S B;  5AV9 A;  3UTB D;  4ZUX C;  2F8N A;  4G91 C;  3AYW A;  3A6N D;  3MGQ C;  5B2J D;  1P3B C;  3B6F B;  3NQU A;  3AFA B;  1EQZ C;  3WKJ D;  3REJ C;  1KX5 C;  5B2I C;  5B32 C;  3LEL A;  2NQB C;  1B67 A;  5AV6 A;  5AVB A;  4YM6 A;  4X23 C;  3B6G B;  1P3O C;  3AV2 B;  1HQ3 A;  4KHA B;  3R45 B;  3MGR B;  5BNV B;  1M19 C;  3W97 D;  5B32 G;  1TZY C;  4Z5T D;  3MGS B;  5GSU C;  3WAA B;  5CPK A;  5B40 B;  3VH6 A;  4J8W C;  5AV5 B;  1KX3 A;  4QLC D;  5B31 D;  3B0D B;  5F99 A;  5AV8 D;  3B0C W;  3AZI A;  4EO5 C;  3WTP D;  3KXB C;  4LD9 C;  4XUJ C;  1P3A A;  3AZG B;  3TU4 D;  3AZK D;  4JJN A;  1P3I D;  2PYO C;  5GXQ C;  3AZH C;  3KUY A;  4J8U B;  1KX4 C;  5DNM D;  4Z66 C;  1P3M C;  5B33 D;  4NE3 A;  1M18 B;  4J8X A;  1M1A D;  4WU9 A;  5AY8 A;  3MVD D;  5GT3 D;  5C3I C;  1ZLA B;  3O62 D;  5BT1 D;  5CPI D;  3MNN A;  4WU8 C;  5B1L C;  4WNN B;  3X1V B;  2YFV B;  4J8V C;  4KUD A;  2BYK B;  5E5A A;  3AZF C;  3A6N C;  3B6F A;  5B2J C;  4DRA A;  3REH B;  5AVC D;  3REK A;  4KGC C;  3AFA D;  1S32 D;  2HIO A;  4E45 A;  3WKJ C;  3AV1 A;  1P3G A;  4G92 C;  4KHA A;  3AV2 D;  1AOI A;  3LZ1 C;  3MGR D;  4ZBJ B;  3W97 C;  3WAA A;  2RVQ D;  4H9R B;  5AV5 A;  3LZ0 B;  3KWQ B;  5B40 D;  3AZN B;  2IO5 C;  1U35 C;  5B1M A;  1P3K D;  3REL B;  3UTA B;  3MGQ D;  2CV5 A;  3WTP C;  2F8N B;  1A7W A;  4HGA C;  3AZG D;  3AYW B;  3X1T A;  5B24 C;  3W98 A;  2ARO B;  3REJ D;  1P3I C;  1KX5 D;  4J8U A;  5B32 D;  3NQU B;  1M18 A;  3LEL B;  1BH9 A;  1P3L C;  5AVB B;  5DNM C;  4YM6 B;  1M1A C;  1P3F A;  1HQ3 B;  3MVD C;  5GT3 C;  3O62 C;  4XZQ D;  5BT1 C;  1TZY D;  4WNN A;  3X1V A;  3LJA C;  2BYK A;  4J8W D;  5BNX B;  5CP6 B;  1KX3 B;  3REH A;  5F99 B;  3UT9 D;  3AZI B;  3C1B D;  3W96 B;  3B0C T;  2BYM B;  1P3A B;  3AFA C;  1S32 C;  2PYO D;  3AZH D;  4JJN B;  5JRG B;  3REI D;  4NE6 A;  3B6G C;  5B0Z D;  3AZE A;  3AV2 C;  3KUY B;  3MGR C;  4J8X B;  3MGS C;  5AY8 B;  3LZ0 A;  3KWQ A;  3AZL D;  5G49 B;  4WU8 D;  5B40 C;  3MNN B;  2NZD B;  5GT0 A;  4J8V D;  3B0D C;  3UTA A;  1P3K C;  5AV9 D;  4KUD B;  3MGP B;  3AZF D;  3X1U A;  3AZG C;  5E5A B;  3AZJ B;  2ARO A;  4KGC D;  3AZM A;  4R8P A;  3REK B;  1F66 A;  2HIO B;  2YFW B;  5DNN B;  3AV1 B;  1P3G B;  1P3P A;  5AV6 D;  2HUE C;  4YM6 D;  3LZ1 D;  3W99 A;  2CWE A;  1AOI B;  4CAY A;  4UUZ A;  4XZQ C;  3UTB A;  5CPJ B;  5BNX A;  5CP6 A;  5CPK D;  1BH8 A;  1U35 D;  4H9S A;  2L5A A;  5B1M B;  3WKJ A;  3W96 A;  2BYM A;  3UT9 C;  3C1B C;  2CV5 B;  1P3A D;  4Z2M H;  5B24 D;  3WTP E;  3X1T B;  5JRG A;  3W98 B;  3REI C;  5B0Z C;  4Z5T A;  1P3L D;  1BH9 B;  4ZBJ C;  1ID3 A;  5G49 A;  4QLC A;  4WU9 D;  1P3F B;  1BFM A;  5B31 A;  3AZL C;  3LJA D;  3B0B A;  5AV8 A;  3AN2 B;  2NZD A;  3AZN C;  4ZUX B;  3WTP A;  4G91 B;  3X1S D;  3MGP A;  3C1C A;  5AV9 C;  1H3O A;  3TU4 A;  3AZK A;  1P3B B;  5BO0 A;  3AZJ A;  4YS3 A;  4DRB A;  1EQZ B;  3B6F D;  2FJ7 A;  2NQB B;  2YFW A;  5DNN A;  2HIO D;  5B33 A;  2F8N G;  1N1J A;  3LEL C;  3B6G D;  4WV4 B;  5AVB C;  5AV6 C;  4YM6 C;  5CPI A;  1AOI D;  3AZE B;  5CPJ A;  1TAF A;  4CSR B;  3MGS D;  3WAA D;  5AV5 D;  5CPK C;  5AVC A;  4XUJ B;  1KX3 C;  5GT0 B;  3KSY A;  5F99 C;  5CHL B;  3AZI C;  2CV5 D;  5B0Y A;  3V9R A;  3X1U B;  4H9O A;  1P3A C;  4E44 A;  3AZM B;  4R8P B;  4JJN C;  1F66 B;  1P3M B;  4Z66 B;  4J8U D;  5BS7 C;  1M18 D;  5C3I B;  3VH5 W;  5JA4 A;  2JSS A;  1P3P B;  1P34 A;  1ZLA D;  3WA9 A;  1P3F D;  3W99 B;  3AN2 A;  5AY8 C;  4WU9 C;  4CAY B;  4ZUX A;  4UUZ B;  3X1V D;  3MGQ A;  3UTB B;  3MNN C;  3X1S C;  1P3B A;  1BH8 B;  4KUD C;  1EQZ A;  3REH D;  3REJ A;  1KX5 A;  4NE5 A;  5B2I A;  5B32 A;  4H9P A;  3B6F C;  3WKJ B;  2NQB A;  4X23 A;  3REK C;  1P3O A;  2HIO C;  1M19 A;  3AV1 C;  1P3G C;  4XZQ A;  1TZY A;  5GSU A;  3W97 B;  3AZE D;  1AOI C;  4Z5T B;  4CSR A;  4J8W A;  1ID3 B;  3WAA C;  4QLC B;  3LZ0 D;  3KWQ D;  3VH6 W;  3AZN D;  5B31 B;  4LD9 A;  3KXB A;  5AV5 C; 
#chains in the Genus database with same CATH topology
 2UWX A;  4XUJ A;  5AV8 B;  3UT9 A;  3C1B A;  3WTP B;  5GT0 D;  4HGA B;  4WZS B;  3REL D;  3NQJ A;  4AWL B;  3UTA D;  2F8N D;  3C1C B;  3AYW D;  3TU4 B;  1H3O B;  3AZK B;  2PYO A;  5FUG A;  5BO0 B;  5GXQ A;  3AZH A;  4YS3 B;  2CV5 C;  3X1T C;  2ARO D;  1KX4 A;  2FJ7 B;  3AZM D;  4Z66 A;  1P3M A;  3W98 C;  1F66 D;  1ULY A;  5DNM B;  5B33 B;  3LEL D;  4J8U C;  2Y2P A;  5AVB D;  3MVD B;  1M18 C;  1N1J B;  5GT3 B;  4WU8 A;  3O62 B;  1P3P D;  1HQ3 D;  3W99 D;  5B1L A;  5CPI B;  1ZLA C;  1P3F C;  4J8V A;  1TAF B;  3X1V C;  3AZF A;  3A6N A;  5B2J A;  5CP6 D;  1KX3 D;  4KGC A;  5AVC B;  5F99 D;  1JFI B;  3REH C;  3AZI D;  1S32 B;  3W96 D;  5B0Y B;  3V9R B;  3LZ1 A;  4H9O B;  4JJN D;  5JRG D;  4NFT A;  3W97 A;  2XD1 A;  3KUY D;  4H9Q B;  3FDD A;  3AZE C;  5JA4 B;  4J8X D;  1WWI A;  1U35 A;  5AY8 D;  1ID3 D;  3VH5 T;  1P34 B;  3WA9 B;  3LZ0 C;  3KWQ C;  1P3K B;  3MNN D;  2NZD D;  3MGQ B;  5GT0 C;  5B24 A;  4H9N A;  3REL C;  4KUD D;  3MGP D;  3UTA C;  3C1C D;  1P3I A;  1T3U A;  5E5A D;  3AYW C;  4YS3 D;  3AZJ D;  3X1U C;  3REJ B;  5BS7 A;  1KX5 B;  5B2I B;  5B32 B;  4H9P B;  3REK D;  2FJ7 D;  1P3L A;  2ARO C;  5DNM A;  4X23 B;  3AZM C;  1M1A A;  4R8P C;  4M6B A;  5DNN D;  2HUE B;  1P3O B;  1F66 C;  3KFU G;  3AV1 D;  1P3G D;  3MVD A;  5GT3 A;  3O62 A;  1M19 B;  1HTA A;  2BG1 A;  3LJA A;  1P3P C;  4XZQ B;  1HQ3 C;  1TZY B;  3W99 C;  5GSU B;  3X1S A;  5CPJ D;  4J8W B;  5KDM B;  2LY8 A;  3UTB C;  5CP6 C;  4EO5 B;  4LD9 B;  3KXB B;  4H9S C;  1JFI A;  3VH6 T;  3UT9 B;  5B1M D;  3AFA A;  1S32 A;  3C1B B;  3NQJ B;  3W96 C;  3X1T D;  5B0Y D;  2PYO B;  3B6G A;  5FUG B;  5GXQ B;  3AZH B;  3AV2 A;  3R45 A;  3REI B;  3MGR A;  5BNV A;  5B0Z B;  3W98 D;  5JRG C;  1KX4 B;  1F1E A;  4H9Q A;  3MGS A;  3KUY C;  2F8N K;  3H0R C;  4Z5T C;  5B40 A;  3AZL B;  2DF4 C;  4WU8 B;  4J8X C;  5B1L B;  1P34 D;  1ID3 C;  3WA9 D;  1P3K A;  4QLC C;  3AN2 D;  4J8V B;  5B31 C;  4ZUX D;  5AV8 C;  2NZD C;  5AV9 B;  3AZG A;  3AZF B;  3A6N B;  4AWL C;  5B2J B;  3MGP C;  1P3B D;  1WWS A;  3C1C C;  3EPL A;  3TU4 C;  3AZK C;  4KGC B;  5E5A C;  1EQZ D;  5B31 G;  4YS3 C;  3AZJ C;  5B2I D;  1R4V A;  2FJ7 C;  4G92 B;  2NQB D;  4X23 D;  1P3O D;  5DNN C;  5AV6 B;  2Y2N A;  3H0M C;  3LZ1 B;  5B33 C;  4Z2M G;  1ZLA A;  1M19 D;  2JE5 A;  1KU5 A;  1B6W A;  5GSU D;  5CPI C;  2YFV A;  5KDM A;  5CPJ C;  5CPK B;  2IO5 B;  1U35 B;  1Q9C A;  4LD9 D;  3KXB D;  4XUJ D;  5AVC C;  2F8N H;  5B1M C;  5B24 B;  4H9N B;  2J8P A;  3X1U D;  3REI A;  1P3I B;  5GXQ D;  5B0Z A;  5B0Y C;  4R8P D;  1KX4 D;  1P3L B;  4Z66 D;  1P3M D;  1M1A B;  3VH5 A;  4H9R A;  3AZL A;  4WU9 B;  3AZN A;  2RVQ C;  3LJA B;  5B1L D;  1P34 C;  3WA9 C;  3REL A;  3AN2 C;  3X1S B;  3A1I A;  5AV9 A;  2Y2H A;  1Z2C B;  4ZUX C;  3UTB D;  2F8N A;  2JCH A;  4G91 C;  3AYW A;  3A6N D;  3MGQ C;  5B2J D;  1P3B C;  3B6F B;  2ZY3 A;  3NQU A;  3AFA B;  1EQZ C;  3WKJ D;  3REJ C;  1KX5 C;  5B2I C;  5B32 C;  3LEL A;  2NQB C;  1B67 A;  5AV6 A;  5AVB A;  4YM6 A;  4X23 C;  3B6G B;  1P3O C;  3AV2 B;  1HQ3 A;  4KHA B;  3R45 B;  3MGR B;  5BNV B;  1M19 C;  3W97 D;  5B32 G;  1TZY C;  4Z5T D;  3MGS B;  5GSU C;  3WAA B;  5CPK A;  5B40 B;  3VH6 A;  4J8W C;  5AV5 B;  1KX3 A;  4QLC D;  5B31 D;  3B0D B;  3EPH A;  5F99 A;  5AV8 D;  3B0C W;  3AZI A;  4EO5 C;  3WTP D;  3KXB C;  4LD9 C;  4XUJ C;  1P3A A;  3AZG B;  2FFF B;  3TU4 D;  3AZK D;  4JJN A;  1P3I D;  2Y2J A;  2PYO C;  5GXQ C;  3AZH C;  3KUY A;  4WJ3 C;  4J8U B;  1KX4 C;  5DNM D;  4Z66 C;  1P3M C;  5B33 D;  2F2A C;  4NE3 A;  4J8X A;  1M18 B;  1M1A D;  4WU9 A;  5AY8 A;  3MVD D;  5GT3 D;  5C3I C;  1ZLA B;  3O62 D;  5BT1 D;  5CPI D;  3MNN A;  4WU8 C;  5B1L C;  4WNN B;  3X1V B;  2YFV B;  4J8V C;  2Y2K A;  4KUD A;  2BYK B;  5E5A A;  3AZF C;  1PZR A;  3A6N C;  4UPK A;  3B6F A;  5B2J C;  4DRA A;  3REH B;  5AVC D;  3REK A;  4KGC C;  3AFA D;  1S32 D;  2HIO A;  4E45 A;  3WKJ C;  3AV1 A;  1P3G A;  4G92 C;  2RIQ A;  4KHA A;  3AV2 D;  1AOI A;  3LZ1 C;  3MGR D;  4ZBJ B;  3W97 C;  3WAA A;  3IP4 C;  2RVQ D;  4H9R B;  5AV5 A;  3LZ0 B;  3KWQ B;  2Y2L A;  5B40 D;  3AZN B;  2IO5 C;  1U35 C;  5B1M A;  1P3K D;  3REL B;  2VQR A;  3MGQ D;  3EPJ A;  3UTA B;  2CV5 A;  3WTP C;  2F8N B;  1A7W A;  4HGA C;  3AZG D;  2Y2M A;  3AYW B;  3X1T A;  5B24 C;  3W98 A;  2ARO B;  3REJ D;  1P3I C;  1KX5 D;  4J8U A;  5B32 D;  3NQU B;  1M18 A;  3LEL B;  1BH9 A;  1P3L C;  5AVB B;  5DNM C;  4YM6 B;  1M1A C;  3F6T A;  1P3F A;  1HQ3 B;  3MVD C;  5GT3 C;  3O62 C;  4XZQ D;  5BT1 C;  1TZY D;  4WNN A;  3X1V A;  3LJA C;  2BYK A;  3A1K A;  4J8W D;  2Y2O A;  5BNX B;  5CP6 B;  1KX3 B;  3REH A;  5F99 B;  2ZM5 A;  3UT9 D;  3AZI B;  3C1B D;  3W96 B;  3B0C T;  2BYM B;  1P3A B;  3AFA C;  1S32 C;  2PYO D;  3AZH D;  4JJN B;  5JRG B;  3REI D;  4NE6 A;  3B6G C;  5B0Z D;  3AZE A;  3AV2 C;  3KUY B;  3MGR C;  3P5J B;  4J8X B;  3MGS C;  5AY8 B;  3LZ0 A;  3KWQ A;  3AZL D;  5G49 B;  4WU8 D;  5B40 C;  3MNN B;  2NZD B;  5GT0 A;  4J8V D;  3B0D C;  3UTA A;  3EG5 B;  1P3K C;  5AV9 D;  4KUD B;  3MGP B;  3AZF D;  4DQY B;  3X1U A;  3AZG C;  5E5A B;  3AZJ B;  2ZY2 A;  2ARO A;  4KGC D;  2W8S A;  3AZM A;  2ZY4 A;  4R8P A;  3REK B;  1F66 A;  2HIO B;  2YFW B;  5DNN B;  3AV1 B;  1P3G B;  1P3P A;  5AV6 D;  2HUE C;  4YM6 D;  3LZ1 D;  3W99 A;  2CWE A;  1AOI B;  4CAY A;  4UUZ A;  4XZQ C;  3UTB A;  5CPJ B;  5BNX A;  5CP6 A;  5CPK D;  3H0L C;  1BH8 A;  4H9S A;  1U35 D;  2L5A A;  5B1M B;  3WKJ A;  3W96 A;  2BYM A;  3UT9 C;  3C1B C;  2CV5 B;  1P3A D;  4Z2M H;  5B24 D;  3WTP E;  3X1T B;  3AL0 C;  5JRG A;  3W98 B;  3REI C;  5B0Z C;  4Z5T A;  1P3L D;  1BH9 B;  4ZBJ C;  1ID3 A;  5G49 A;  4QLC A;  4WU9 D;  1P3F B;  1BFM A;  5B31 A;  3AZL C;  3LJA D;  3B0B A;  5AV8 A;  3AN2 B;  2NZD A;  3AZN C;  4ZUX B;  3WTP A;  1W2E A;  4G91 B;  3X1S D;  3MGP A;  3C1C A;  5AV9 C;  1H3O A;  3TU4 A;  3AZK A;  1P3B B;  5BO0 A;  3AZJ A;  4YS3 A;  4DRB A;  1EQZ B;  3B6F D;  2FJ7 A;  2G5H C;  2Y2G A;  2NQB B;  2YFW A;  5DNN A;  2HIO D;  5B33 A;  2F8N G;  1N1J A;  3LEL C;  3B6G D;  2G5I C;  2DQN C;  4WV4 B;  5AVB C;  5AV6 C;  4YM6 C;  5CPI A;  1AOI D;  3AZE B;  5CPJ A;  1TAF A;  3EPK A;  4CSR B;  3MGS D;  3WAA D;  5AV5 D;  5CPK C;  5AVC A;  4XUJ B;  1KX3 C;  5GT0 B;  3KSY A;  5F99 C;  5CHL B;  3AZI C;  2CV5 D;  5B0Y A;  3V9R A;  3X1U B;  4H9O A;  1P3A C;  2Y2I A;  4E44 A;  3AZM B;  2Y2Q A;  4R8P B;  4JJN C;  1F66 B;  1P3M B;  4Z66 B;  4J8U D;  5BS7 C;  1M18 D;  5C3I B;  3VH5 W;  5JA4 A;  2JSS A;  1P3P B;  1P34 A;  1ZLA D;  3WA9 A;  1P3F D;  3W99 B;  3AN2 A;  5AY8 C;  4WU9 C;  4CAY B;  4ZUX A;  4UUZ B;  3X1V D;  3MGQ A;  3UTB B;  3MNN C;  3X1S C;  2XD5 A;  1P3B A;  1BH8 B;  4KUD C;  1EQZ A;  3REH D;  3REJ A;  1KX5 A;  4NE5 A;  5B2I A;  5B32 A;  4H9P A;  2ZY5 A;  3B6F C;  3WKJ B;  2NQB A;  4X23 A;  3REK C;  1P3O A;  2HIO C;  1M19 A;  3AV1 C;  1P3G C;  4XZQ A;  1TZY A;  5GSU A;  3W97 B;  3AZE D;  1AOI C;  4Z5T B;  4CSR A;  4J8W A;  1ID3 B;  3WAA C;  4QLC B;  3LZ0 D;  3KWQ D;  3VH6 W;  3AZN D;  5B31 B;  4LD9 A;  3KXB A;  5AV5 C; 
#chains in the Genus database with same CATH homology
 2UWX A;  4XUJ A;  5AV8 B;  3UT9 A;  3C1B A;  3WTP B;  5GT0 D;  4HGA B;  4WZS B;  3REL D;  3NQJ A;  4AWL B;  3UTA D;  2F8N D;  3C1C B;  3AYW D;  3TU4 B;  1H3O B;  3AZK B;  2PYO A;  5FUG A;  5BO0 B;  5GXQ A;  3AZH A;  4YS3 B;  2CV5 C;  3X1T C;  2ARO D;  1KX4 A;  2FJ7 B;  3AZM D;  4Z66 A;  1P3M A;  3W98 C;  1F66 D;  1ULY A;  5DNM B;  5B33 B;  3LEL D;  4J8U C;  2Y2P A;  5AVB D;  3MVD B;  1M18 C;  1N1J B;  5GT3 B;  4WU8 A;  3O62 B;  1P3P D;  1HQ3 D;  3W99 D;  5B1L A;  5CPI B;  1ZLA C;  1P3F C;  4J8V A;  1TAF B;  3X1V C;  3AZF A;  3A6N A;  5B2J A;  5CP6 D;  1KX3 D;  4KGC A;  5AVC B;  5F99 D;  1JFI B;  3REH C;  3AZI D;  1S32 B;  3W96 D;  5B0Y B;  3V9R B;  3LZ1 A;  4H9O B;  4JJN D;  5JRG D;  4NFT A;  3W97 A;  2XD1 A;  3KUY D;  4H9Q B;  3FDD A;  3AZE C;  5JA4 B;  4J8X D;  1WWI A;  1U35 A;  5AY8 D;  1ID3 D;  3VH5 T;  1P34 B;  3WA9 B;  3LZ0 C;  3KWQ C;  1P3K B;  3MNN D;  2NZD D;  3MGQ B;  5GT0 C;  5B24 A;  4H9N A;  3REL C;  4KUD D;  3MGP D;  3UTA C;  3C1C D;  1P3I A;  1T3U A;  5E5A D;  3AYW C;  4YS3 D;  3AZJ D;  3X1U C;  3REJ B;  5BS7 A;  1KX5 B;  5B2I B;  5B32 B;  4H9P B;  3REK D;  2FJ7 D;  1P3L A;  2ARO C;  5DNM A;  4X23 B;  3AZM C;  1M1A A;  4R8P C;  4M6B A;  5DNN D;  2HUE B;  1P3O B;  1F66 C;  3KFU G;  3AV1 D;  1P3G D;  3MVD A;  5GT3 A;  3O62 A;  1M19 B;  1HTA A;  2BG1 A;  3LJA A;  1P3P C;  4XZQ B;  1HQ3 C;  1TZY B;  3W99 C;  5GSU B;  3X1S A;  5CPJ D;  4J8W B;  5KDM B;  2LY8 A;  3UTB C;  5CP6 C;  4EO5 B;  4LD9 B;  3KXB B;  4H9S C;  1JFI A;  3VH6 T;  3UT9 B;  5B1M D;  3AFA A;  1S32 A;  3C1B B;  3NQJ B;  3W96 C;  3X1T D;  5B0Y D;  2PYO B;  3B6G A;  5FUG B;  5GXQ B;  3AZH B;  3AV2 A;  3R45 A;  3REI B;  3MGR A;  5BNV A;  5B0Z B;  3W98 D;  5JRG C;  1KX4 B;  1F1E A;  4H9Q A;  3MGS A;  3KUY C;  2F8N K;  3H0R C;  4Z5T C;  5B40 A;  3AZL B;  2DF4 C;  4WU8 B;  4J8X C;  5B1L B;  1P34 D;  1ID3 C;  3WA9 D;  1P3K A;  4QLC C;  3AN2 D;  4J8V B;  5B31 C;  4ZUX D;  5AV8 C;  2NZD C;  5AV9 B;  3AZG A;  3AZF B;  3A6N B;  4AWL C;  5B2J B;  3MGP C;  1P3B D;  1WWS A;  3C1C C;  3EPL A;  3TU4 C;  3AZK C;  4KGC B;  5E5A C;  1EQZ D;  5B31 G;  4YS3 C;  3AZJ C;  5B2I D;  1R4V A;  2FJ7 C;  4G92 B;  2NQB D;  4X23 D;  1P3O D;  5DNN C;  5AV6 B;  2Y2N A;  3H0M C;  3LZ1 B;  5B33 C;  4Z2M G;  1ZLA A;  1M19 D;  2JE5 A;  1KU5 A;  1B6W A;  5GSU D;  5CPI C;  2YFV A;  5KDM A;  5CPJ C;  5CPK B;  2IO5 B;  1U35 B;  1Q9C A;  4LD9 D;  3KXB D;  4XUJ D;  5AVC C;  2F8N H;  5B1M C;  5B24 B;  4H9N B;  2J8P A;  3X1U D;  3REI A;  1P3I B;  5GXQ D;  5B0Z A;  5B0Y C;  4R8P D;  1KX4 D;  1P3L B;  4Z66 D;  1P3M D;  1M1A B;  3VH5 A;  4H9R A;  3AZL A;  4WU9 B;  3AZN A;  2RVQ C;  3LJA B;  5B1L D;  1P34 C;  3WA9 C;  3REL A;  3AN2 C;  3X1S B;  3A1I A;  5AV9 A;  2Y2H A;  1Z2C B;  4ZUX C;  3UTB D;  2F8N A;  2JCH A;  4G91 C;  3AYW A;  3A6N D;  3MGQ C;  5B2J D;  1P3B C;  3B6F B;  2ZY3 A;  3NQU A;  3AFA B;  1EQZ C;  3WKJ D;  3REJ C;  1KX5 C;  5B2I C;  5B32 C;  3LEL A;  2NQB C;  1B67 A;  5AV6 A;  5AVB A;  4YM6 A;  4X23 C;  3B6G B;  1P3O C;  3AV2 B;  1HQ3 A;  4KHA B;  3R45 B;  3MGR B;  5BNV B;  1M19 C;  3W97 D;  5B32 G;  1TZY C;  4Z5T D;  3MGS B;  5GSU C;  3WAA B;  5CPK A;  5B40 B;  3VH6 A;  4J8W C;  5AV5 B;  1KX3 A;  4QLC D;  5B31 D;  3B0D B;  3EPH A;  5F99 A;  5AV8 D;  3B0C W;  3AZI A;  4EO5 C;  3WTP D;  3KXB C;  4LD9 C;  4XUJ C;  1P3A A;  3AZG B;  2FFF B;  3TU4 D;  3AZK D;  4JJN A;  1P3I D;  2Y2J A;  2PYO C;  5GXQ C;  3AZH C;  3KUY A;  4WJ3 C;  4J8U B;  1KX4 C;  5DNM D;  4Z66 C;  1P3M C;  5B33 D;  2F2A C;  4NE3 A;  4J8X A;  1M18 B;  1M1A D;  4WU9 A;  5AY8 A;  3MVD D;  5GT3 D;  5C3I C;  1ZLA B;  3O62 D;  5BT1 D;  5CPI D;  3MNN A;  4WU8 C;  5B1L C;  4WNN B;  3X1V B;  2YFV B;  4J8V C;  2Y2K A;  4KUD A;  2BYK B;  5E5A A;  3AZF C;  1PZR A;  3A6N C;  4UPK A;  3B6F A;  5B2J C;  4DRA A;  3REH B;  5AVC D;  3REK A;  4KGC C;  3AFA D;  1S32 D;  2HIO A;  4E45 A;  3WKJ C;  3AV1 A;  1P3G A;  4G92 C;  2RIQ A;  4KHA A;  3AV2 D;  1AOI A;  3LZ1 C;  3MGR D;  4ZBJ B;  3W97 C;  3WAA A;  3IP4 C;  2RVQ D;  4H9R B;  5AV5 A;  3LZ0 B;  3KWQ B;  2Y2L A;  5B40 D;  3AZN B;  2IO5 C;  1U35 C;  5B1M A;  1P3K D;  3REL B;  2VQR A;  3MGQ D;  3EPJ A;  3UTA B;  2CV5 A;  3WTP C;  2F8N B;  1A7W A;  4HGA C;  3AZG D;  2Y2M A;  3AYW B;  3X1T A;  5B24 C;  3W98 A;  2ARO B;  3REJ D;  1P3I C;  1KX5 D;  4J8U A;  5B32 D;  3NQU B;  1M18 A;  3LEL B;  1BH9 A;  1P3L C;  5AVB B;  5DNM C;  4YM6 B;  1M1A C;  3F6T A;  1P3F A;  1HQ3 B;  3MVD C;  5GT3 C;  3O62 C;  4XZQ D;  5BT1 C;  1TZY D;  4WNN A;  3X1V A;  3LJA C;  2BYK A;  3A1K A;  4J8W D;  2Y2O A;  5BNX B;  5CP6 B;  1KX3 B;  3REH A;  5F99 B;  2ZM5 A;  3UT9 D;  3AZI B;  3C1B D;  3W96 B;  3B0C T;  2BYM B;  1P3A B;  3AFA C;  1S32 C;  2PYO D;  3AZH D;  4JJN B;  5JRG B;  3REI D;  4NE6 A;  3B6G C;  5B0Z D;  3AZE A;  3AV2 C;  3KUY B;  3MGR C;  3P5J B;  4J8X B;  3MGS C;  5AY8 B;  3LZ0 A;  3KWQ A;  3AZL D;  5G49 B;  4WU8 D;  5B40 C;  3MNN B;  2NZD B;  5GT0 A;  4J8V D;  3B0D C;  3UTA A;  3EG5 B;  1P3K C;  5AV9 D;  4KUD B;  3MGP B;  3AZF D;  4DQY B;  3X1U A;  3AZG C;  5E5A B;  3AZJ B;  2ZY2 A;  2ARO A;  4KGC D;  2W8S A;  3AZM A;  2ZY4 A;  4R8P A;  3REK B;  1F66 A;  2HIO B;  2YFW B;  5DNN B;  3AV1 B;  1P3G B;  1P3P A;  5AV6 D;  2HUE C;  4YM6 D;  3LZ1 D;  3W99 A;  2CWE A;  1AOI B;  4CAY A;  4UUZ A;  4XZQ C;  3UTB A;  5CPJ B;  5BNX A;  5CP6 A;  5CPK D;  3H0L C;  1BH8 A;  4H9S A;  1U35 D;  2L5A A;  5B1M B;  3WKJ A;  3W96 A;  2BYM A;  3UT9 C;  3C1B C;  2CV5 B;  1P3A D;  4Z2M H;  5B24 D;  3WTP E;  3X1T B;  3AL0 C;  5JRG A;  3W98 B;  3REI C;  5B0Z C;  4Z5T A;  1P3L D;  1BH9 B;  4ZBJ C;  1ID3 A;  5G49 A;  4QLC A;  4WU9 D;  1P3F B;  1BFM A;  5B31 A;  3AZL C;  3LJA D;  3B0B A;  5AV8 A;  3AN2 B;  2NZD A;  3AZN C;  4ZUX B;  3WTP A;  1W2E A;  4G91 B;  3X1S D;  3MGP A;  3C1C A;  5AV9 C;  1H3O A;  3TU4 A;  3AZK A;  1P3B B;  5BO0 A;  3AZJ A;  4YS3 A;  4DRB A;  1EQZ B;  3B6F D;  2FJ7 A;  2G5H C;  2Y2G A;  2NQB B;  2YFW A;  5DNN A;  2HIO D;  5B33 A;  2F8N G;  1N1J A;  3LEL C;  3B6G D;  2G5I C;  2DQN C;  4WV4 B;  5AVB C;  5AV6 C;  4YM6 C;  5CPI A;  1AOI D;  3AZE B;  5CPJ A;  1TAF A;  3EPK A;  4CSR B;  3MGS D;  3WAA D;  5AV5 D;  5CPK C;  5AVC A;  4XUJ B;  1KX3 C;  5GT0 B;  3KSY A;  5F99 C;  5CHL B;  3AZI C;  2CV5 D;  5B0Y A;  3V9R A;  3X1U B;  4H9O A;  1P3A C;  2Y2I A;  4E44 A;  3AZM B;  2Y2Q A;  4R8P B;  4JJN C;  1F66 B;  1P3M B;  4Z66 B;  4J8U D;  5BS7 C;  1M18 D;  5C3I B;  3VH5 W;  5JA4 A;  2JSS A;  1P3P B;  1P34 A;  1ZLA D;  3WA9 A;  1P3F D;  3W99 B;  3AN2 A;  5AY8 C;  4WU9 C;  4CAY B;  4ZUX A;  4UUZ B;  3X1V D;  3MGQ A;  3UTB B;  3MNN C;  3X1S C;  2XD5 A;  1P3B A;  1BH8 B;  4KUD C;  1EQZ A;  3REH D;  3REJ A;  1KX5 A;  4NE5 A;  5B2I A;  5B32 A;  4H9P A;  2ZY5 A;  3B6F C;  3WKJ B;  2NQB A;  4X23 A;  3REK C;  1P3O A;  2HIO C;  1M19 A;  3AV1 C;  1P3G C;  4XZQ A;  1TZY A;  5GSU A;  3W97 B;  3AZE D;  1AOI C;  4Z5T B;  4CSR A;  4J8W A;  1ID3 B;  3WAA C;  4QLC B;  3LZ0 D;  3KWQ D;  3VH6 W;  3AZN D;  5B31 B;  4LD9 A;  3KXB A;  5AV5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...