4KGCA

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcA00
2BYKA 1M19B 4J8UC 3MGSC 4H9RA 3KXBD 3VH6W 3AN2A 3REIA 1P3BA 3AZGA 2NQBB 1HQ3D 2CV5B 3MGQB 3WKJB 3AYWB 4QLCC 3UT9C 4J8XB 4Z2MH 3TU4B 4YS3B 4J8WC 4ZBJC 5CPKB 3X1VC 3W98D 4H9PA 1F66A 5GT3A 5JRGB 1M18B 5B0YB 1P3PB 3NQJB 2FJ7B 5AV8D 1B67A 4J8UA 3MGSA 5B2JD 4XZQC 3AZHD 3AZIB 5E5AC 3MVDD 1KX3B 5GXQB 1P3LD 3C1BD 4Z5TC 5F99C 4QLCA 3UT9A 3V9RB 3REJB 5AV6C 3RELD 5CPID 4J8WA 3X1UC 1WWSA 3AZFB 1KX5C 2F8NK 3X1VA 2HIOD 2IO5B 5DNMD 4KGCC 5B0ZD 3WA9D 1S32D 5GT0C 3AZMC 1ID3C 5B32G 4XZQA 3MGPD 5B1LD 5E5AA 1P34C 1M1AD 5AV9D 4Z5TA 5F99A 3UTAD 5DNNB 5AV6A 5B31G 3AFAC 3X1UA 1KX5A 1AOID 3AZKC 4H9NB 4H9OB 5KDMA 1P3OB 5FUGA 2PYOA 3AZJC 4KGCA 3A6NC 3MGRC 3B0BA 3WAAD 4Z66D 3AZMA 3AZED 1ID3A 3WA9B 3LZ1D 4EO5B 5B2IC 1P3GC 1P34A 1N1JB 4XUJD 1M19C 2AROD 3AV1D 1P3ID 1P3MB 1Q9CA 5B24D 2YFVB 1M1AB 3KUYD 3AZND 4CAYB 5AV9B 2NQBC 5BT1D 4R8PB 3UTAB 3AZKA 3R45B 3MGQC 2CV5C 3AYWC 3WKJC 4J8XC 3TU4C 3WTPD 4YS3C 3AZJA 3A6NA 3MGRA 1AOIB 5CPKC 1JFIB 4H9QB 2L5AA 5JRGC 1M18C 5B0YC 3UTBD 1P3PC 2FJ7C 5B2IA 1P3GA 3WAAB 1M19A 4Z66B 3AZEB 3X1SB 4X23B 4UUZB 3AZIC 1KX3C 4XUJB 5GXQC 2NQBA 4G92B 4Z2MG 1P3FB 4NE6A 2CV5A 3MGQA 3WKJA 3AYWA 1BH8B 3W99D 5B40D 4J8XA 3C1CB 3REJC 5B33D 3TU4A 3AZLD 3AZNB 3VH5T 5BS7C 1ULYA 3AZFC 4YS3A 5AVBB 5CPKA 3B6FD 5BO0B 4YM6B 3WTPB 3REHD 5JRGA 1M18A 5B0YA 1P3PA 3NQJA 2FJ7A 4E45A 3AV2D 4DRAA 4KUDA 3B0CT 3AZIA 1KX3A 3KWQB 3W97D 5GXQA 1ZLAD 3LELD 5AY8B 1U35D 5DNNC 3V9RA 3REJA 5JA4B 1P3KD 5AV5B 5BS7A 5GSUD 3AZFA 3LZ0D 1EQZB 4WNNB 1P3OC 3MNNB 5B40B 3LJAB 5B32D 3REKB 5B33B 3AN2D 3REID 1P3BD 1TZYD 3AZGD 5B1MD 2F8NG 1TAFB 3O62D 5CPJB 3WA9C 5B31D 5BNVB 4NE3A 4EO5C 3AV2B 4KHAB 3KXBB 1P3AD 1F66D 5GT3D 5DNNA 1P3MC 4WU8D 3W97B 1M1AC 5AV9C 3LELB 1U35B 4R8PC 1HQ3B 4J8UD 2JSSA 3MGSD 4H9OA 4H9NA 1P3OA 2PYOC 1P3KB 1B6WA 3LZ0B 3W98B 5B32B 2F8NH 3UT9D 1TZYB 3WA9A 5B1MB 3B6GD 4CSRB 3O62B 5AV8B 3X1VD 3WAAC 1N1JA 4Z66C 5B2JB 3AZEC 3X1SC 5B31B 1H3OB 3AZHB 4X23C 1P3MA 3MVDB 2YFVA 1M1AA 4XUJC 1P3LB 4CAYA 5AV9A 3C1BB 4G92C 1P3AB 1KU5A 4R8PA 1P3FC 3UTAA 3R45A 1KX4D 1F1EA 4WU8B 3RELB 3C1CC 5CPIB 4JJND 3AZNC 5E5AD 5AVBC 5BT1C 1AOIA 1JFIA 2HIOB 4J8VD 4YM6C 5AVCD 3WTPC 5DNMB 5B0ZB 4H9QA 5AV6D 3X1UD 2LY8A 1S32B 3WAAA 5G49B 4Z66A 3AZEA 3X1SA 3MGPB 3B6GB 4KGCD 5B1LB 4X23A 4UUZA 2YFWB 3KWQC 4XUJA 5GT0D 1P3FA 5AY8C 1BH8A 3C1CA 3AZNA 5AV5C 5AVBA 1P34D 1EQZC 5BO0A 1KX4B 3W96D 4YM6A 3MNNC 3LJAC 3REKC 4JJNB 3VH5W 3WTPA 5B33C 5C3IB 2BYMB 5BNXB 3AFAD 4J8VB 3NQUB 4WU9D 5CPJC 3AZKD 5AVCB 3LZ1B 3AZJD 3A6ND 5CP6D 3X1TD 3MGRD 3KWQA 3AV2C 2AROB 3AV1B 3KXBC 1P3IB 5AY8A 3B0CW 5B24B 5JA4A 3KUYB 2F8ND 3W97C 4G91B 5AV5A 4HGAB 5GT0B 5B2ID 3LELC 1P3GD 1U35C 1M19D 1HQ3C 4WNNA 1EQZA 3MNNA 2IO5C 5B40A 3LJAA 3REKA 1P3KC 5B33A 4LD9D 3LZ0C 2NQBD 1TAFA 3B0DB 3W96B 4ZUXD 3W98C 3VH5A 2NZDD 5B32C 5CPJA 2CV5D 4J8XD 1TZYC 3TU4D 5B1MC 4YS3D 3UTBB 5BNVA 4WU9B 3O62C 5AV8C 3AV2A 4KHAA 5B2JC 3KXBA 4NFTA 5B31C 5CP6B 3AZHC 3X1TB 3MVDC 3W97A 5B0YD 1P3PD 1P3LC 4KUDD 3C1BC 3LELA 1P3AC 1U35A 1HQ3A 3W99B 4WU8C 3RELC 1P3KA 3AZLB 5CPIC 2F8NB 3LZ0A 3AZID 1KX3D 3B6FB 5GXQD 1BH9B 2HIOC 3W98A 4LD9B 5B32A 4AWLB 5DNMC 3REJD 3REHB 1A7WA 1TZYA 5B0ZC 5B1MA 3AZFD 2RVQD 4CSRA 4ZUXB 3O62A 1S32C 5AV8A 2NZDB 5B2JA 3MGPC 3B6GC 5B31A 1H3OA 3AZHA 5B1LC 3MVDA 2HUEB 1ZLAB 1P3LA 3C1BA 4NE5A 1P3AA 3UTAC 3VH6T 3WTPE 4WU8A 3RELA 5CPIA 5GSUB 4KUDB 2BYKB 1AOIC 2HIOA 1KX4C 4H9RB 3AN2B 4QLCD 5DNND 5DNMA 4WZSB 4JJNC 3REIB 5C3IC 5B0ZA 3AZGB 1P3BB 4J8WD 3VH6A 4J8VC 4WV4B 1S32A 5G49A 5AVCC 1P3OD 3LZ1C 3MGPA 3B6GA 5B1LA 2YFWA 2AROC 4H9PB 3AV1C 1P3IC 1F66B 5GT3B 4XZQD 5B24C 3KUYC 4G91C 4M6BA 4HGAC 4J8UB 3MGSB 1KX4A 4Z5TD 5F99D 4JJNA 1P3MD 2BYMA 5BNXA 1KX5D 3B0DC 4J8VA 3NQUA 3W96C 4R8PD 5AVCA 4QLCB 1R4VA 3UT9B 1HTAA 2PYOD 4H9SC 3LZ1A 4J8WB 4ZBJB 3UTBC 5CHLB 4DRBA 3X1VB 4WU9C 2AROA 3AV1A 1P3IA 3AZMD 1WWIA 1ID3D 5CP6C 3X1TC 3KSYA 5B24A 3KUYA 5GT0A 4XZQB 3W99C 3X1SD 5B40C 3AZLC 4X23D 5E5AB 3B6FC 4Z5TB 3W96A 1P3FD 5F99B 4LD9C 4AWLC 4H9SA 5AV6B 3C1CD 3REHC 1KX5B 3X1UB 3AFAA 1BFMA 3UTBA 5AVBD 4ZUXC 4WU9A 2NZDC 5KDMB 2PYOB 5FUGB 4YM6D 4E44A 4KGCB 5CP6A 3X1TA 2HUEC 1ZLAC 2CWEA 3AZMB 1ID3B 3W99A 3AZLA 2F8NA 5GSUC 4KUDC 1P34B 3KWQD 3B6FA 1BH9A 5AY8D 4LD9A 3MGQD 3AN2C 3AYWD 3WKJD 3REIC 1P3BC 3REHA 3AZGC 3AFAB 5AV5D 4ZUXA 5CPKD 1EQZD 2NZDA 3AZKB 3MNND 3LJAD 3REKD 3AZJB 3A6NB 2RVQC 3MGRB 5JRGD 1M18D 1ZLAA 2FJ7D 5CPJD 1F66C 5GT3C 5GSUA 5B2IB 1P3GB
chains in the Genus database with same CATH superfamily
2BYKA 1M19B 4J8UC 3MGSC 4H9RA 3KXBD 3VH6W 3EPKA 3AN2A 3REIA 1P3BA 3AZGA 2NQBB 2VQRA 1HQ3D 2CV5B 3MGQB 3WKJB 3AYWB 4QLCC 3UT9C 4J8XB 4Z2MH 3TU4B 4YS3B 4J8WC 4ZBJC 5CPKB 3X1VC 3W98D 4H9PA 1F66A 5GT3A 5JRGB 1M18B 5B0YB 1P3PB 3NQJB 2FJ7B 5AV8D 1B67A 4J8UA 3MGSA 5B2JD 4XZQC 3AZHD 3AZIB 5E5AC 3MVDD 1KX3B 5GXQB 1P3LD 3C1BD 4Z5TC 5F99C 4QLCA 3UT9A 3V9RB 3REJB 5AV6C 3RELD 5CPID 4J8WA 3X1UC 1WWSA 3AZFB 1KX5C 2F8NK 3X1VA 2G5HC 2HIOD 2IO5B 5DNMD 4KGCC 5B0ZD 3WA9D 1S32D 5GT0C 3AZMC 1ID3C 5B32G 4XZQA 3MGPD 5B1LD 5E5AA 1P34C 1M1AD 5AV9D 4Z5TA 5F99A 3UTAD 5DNNB 5AV6A 5B31G 3EPJA 3AFAC 3X1UA 1KX5A 1AOID 3AZKC 4H9NB 4H9OB 5KDMA 1P3OB 5FUGA 2PYOA 3AZJC 2Y2QA 4KGCA 3A6NC 3MGRC 3B0BA 2Y2LA 3WAAD 4Z66D 3AZMA 1W2EA 3AZED 1ID3A 3WA9B 3LZ1D 4EO5B 5B2IC 1P3GC 1P34A 1N1JB 4XUJD 1M19C 2AROD 3IP4C 3AV1D 1P3ID 1P3MB 1Q9CA 5B24D 2YFVB 1M1AB 3KUYD 3AZND 4CAYB 5AV9B 2NQBC 5BT1D 4R8PB 3UTAB 3AZKA 3R45B 3MGQC 2CV5C 3AYWC 3WKJC 4J8XC 3TU4C 3WTPD 4YS3C 3AZJA 3A6NA 3MGRA 1AOIB 5CPKC 1JFIB 4H9QB 2L5AA 5JRGC 1M18C 5B0YC 3UTBD 1P3PC 2FJ7C 5B2IA 1P3GA 3WAAB 1M19A 4Z66B 2UWXA 3X1SB 3AZEB 4X23B 4UUZB 3AZIC 1KX3C 4XUJB 5GXQC 2NQBA 4G92B 4Z2MG 1P3FB 4NE6A 2CV5A 3MGQA 3WKJA 3AYWA 1BH8B 3W99D 5B40D 4J8XA 3C1CB 3REJC 5B33D 3TU4A 3AZLD 3AZNB 3VH5T 5BS7C 1ULYA 3AZFC 4YS3A 2Y2OA 5AVBB 5CPKA 3B6FD 2JCHA 5BO0B 4YM6B 3WTPB 3REHD 5JRGA 1M18A 5B0YA 1P3PA 2DQNC 3NQJA 2FJ7A 4E45A 3AV2D 4DRAA 3H0RC 4KUDA 3B0CT 3AZIA 4UPKA 1KX3A 3KWQB 3W97D 5GXQA 1ZLAD 3LELD 5AY8B 1U35D 5DNNC 3V9RA 3REJA 5JA4B 1P3KD 2ZM5A 5AV5B 5BS7A 5GSUD 3AZFA 3LZ0D 1EQZB 4WNNB 1P3OC 3MNNB 5B40B 3LJAB 5B32D 3REKB 5B33B 3H0LC 3AN2D 3REID 1P3BD 1TZYD 3AZGD 5B1MD 2F8NG 1TAFB 3O62D 5CPJB 3WA9C 5B31D 5BNVB 2Y2IA 4NE3A 4EO5C 3AV2B 4KHAB 3KXBB 1P3AD 1F66D 5GT3D 2G5IC 5DNNA 1P3MC 4WU8D 3W97B 1M1AC 5AV9C 3LELB 1U35B 4R8PC 1HQ3B 4J8UD 2JSSA 3MGSD 3FDDA 4H9OA 4H9NA 1P3OA 2PYOC 1P3KB 1B6WA 3LZ0B 2RIQA 3W98B 5B32B 2F8NH 3UT9D 1TZYB 3WA9A 5B1MB 3B6GD 4CSRB 3O62B 5AV8B 3X1VD 3WAAC 1N1JA 4Z66C 5B2JB 3AZEC 3X1SC 1T3UA 5B31B 1H3OB 3AZHB 4X23C 1P3MA 3MVDB 2YFVA 1M1AA 4XUJC 1P3LB 4CAYA 5AV9A 3C1BB 4G92C 1P3AB 1KU5A 2FFFB 4R8PA 1P3FC 3UTAA 3R45A 1KX4D 1F1EA 4WU8B 2Y2MA 3C1CC 3RELB 5CPIB 4JJND 3AZNC 5E5AD 5AVBC 5BT1C 1AOIA 1JFIA 2HIOB 4J8VD 4YM6C 1PZRA 5AVCD 3WTPC 5DNMB 3EPHA 5B0ZB 4H9QA 5AV6D 3X1UD 2LY8A 1S32B 3WAAA 5G49B 4Z66A 3AZEA 3X1SA 3MGPB 3B6GB 4KGCD 2BG1A 5B1LB 4X23A 4UUZA 2YFWB 3KWQC 4XUJA 5GT0D 2Y2NA 1P3FA 5AY8C 2Y2JA 1BH8A 3C1CA 3AZNA 5AV5C 5AVBA 1P34D 1EQZC 5BO0A 1KX4B 3W96D 4YM6A 3MNNC 3LJAC 3A1KA 3REKC 4JJNB 3VH5W 3WTPA 5B33C 2Y2HA 5C3IB 2BYMB 5BNXB 2ZY3A 3AFAD 4J8VB 3NQUB 4WU9D 2W8SA 5CPJC 3AZKD 5AVCB 3LZ1B 3AZJD 3A6ND 2ZY4A 5CP6D 3X1TD 3MGRD 3KWQA 3AV2C 2AROB 3AV1B 3KXBC 1P3IB 5AY8A 3EG5B 3B0CW 5B24B 5JA4A 3KUYB 2F8ND 3W97C 4G91B 5AV5A 4HGAB 5GT0B 5B2ID 2XD1A 3LELC 1P3GD 1U35C 1M19D 1HQ3C 4WNNA 1EQZA 3MNNA 2IO5C 5B40A 3LJAA 3REKA 1P3KC 5B33A 4LD9D 3LZ0C 2NQBD 2Y2KA 1TAFA 3B0DB 3W96B 4ZUXD 3W98C 3VH5A 2NZDD 5B32C 5CPJA 2CV5D 4J8XD 1TZYC 3TU4D 5B1MC 4YS3D 3UTBB 5BNVA 4WU9B 3O62C 5AV8C 3AV2A 4KHAA 5B2JC 3KXBA 4NFTA 5B31C 5CP6B 3AZHC 3X1TB 3F6TA 3MVDC 3W97A 5B0YD 1P3PD 1P3LC 4KUDD 3C1BC 3LELA 1P3AC 1U35A 1HQ3A 3W99B 4WU8C 3RELC 1P3KA 3AZLB 5CPIC 2F8NB 3LZ0A 3AZID 1KX3D 3B6FB 5GXQD 1BH9B 2HIOC 3W98A 4LD9B 5B32A 4AWLB 5DNMC 3REJD 3REHB 1A7WA 1TZYA 5B0ZC 2Y2PA 5B1MA 3AZFD 2RVQD 4CSRA 4ZUXB 3O62A 1S32C 5AV8A 2NZDB 1Z2CB 5B2JA 2F2AC 3MGPC 3B6GC 5B31A 1H3OA 3AZHA 5B1LC 3MVDA 2HUEB 1ZLAB 1P3LA 3C1BA 4NE5A 1P3AA 3UTAC 3VH6T 3WTPE 4WU8A 3RELA 5CPIA 5GSUB 4KUDB 2BYKB 1AOIC 2HIOA 1KX4C 4H9RB 3A1IA 3AN2B 4QLCD 5DNND 5DNMA 4WZSB 4JJNC 3REIB 5C3IC 5B0ZA 3AZGB 1P3BB 4J8WD 3VH6A 4J8VC 2Y2GA 4WV4B 1S32A 2ZY5A 5G49A 5AVCC 1P3OD 2J8PA 3LZ1C 3MGPA 3AL0C 3B6GA 5B1LA 2YFWA 2AROC 4H9PB 3AV1C 1P3IC 1F66B 5GT3B 4XZQD 3EPLA 5B24C 3KUYC 4G91C 4M6BA 4HGAC 4J8UB 3MGSB 1KX4A 4Z5TD 5F99D 4JJNA 1P3MD 2BYMA 5BNXA 1KX5D 3B0DC 4J8VA 3NQUA 3W96C 4R8PD 5AVCA 4QLCB 1R4VA 3UT9B 1HTAA 2PYOD 4H9SC 3LZ1A 4J8WB 4ZBJB 3UTBC 5CHLB 4DRBA 3X1VB 4WU9C 2AROA 3AV1A 2XD5A 1P3IA 3AZMD 1WWIA 1ID3D 5CP6C 3X1TC 3KSYA 5B24A 3KUYA 5GT0A 4XZQB 3W99C 3X1SD 5B40C 3AZLC 4X23D 5E5AB 3B6FC 4Z5TB 3P5JB 3W96A 1P3FD 5F99B 4LD9C 4AWLC 4H9SA 5AV6B 3C1CD 3REHC 1KX5B 3X1UB 3AFAA 1BFMA 3UTBA 5AVBD 4ZUXC 4WU9A 2NZDC 5KDMB 2PYOB 5FUGB 4YM6D 3KFUG 4E44A 4KGCB 5CP6A 3X1TA 4WJ3C 2HUEC 1ZLAC 2CWEA 3AZMB 3H0MC 1ID3B 3W99A 3AZLA 2F8NA 5GSUC 4KUDC 1P34B 3KWQD 3B6FA 1BH9A 4DQYB 2JE5A 5AY8D 4LD9A 3MGQD 3AN2C 3AYWD 3WKJD 3REIC 1P3BC 3REHA 2ZY2A 3AZGC 3AFAB 5AV5D 4ZUXA 5CPKD 1EQZD 2NZDA 3AZKB 2DF4C 3MNND 3LJAD 3REKD 3AZJB 3A6NB 2RVQC 3MGRB 5JRGD 1M18D 1ZLAA 2FJ7D 5CPJD 1F66C 5GT3C 5GSUA 5B2IB 1P3GB
chains in the Genus database with same CATH topology
2BYKA 1M19B 4J8UC 3MGSC 4H9RA 3KXBD 3VH6W 3EPKA 3AN2A 3REIA 1P3BA 3AZGA 2NQBB 2VQRA 1HQ3D 2CV5B 3MGQB 3WKJB 3AYWB 4QLCC 3UT9C 4J8XB 4Z2MH 3TU4B 4YS3B 4J8WC 4ZBJC 5CPKB 3X1VC 3W98D 4H9PA 1F66A 5GT3A 5JRGB 1M18B 5B0YB 1P3PB 3NQJB 2FJ7B 5AV8D 1B67A 4J8UA 3MGSA 5B2JD 4XZQC 3AZHD 3AZIB 5E5AC 3MVDD 1KX3B 5GXQB 1P3LD 3C1BD 4Z5TC 5F99C 4QLCA 3UT9A 3V9RB 3REJB 5AV6C 3RELD 5CPID 4J8WA 3X1UC 1WWSA 3AZFB 1KX5C 2F8NK 3X1VA 2G5HC 2HIOD 2IO5B 5DNMD 4KGCC 5B0ZD 3WA9D 1S32D 5GT0C 3AZMC 1ID3C 5B32G 4XZQA 3MGPD 5B1LD 5E5AA 1P34C 1M1AD 5AV9D 4Z5TA 5F99A 3UTAD 5DNNB 5AV6A 5B31G 3EPJA 3AFAC 3X1UA 1KX5A 1AOID 3AZKC 4H9NB 4H9OB 5KDMA 1P3OB 5FUGA 2PYOA 3AZJC 2Y2QA 4KGCA 3A6NC 3MGRC 3B0BA 2Y2LA 3WAAD 4Z66D 3AZMA 1W2EA 3AZED 1ID3A 3WA9B 3LZ1D 4EO5B 5B2IC 1P3GC 1P34A 1N1JB 4XUJD 1M19C 2AROD 3IP4C 3AV1D 1P3ID 1P3MB 1Q9CA 5B24D 2YFVB 1M1AB 3KUYD 3AZND 4CAYB 5AV9B 2NQBC 5BT1D 4R8PB 3UTAB 3AZKA 3R45B 3MGQC 2CV5C 3AYWC 3WKJC 4J8XC 3TU4C 3WTPD 4YS3C 3AZJA 3A6NA 3MGRA 1AOIB 5CPKC 1JFIB 4H9QB 2L5AA 5JRGC 1M18C 5B0YC 3UTBD 1P3PC 2FJ7C 5B2IA 1P3GA 3WAAB 1M19A 4Z66B 2UWXA 3X1SB 3AZEB 4X23B 4UUZB 3AZIC 1KX3C 4XUJB 5GXQC 2NQBA 4G92B 4Z2MG 1P3FB 4NE6A 2CV5A 3MGQA 3WKJA 3AYWA 1BH8B 3W99D 5B40D 4J8XA 3C1CB 3REJC 5B33D 3TU4A 3AZLD 3AZNB 3VH5T 5BS7C 1ULYA 3AZFC 4YS3A 2Y2OA 5AVBB 5CPKA 3B6FD 2JCHA 5BO0B 4YM6B 3WTPB 3REHD 5JRGA 1M18A 5B0YA 1P3PA 2DQNC 3NQJA 2FJ7A 4E45A 3AV2D 4DRAA 3H0RC 4KUDA 3B0CT 3AZIA 4UPKA 1KX3A 3KWQB 3W97D 5GXQA 1ZLAD 3LELD 5AY8B 1U35D 5DNNC 3V9RA 3REJA 5JA4B 1P3KD 2ZM5A 5AV5B 5BS7A 5GSUD 3AZFA 3LZ0D 1EQZB 4WNNB 1P3OC 3MNNB 5B40B 3LJAB 5B32D 3REKB 5B33B 3H0LC 3AN2D 3REID 1P3BD 1TZYD 3AZGD 5B1MD 2F8NG 1TAFB 3O62D 5CPJB 3WA9C 5B31D 5BNVB 2Y2IA 4NE3A 4EO5C 3AV2B 4KHAB 3KXBB 1P3AD 1F66D 5GT3D 2G5IC 5DNNA 1P3MC 4WU8D 3W97B 1M1AC 5AV9C 3LELB 1U35B 4R8PC 1HQ3B 4J8UD 2JSSA 3MGSD 3FDDA 4H9OA 4H9NA 1P3OA 2PYOC 1P3KB 1B6WA 3LZ0B 2RIQA 3W98B 5B32B 2F8NH 3UT9D 1TZYB 3WA9A 5B1MB 3B6GD 4CSRB 3O62B 5AV8B 3X1VD 3WAAC 1N1JA 4Z66C 5B2JB 3AZEC 3X1SC 1T3UA 5B31B 1H3OB 3AZHB 4X23C 1P3MA 3MVDB 2YFVA 1M1AA 4XUJC 1P3LB 4CAYA 5AV9A 3C1BB 4G92C 1P3AB 1KU5A 2FFFB 4R8PA 1P3FC 3UTAA 3R45A 1KX4D 1F1EA 4WU8B 2Y2MA 3C1CC 3RELB 5CPIB 4JJND 3AZNC 5E5AD 5AVBC 5BT1C 1AOIA 1JFIA 2HIOB 4J8VD 4YM6C 1PZRA 5AVCD 3WTPC 5DNMB 3EPHA 5B0ZB 4H9QA 5AV6D 3X1UD 2LY8A 1S32B 3WAAA 5G49B 4Z66A 3AZEA 3X1SA 3MGPB 3B6GB 4KGCD 2BG1A 5B1LB 4X23A 4UUZA 2YFWB 3KWQC 4XUJA 5GT0D 2Y2NA 1P3FA 5AY8C 2Y2JA 1BH8A 3C1CA 3AZNA 5AV5C 5AVBA 1P34D 1EQZC 5BO0A 1KX4B 3W96D 4YM6A 3MNNC 3LJAC 3A1KA 3REKC 4JJNB 3VH5W 3WTPA 5B33C 2Y2HA 5C3IB 2BYMB 5BNXB 2ZY3A 3AFAD 4J8VB 3NQUB 4WU9D 2W8SA 5CPJC 3AZKD 5AVCB 3LZ1B 3AZJD 3A6ND 2ZY4A 5CP6D 3X1TD 3MGRD 3KWQA 3AV2C 2AROB 3AV1B 3KXBC 1P3IB 5AY8A 3EG5B 3B0CW 5B24B 5JA4A 3KUYB 2F8ND 3W97C 4G91B 5AV5A 4HGAB 5GT0B 5B2ID 2XD1A 3LELC 1P3GD 1U35C 1M19D 1HQ3C 4WNNA 1EQZA 3MNNA 2IO5C 5B40A 3LJAA 3REKA 1P3KC 5B33A 4LD9D 3LZ0C 2NQBD 2Y2KA 1TAFA 3B0DB 3W96B 4ZUXD 3W98C 3VH5A 2NZDD 5B32C 5CPJA 2CV5D 4J8XD 1TZYC 3TU4D 5B1MC 4YS3D 3UTBB 5BNVA 4WU9B 3O62C 5AV8C 3AV2A 4KHAA 5B2JC 3KXBA 4NFTA 5B31C 5CP6B 3AZHC 3X1TB 3F6TA 3MVDC 3W97A 5B0YD 1P3PD 1P3LC 4KUDD 3C1BC 3LELA 1P3AC 1U35A 1HQ3A 3W99B 4WU8C 3RELC 1P3KA 3AZLB 5CPIC 2F8NB 3LZ0A 3AZID 1KX3D 3B6FB 5GXQD 1BH9B 2HIOC 3W98A 4LD9B 5B32A 4AWLB 5DNMC 3REJD 3REHB 1A7WA 1TZYA 5B0ZC 2Y2PA 5B1MA 3AZFD 2RVQD 4CSRA 4ZUXB 3O62A 1S32C 5AV8A 2NZDB 1Z2CB 5B2JA 2F2AC 3MGPC 3B6GC 5B31A 1H3OA 3AZHA 5B1LC 3MVDA 2HUEB 1ZLAB 1P3LA 3C1BA 4NE5A 1P3AA 3UTAC 3VH6T 3WTPE 4WU8A 3RELA 5CPIA 5GSUB 4KUDB 2BYKB 1AOIC 2HIOA 1KX4C 4H9RB 3A1IA 3AN2B 4QLCD 5DNND 5DNMA 4WZSB 4JJNC 3REIB 5C3IC 5B0ZA 3AZGB 1P3BB 4J8WD 3VH6A 4J8VC 2Y2GA 4WV4B 1S32A 2ZY5A 5G49A 5AVCC 1P3OD 2J8PA 3LZ1C 3MGPA 3AL0C 3B6GA 5B1LA 2YFWA 2AROC 4H9PB 3AV1C 1P3IC 1F66B 5GT3B 4XZQD 3EPLA 5B24C 3KUYC 4G91C 4M6BA 4HGAC 4J8UB 3MGSB 1KX4A 4Z5TD 5F99D 4JJNA 1P3MD 2BYMA 5BNXA 1KX5D 3B0DC 4J8VA 3NQUA 3W96C 4R8PD 5AVCA 4QLCB 1R4VA 3UT9B 1HTAA 2PYOD 4H9SC 3LZ1A 4J8WB 4ZBJB 3UTBC 5CHLB 4DRBA 3X1VB 4WU9C 2AROA 3AV1A 2XD5A 1P3IA 3AZMD 1WWIA 1ID3D 5CP6C 3X1TC 3KSYA 5B24A 3KUYA 5GT0A 4XZQB 3W99C 3X1SD 5B40C 3AZLC 4X23D 5E5AB 3B6FC 4Z5TB 3P5JB 3W96A 1P3FD 5F99B 4LD9C 4AWLC 4H9SA 5AV6B 3C1CD 3REHC 1KX5B 3X1UB 3AFAA 1BFMA 3UTBA 5AVBD 4ZUXC 4WU9A 2NZDC 5KDMB 2PYOB 5FUGB 4YM6D 3KFUG 4E44A 4KGCB 5CP6A 3X1TA 4WJ3C 2HUEC 1ZLAC 2CWEA 3AZMB 3H0MC 1ID3B 3W99A 3AZLA 2F8NA 5GSUC 4KUDC 1P34B 3KWQD 3B6FA 1BH9A 4DQYB 2JE5A 5AY8D 4LD9A 3MGQD 3AN2C 3AYWD 3WKJD 3REIC 1P3BC 3REHA 2ZY2A 3AZGC 3AFAB 5AV5D 4ZUXA 5CPKD 1EQZD 2NZDA 3AZKB 2DF4C 3MNND 3LJAD 3REKD 3AZJB 3A6NB 2RVQC 3MGRB 5JRGD 1M18D 1ZLAA 2FJ7D 5CPJD 1F66C 5GT3C 5GSUA 5B2IB 1P3GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYK A;  1M19 B;  4J8U C;  3MGS C;  4H9R A;  3KXB D;  3VH6 W;  3AN2 A;  3REI A;  1P3B A;  3AZG A;  2NQB B;  1HQ3 D;  2CV5 B;  3MGQ B;  3WKJ B;  3AYW B;  4QLC C;  3UT9 C;  4J8X B;  4Z2M H;  3TU4 B;  4YS3 B;  4J8W C;  4ZBJ C;  5CPK B;  3X1V C;  3W98 D;  4H9P A;  1F66 A;  5GT3 A;  5JRG B;  1M18 B;  5B0Y B;  1P3P B;  3NQJ B;  2FJ7 B;  5AV8 D;  1B67 A;  4J8U A;  3MGS A;  5B2J D;  4XZQ C;  3AZH D;  3AZI B;  5E5A C;  3MVD D;  1KX3 B;  5GXQ B;  1P3L D;  3C1B D;  4Z5T C;  5F99 C;  4QLC A;  3UT9 A;  3V9R B;  3REJ B;  5AV6 C;  3REL D;  5CPI D;  4J8W A;  3X1U C;  1WWS A;  3AZF B;  1KX5 C;  2F8N K;  3X1V A;  2HIO D;  2IO5 B;  5DNM D;  4KGC C;  5B0Z D;  3WA9 D;  1S32 D;  5GT0 C;  3AZM C;  1ID3 C;  5B32 G;  4XZQ A;  3MGP D;  5B1L D;  5E5A A;  1P34 C;  1M1A D;  5AV9 D;  4Z5T A;  5F99 A;  3UTA D;  5DNN B;  5AV6 A;  5B31 G;  3AFA C;  3X1U A;  1KX5 A;  1AOI D;  3AZK C;  4H9N B;  4H9O B;  5KDM A;  1P3O B;  5FUG A;  2PYO A;  3AZJ C;  4KGC A;  3A6N C;  3MGR C;  3B0B A;  3WAA D;  4Z66 D;  3AZM A;  3AZE D;  1ID3 A;  3WA9 B;  3LZ1 D;  4EO5 B;  5B2I C;  1P3G C;  1P34 A;  1N1J B;  4XUJ D;  1M19 C;  2ARO D;  3AV1 D;  1P3I D;  1P3M B;  1Q9C A;  5B24 D;  2YFV B;  1M1A B;  3KUY D;  3AZN D;  4CAY B;  5AV9 B;  2NQB C;  5BT1 D;  4R8P B;  3UTA B;  3AZK A;  3R45 B;  3MGQ C;  2CV5 C;  3AYW C;  3WKJ C;  4J8X C;  3TU4 C;  3WTP D;  4YS3 C;  3AZJ A;  3A6N A;  3MGR A;  1AOI B;  5CPK C;  1JFI B;  4H9Q B;  2L5A A;  5JRG C;  1M18 C;  5B0Y C;  3UTB D;  1P3P C;  2FJ7 C;  5B2I A;  1P3G A;  3WAA B;  1M19 A;  4Z66 B;  3AZE B;  3X1S B;  4X23 B;  4UUZ B;  3AZI C;  1KX3 C;  4XUJ B;  5GXQ C;  2NQB A;  4G92 B;  4Z2M G;  1P3F B;  4NE6 A;  2CV5 A;  3MGQ A;  3WKJ A;  3AYW A;  1BH8 B;  3W99 D;  5B40 D;  4J8X A;  3C1C B;  3REJ C;  5B33 D;  3TU4 A;  3AZL D;  3AZN B;  3VH5 T;  5BS7 C;  1ULY A;  3AZF C;  4YS3 A;  5AVB B;  5CPK A;  3B6F D;  5BO0 B;  4YM6 B;  3WTP B;  3REH D;  5JRG A;  1M18 A;  5B0Y A;  1P3P A;  3NQJ A;  2FJ7 A;  4E45 A;  3AV2 D;  4DRA A;  4KUD A;  3B0C T;  3AZI A;  1KX3 A;  3KWQ B;  3W97 D;  5GXQ A;  1ZLA D;  3LEL D;  5AY8 B;  1U35 D;  5DNN C;  3V9R A;  3REJ A;  5JA4 B;  1P3K D;  5AV5 B;  5BS7 A;  5GSU D;  3AZF A;  3LZ0 D;  1EQZ B;  4WNN B;  1P3O C;  3MNN B;  5B40 B;  3LJA B;  5B32 D;  3REK B;  5B33 B;  3AN2 D;  3REI D;  1P3B D;  1TZY D;  3AZG D;  5B1M D;  2F8N G;  1TAF B;  3O62 D;  5CPJ B;  3WA9 C;  5B31 D;  5BNV B;  4NE3 A;  4EO5 C;  3AV2 B;  4KHA B;  3KXB B;  1P3A D;  1F66 D;  5GT3 D;  5DNN A;  1P3M C;  4WU8 D;  3W97 B;  1M1A C;  5AV9 C;  3LEL B;  1U35 B;  4R8P C;  1HQ3 B;  4J8U D;  2JSS A;  3MGS D;  4H9O A;  4H9N A;  1P3O A;  2PYO C;  1P3K B;  1B6W A;  3LZ0 B;  3W98 B;  5B32 B;  2F8N H;  3UT9 D;  1TZY B;  3WA9 A;  5B1M B;  3B6G D;  4CSR B;  3O62 B;  5AV8 B;  3X1V D;  3WAA C;  1N1J A;  4Z66 C;  5B2J B;  3AZE C;  3X1S C;  5B31 B;  1H3O B;  3AZH B;  4X23 C;  1P3M A;  3MVD B;  2YFV A;  1M1A A;  4XUJ C;  1P3L B;  4CAY A;  5AV9 A;  3C1B B;  4G92 C;  1P3A B;  1KU5 A;  4R8P A;  1P3F C;  3UTA A;  3R45 A;  1KX4 D;  1F1E A;  4WU8 B;  3REL B;  3C1C C;  5CPI B;  4JJN D;  3AZN C;  5E5A D;  5AVB C;  5BT1 C;  1AOI A;  1JFI A;  2HIO B;  4J8V D;  4YM6 C;  5AVC D;  3WTP C;  5DNM B;  5B0Z B;  4H9Q A;  5AV6 D;  3X1U D;  2LY8 A;  1S32 B;  3WAA A;  5G49 B;  4Z66 A;  3AZE A;  3X1S A;  3MGP B;  3B6G B;  4KGC D;  5B1L B;  4X23 A;  4UUZ A;  2YFW B;  3KWQ C;  4XUJ A;  5GT0 D;  1P3F A;  5AY8 C;  1BH8 A;  3C1C A;  3AZN A;  5AV5 C;  5AVB A;  1P34 D;  1EQZ C;  5BO0 A;  1KX4 B;  3W96 D;  4YM6 A;  3MNN C;  3LJA C;  3REK C;  4JJN B;  3VH5 W;  3WTP A;  5B33 C;  5C3I B;  2BYM B;  5BNX B;  3AFA D;  4J8V B;  3NQU B;  4WU9 D;  5CPJ C;  3AZK D;  5AVC B;  3LZ1 B;  3AZJ D;  3A6N D;  5CP6 D;  3X1T D;  3MGR D;  3KWQ A;  3AV2 C;  2ARO B;  3AV1 B;  3KXB C;  1P3I B;  5AY8 A;  3B0C W;  5B24 B;  5JA4 A;  3KUY B;  2F8N D;  3W97 C;  4G91 B;  5AV5 A;  4HGA B;  5GT0 B;  5B2I D;  3LEL C;  1P3G D;  1U35 C;  1M19 D;  1HQ3 C;  4WNN A;  1EQZ A;  3MNN A;  2IO5 C;  5B40 A;  3LJA A;  3REK A;  1P3K C;  5B33 A;  4LD9 D;  3LZ0 C;  2NQB D;  1TAF A;  3B0D B;  3W96 B;  4ZUX D;  3W98 C;  3VH5 A;  2NZD D;  5B32 C;  5CPJ A;  2CV5 D;  4J8X D;  1TZY C;  3TU4 D;  5B1M C;  4YS3 D;  3UTB B;  5BNV A;  4WU9 B;  3O62 C;  5AV8 C;  3AV2 A;  4KHA A;  5B2J C;  3KXB A;  4NFT A;  5B31 C;  5CP6 B;  3AZH C;  3X1T B;  3MVD C;  3W97 A;  5B0Y D;  1P3P D;  1P3L C;  4KUD D;  3C1B C;  3LEL A;  1P3A C;  1U35 A;  1HQ3 A;  3W99 B;  4WU8 C;  3REL C;  1P3K A;  3AZL B;  5CPI C;  2F8N B;  3LZ0 A;  3AZI D;  1KX3 D;  3B6F B;  5GXQ D;  1BH9 B;  2HIO C;  3W98 A;  4LD9 B;  5B32 A;  4AWL B;  5DNM C;  3REJ D;  3REH B;  1A7W A;  1TZY A;  5B0Z C;  5B1M A;  3AZF D;  2RVQ D;  4CSR A;  4ZUX B;  3O62 A;  1S32 C;  5AV8 A;  2NZD B;  5B2J A;  3MGP C;  3B6G C;  5B31 A;  1H3O A;  3AZH A;  5B1L C;  3MVD A;  2HUE B;  1ZLA B;  1P3L A;  3C1B A;  4NE5 A;  1P3A A;  3UTA C;  3VH6 T;  3WTP E;  4WU8 A;  3REL A;  5CPI A;  5GSU B;  4KUD B;  2BYK B;  1AOI C;  2HIO A;  1KX4 C;  4H9R B;  3AN2 B;  4QLC D;  5DNN D;  5DNM A;  4WZS B;  4JJN C;  3REI B;  5C3I C;  5B0Z A;  3AZG B;  1P3B B;  4J8W D;  3VH6 A;  4J8V C;  4WV4 B;  1S32 A;  5G49 A;  5AVC C;  1P3O D;  3LZ1 C;  3MGP A;  3B6G A;  5B1L A;  2YFW A;  2ARO C;  4H9P B;  3AV1 C;  1P3I C;  1F66 B;  5GT3 B;  4XZQ D;  5B24 C;  3KUY C;  4G91 C;  4M6B A;  4HGA C;  4J8U B;  3MGS B;  1KX4 A;  4Z5T D;  5F99 D;  4JJN A;  1P3M D;  2BYM A;  5BNX A;  1KX5 D;  3B0D C;  4J8V A;  3NQU A;  3W96 C;  4R8P D;  5AVC A;  4QLC B;  1R4V A;  3UT9 B;  1HTA A;  2PYO D;  4H9S C;  3LZ1 A;  4J8W B;  4ZBJ B;  3UTB C;  5CHL B;  4DRB A;  3X1V B;  4WU9 C;  2ARO A;  3AV1 A;  1P3I A;  3AZM D;  1WWI A;  1ID3 D;  5CP6 C;  3X1T C;  3KSY A;  5B24 A;  3KUY A;  5GT0 A;  4XZQ B;  3W99 C;  3X1S D;  5B40 C;  3AZL C;  4X23 D;  5E5A B;  3B6F C;  4Z5T B;  3W96 A;  1P3F D;  5F99 B;  4LD9 C;  4AWL C;  4H9S A;  5AV6 B;  3C1C D;  3REH C;  1KX5 B;  3X1U B;  3AFA A;  1BFM A;  3UTB A;  5AVB D;  4ZUX C;  4WU9 A;  2NZD C;  5KDM B;  2PYO B;  5FUG B;  4YM6 D;  4E44 A;  4KGC B;  5CP6 A;  3X1T A;  2HUE C;  1ZLA C;  2CWE A;  3AZM B;  1ID3 B;  3W99 A;  3AZL A;  2F8N A;  5GSU C;  4KUD C;  1P34 B;  3KWQ D;  3B6F A;  1BH9 A;  5AY8 D;  4LD9 A;  3MGQ D;  3AN2 C;  3AYW D;  3WKJ D;  3REI C;  1P3B C;  3REH A;  3AZG C;  3AFA B;  5AV5 D;  4ZUX A;  5CPK D;  1EQZ D;  2NZD A;  3AZK B;  3MNN D;  3LJA D;  3REK D;  3AZJ B;  3A6N B;  2RVQ C;  3MGR B;  5JRG D;  1M18 D;  1ZLA A;  2FJ7 D;  5CPJ D;  1F66 C;  5GT3 C;  5GSU A;  5B2I B;  1P3G B; 
#chains in the Genus database with same CATH topology
 2BYK A;  1M19 B;  4J8U C;  3MGS C;  4H9R A;  3KXB D;  3VH6 W;  3EPK A;  3AN2 A;  3REI A;  1P3B A;  3AZG A;  2NQB B;  2VQR A;  1HQ3 D;  2CV5 B;  3MGQ B;  3WKJ B;  3AYW B;  4QLC C;  3UT9 C;  4J8X B;  4Z2M H;  3TU4 B;  4YS3 B;  4J8W C;  4ZBJ C;  5CPK B;  3X1V C;  3W98 D;  4H9P A;  1F66 A;  5GT3 A;  5JRG B;  1M18 B;  5B0Y B;  1P3P B;  3NQJ B;  2FJ7 B;  5AV8 D;  1B67 A;  4J8U A;  3MGS A;  5B2J D;  4XZQ C;  3AZH D;  3AZI B;  5E5A C;  3MVD D;  1KX3 B;  5GXQ B;  1P3L D;  3C1B D;  4Z5T C;  5F99 C;  4QLC A;  3UT9 A;  3V9R B;  3REJ B;  5AV6 C;  3REL D;  5CPI D;  4J8W A;  3X1U C;  1WWS A;  3AZF B;  1KX5 C;  2F8N K;  3X1V A;  2G5H C;  2HIO D;  2IO5 B;  5DNM D;  4KGC C;  5B0Z D;  3WA9 D;  1S32 D;  5GT0 C;  3AZM C;  1ID3 C;  5B32 G;  4XZQ A;  3MGP D;  5B1L D;  5E5A A;  1P34 C;  1M1A D;  5AV9 D;  4Z5T A;  5F99 A;  3UTA D;  5DNN B;  5AV6 A;  5B31 G;  3EPJ A;  3AFA C;  3X1U A;  1KX5 A;  1AOI D;  3AZK C;  4H9N B;  4H9O B;  5KDM A;  1P3O B;  5FUG A;  2PYO A;  3AZJ C;  2Y2Q A;  4KGC A;  3A6N C;  3MGR C;  3B0B A;  2Y2L A;  3WAA D;  4Z66 D;  3AZM A;  1W2E A;  3AZE D;  1ID3 A;  3WA9 B;  3LZ1 D;  4EO5 B;  5B2I C;  1P3G C;  1P34 A;  1N1J B;  4XUJ D;  1M19 C;  2ARO D;  3IP4 C;  3AV1 D;  1P3I D;  1P3M B;  1Q9C A;  5B24 D;  2YFV B;  1M1A B;  3KUY D;  3AZN D;  4CAY B;  5AV9 B;  2NQB C;  5BT1 D;  4R8P B;  3UTA B;  3AZK A;  3R45 B;  3MGQ C;  2CV5 C;  3AYW C;  3WKJ C;  4J8X C;  3TU4 C;  3WTP D;  4YS3 C;  3AZJ A;  3A6N A;  3MGR A;  1AOI B;  5CPK C;  1JFI B;  4H9Q B;  2L5A A;  5JRG C;  1M18 C;  5B0Y C;  3UTB D;  1P3P C;  2FJ7 C;  5B2I A;  1P3G A;  3WAA B;  1M19 A;  4Z66 B;  2UWX A;  3X1S B;  3AZE B;  4X23 B;  4UUZ B;  3AZI C;  1KX3 C;  4XUJ B;  5GXQ C;  2NQB A;  4G92 B;  4Z2M G;  1P3F B;  4NE6 A;  2CV5 A;  3MGQ A;  3WKJ A;  3AYW A;  1BH8 B;  3W99 D;  5B40 D;  4J8X A;  3C1C B;  3REJ C;  5B33 D;  3TU4 A;  3AZL D;  3AZN B;  3VH5 T;  5BS7 C;  1ULY A;  3AZF C;  4YS3 A;  2Y2O A;  5AVB B;  5CPK A;  3B6F D;  2JCH A;  5BO0 B;  4YM6 B;  3WTP B;  3REH D;  5JRG A;  1M18 A;  5B0Y A;  1P3P A;  2DQN C;  3NQJ A;  2FJ7 A;  4E45 A;  3AV2 D;  4DRA A;  3H0R C;  4KUD A;  3B0C T;  3AZI A;  4UPK A;  1KX3 A;  3KWQ B;  3W97 D;  5GXQ A;  1ZLA D;  3LEL D;  5AY8 B;  1U35 D;  5DNN C;  3V9R A;  3REJ A;  5JA4 B;  1P3K D;  2ZM5 A;  5AV5 B;  5BS7 A;  5GSU D;  3AZF A;  3LZ0 D;  1EQZ B;  4WNN B;  1P3O C;  3MNN B;  5B40 B;  3LJA B;  5B32 D;  3REK B;  5B33 B;  3H0L C;  3AN2 D;  3REI D;  1P3B D;  1TZY D;  3AZG D;  5B1M D;  2F8N G;  1TAF B;  3O62 D;  5CPJ B;  3WA9 C;  5B31 D;  5BNV B;  2Y2I A;  4NE3 A;  4EO5 C;  3AV2 B;  4KHA B;  3KXB B;  1P3A D;  1F66 D;  5GT3 D;  2G5I C;  5DNN A;  1P3M C;  4WU8 D;  3W97 B;  1M1A C;  5AV9 C;  3LEL B;  1U35 B;  4R8P C;  1HQ3 B;  4J8U D;  2JSS A;  3MGS D;  3FDD A;  4H9O A;  4H9N A;  1P3O A;  2PYO C;  1P3K B;  1B6W A;  3LZ0 B;  2RIQ A;  3W98 B;  5B32 B;  2F8N H;  3UT9 D;  1TZY B;  3WA9 A;  5B1M B;  3B6G D;  4CSR B;  3O62 B;  5AV8 B;  3X1V D;  3WAA C;  1N1J A;  4Z66 C;  5B2J B;  3AZE C;  3X1S C;  1T3U A;  5B31 B;  1H3O B;  3AZH B;  4X23 C;  1P3M A;  3MVD B;  2YFV A;  1M1A A;  4XUJ C;  1P3L B;  4CAY A;  5AV9 A;  3C1B B;  4G92 C;  1P3A B;  1KU5 A;  2FFF B;  4R8P A;  1P3F C;  3UTA A;  3R45 A;  1KX4 D;  1F1E A;  4WU8 B;  2Y2M A;  3C1C C;  3REL B;  5CPI B;  4JJN D;  3AZN C;  5E5A D;  5AVB C;  5BT1 C;  1AOI A;  1JFI A;  2HIO B;  4J8V D;  4YM6 C;  1PZR A;  5AVC D;  3WTP C;  5DNM B;  3EPH A;  5B0Z B;  4H9Q A;  5AV6 D;  3X1U D;  2LY8 A;  1S32 B;  3WAA A;  5G49 B;  4Z66 A;  3AZE A;  3X1S A;  3MGP B;  3B6G B;  4KGC D;  2BG1 A;  5B1L B;  4X23 A;  4UUZ A;  2YFW B;  3KWQ C;  4XUJ A;  5GT0 D;  2Y2N A;  1P3F A;  5AY8 C;  2Y2J A;  1BH8 A;  3C1C A;  3AZN A;  5AV5 C;  5AVB A;  1P34 D;  1EQZ C;  5BO0 A;  1KX4 B;  3W96 D;  4YM6 A;  3MNN C;  3LJA C;  3A1K A;  3REK C;  4JJN B;  3VH5 W;  3WTP A;  5B33 C;  2Y2H A;  5C3I B;  2BYM B;  5BNX B;  2ZY3 A;  3AFA D;  4J8V B;  3NQU B;  4WU9 D;  2W8S A;  5CPJ C;  3AZK D;  5AVC B;  3LZ1 B;  3AZJ D;  3A6N D;  2ZY4 A;  5CP6 D;  3X1T D;  3MGR D;  3KWQ A;  3AV2 C;  2ARO B;  3AV1 B;  3KXB C;  1P3I B;  5AY8 A;  3EG5 B;  3B0C W;  5B24 B;  5JA4 A;  3KUY B;  2F8N D;  3W97 C;  4G91 B;  5AV5 A;  4HGA B;  5GT0 B;  5B2I D;  2XD1 A;  3LEL C;  1P3G D;  1U35 C;  1M19 D;  1HQ3 C;  4WNN A;  1EQZ A;  3MNN A;  2IO5 C;  5B40 A;  3LJA A;  3REK A;  1P3K C;  5B33 A;  4LD9 D;  3LZ0 C;  2NQB D;  2Y2K A;  1TAF A;  3B0D B;  3W96 B;  4ZUX D;  3W98 C;  3VH5 A;  2NZD D;  5B32 C;  5CPJ A;  2CV5 D;  4J8X D;  1TZY C;  3TU4 D;  5B1M C;  4YS3 D;  3UTB B;  5BNV A;  4WU9 B;  3O62 C;  5AV8 C;  3AV2 A;  4KHA A;  5B2J C;  3KXB A;  4NFT A;  5B31 C;  5CP6 B;  3AZH C;  3X1T B;  3F6T A;  3MVD C;  3W97 A;  5B0Y D;  1P3P D;  1P3L C;  4KUD D;  3C1B C;  3LEL A;  1P3A C;  1U35 A;  1HQ3 A;  3W99 B;  4WU8 C;  3REL C;  1P3K A;  3AZL B;  5CPI C;  2F8N B;  3LZ0 A;  3AZI D;  1KX3 D;  3B6F B;  5GXQ D;  1BH9 B;  2HIO C;  3W98 A;  4LD9 B;  5B32 A;  4AWL B;  5DNM C;  3REJ D;  3REH B;  1A7W A;  1TZY A;  5B0Z C;  2Y2P A;  5B1M A;  3AZF D;  2RVQ D;  4CSR A;  4ZUX B;  3O62 A;  1S32 C;  5AV8 A;  2NZD B;  1Z2C B;  5B2J A;  2F2A C;  3MGP C;  3B6G C;  5B31 A;  1H3O A;  3AZH A;  5B1L C;  3MVD A;  2HUE B;  1ZLA B;  1P3L A;  3C1B A;  4NE5 A;  1P3A A;  3UTA C;  3VH6 T;  3WTP E;  4WU8 A;  3REL A;  5CPI A;  5GSU B;  4KUD B;  2BYK B;  1AOI C;  2HIO A;  1KX4 C;  4H9R B;  3A1I A;  3AN2 B;  4QLC D;  5DNN D;  5DNM A;  4WZS B;  4JJN C;  3REI B;  5C3I C;  5B0Z A;  3AZG B;  1P3B B;  4J8W D;  3VH6 A;  4J8V C;  2Y2G A;  4WV4 B;  1S32 A;  2ZY5 A;  5G49 A;  5AVC C;  1P3O D;  2J8P A;  3LZ1 C;  3MGP A;  3AL0 C;  3B6G A;  5B1L A;  2YFW A;  2ARO C;  4H9P B;  3AV1 C;  1P3I C;  1F66 B;  5GT3 B;  4XZQ D;  3EPL A;  5B24 C;  3KUY C;  4G91 C;  4M6B A;  4HGA C;  4J8U B;  3MGS B;  1KX4 A;  4Z5T D;  5F99 D;  4JJN A;  1P3M D;  2BYM A;  5BNX A;  1KX5 D;  3B0D C;  4J8V A;  3NQU A;  3W96 C;  4R8P D;  5AVC A;  4QLC B;  1R4V A;  3UT9 B;  1HTA A;  2PYO D;  4H9S C;  3LZ1 A;  4J8W B;  4ZBJ B;  3UTB C;  5CHL B;  4DRB A;  3X1V B;  4WU9 C;  2ARO A;  3AV1 A;  2XD5 A;  1P3I A;  3AZM D;  1WWI A;  1ID3 D;  5CP6 C;  3X1T C;  3KSY A;  5B24 A;  3KUY A;  5GT0 A;  4XZQ B;  3W99 C;  3X1S D;  5B40 C;  3AZL C;  4X23 D;  5E5A B;  3B6F C;  4Z5T B;  3P5J B;  3W96 A;  1P3F D;  5F99 B;  4LD9 C;  4AWL C;  4H9S A;  5AV6 B;  3C1C D;  3REH C;  1KX5 B;  3X1U B;  3AFA A;  1BFM A;  3UTB A;  5AVB D;  4ZUX C;  4WU9 A;  2NZD C;  5KDM B;  2PYO B;  5FUG B;  4YM6 D;  3KFU G;  4E44 A;  4KGC B;  5CP6 A;  3X1T A;  4WJ3 C;  2HUE C;  1ZLA C;  2CWE A;  3AZM B;  3H0M C;  1ID3 B;  3W99 A;  3AZL A;  2F8N A;  5GSU C;  4KUD C;  1P34 B;  3KWQ D;  3B6F A;  1BH9 A;  4DQY B;  2JE5 A;  5AY8 D;  4LD9 A;  3MGQ D;  3AN2 C;  3AYW D;  3WKJ D;  3REI C;  1P3B C;  3REH A;  2ZY2 A;  3AZG C;  3AFA B;  5AV5 D;  4ZUX A;  5CPK D;  1EQZ D;  2NZD A;  3AZK B;  2DF4 C;  3MNN D;  3LJA D;  3REK D;  3AZJ B;  3A6N B;  2RVQ C;  3MGR B;  5JRG D;  1M18 D;  1ZLA A;  2FJ7 D;  5CPJ D;  1F66 C;  5GT3 C;  5GSU A;  5B2I B;  1P3G B; 
#chains in the Genus database with same CATH homology
 2BYK A;  1M19 B;  4J8U C;  3MGS C;  4H9R A;  3KXB D;  3VH6 W;  3EPK A;  3AN2 A;  3REI A;  1P3B A;  3AZG A;  2NQB B;  2VQR A;  1HQ3 D;  2CV5 B;  3MGQ B;  3WKJ B;  3AYW B;  4QLC C;  3UT9 C;  4J8X B;  4Z2M H;  3TU4 B;  4YS3 B;  4J8W C;  4ZBJ C;  5CPK B;  3X1V C;  3W98 D;  4H9P A;  1F66 A;  5GT3 A;  5JRG B;  1M18 B;  5B0Y B;  1P3P B;  3NQJ B;  2FJ7 B;  5AV8 D;  1B67 A;  4J8U A;  3MGS A;  5B2J D;  4XZQ C;  3AZH D;  3AZI B;  5E5A C;  3MVD D;  1KX3 B;  5GXQ B;  1P3L D;  3C1B D;  4Z5T C;  5F99 C;  4QLC A;  3UT9 A;  3V9R B;  3REJ B;  5AV6 C;  3REL D;  5CPI D;  4J8W A;  3X1U C;  1WWS A;  3AZF B;  1KX5 C;  2F8N K;  3X1V A;  2G5H C;  2HIO D;  2IO5 B;  5DNM D;  4KGC C;  5B0Z D;  3WA9 D;  1S32 D;  5GT0 C;  3AZM C;  1ID3 C;  5B32 G;  4XZQ A;  3MGP D;  5B1L D;  5E5A A;  1P34 C;  1M1A D;  5AV9 D;  4Z5T A;  5F99 A;  3UTA D;  5DNN B;  5AV6 A;  5B31 G;  3EPJ A;  3AFA C;  3X1U A;  1KX5 A;  1AOI D;  3AZK C;  4H9N B;  4H9O B;  5KDM A;  1P3O B;  5FUG A;  2PYO A;  3AZJ C;  2Y2Q A;  4KGC A;  3A6N C;  3MGR C;  3B0B A;  2Y2L A;  3WAA D;  4Z66 D;  3AZM A;  1W2E A;  3AZE D;  1ID3 A;  3WA9 B;  3LZ1 D;  4EO5 B;  5B2I C;  1P3G C;  1P34 A;  1N1J B;  4XUJ D;  1M19 C;  2ARO D;  3IP4 C;  3AV1 D;  1P3I D;  1P3M B;  1Q9C A;  5B24 D;  2YFV B;  1M1A B;  3KUY D;  3AZN D;  4CAY B;  5AV9 B;  2NQB C;  5BT1 D;  4R8P B;  3UTA B;  3AZK A;  3R45 B;  3MGQ C;  2CV5 C;  3AYW C;  3WKJ C;  4J8X C;  3TU4 C;  3WTP D;  4YS3 C;  3AZJ A;  3A6N A;  3MGR A;  1AOI B;  5CPK C;  1JFI B;  4H9Q B;  2L5A A;  5JRG C;  1M18 C;  5B0Y C;  3UTB D;  1P3P C;  2FJ7 C;  5B2I A;  1P3G A;  3WAA B;  1M19 A;  4Z66 B;  2UWX A;  3X1S B;  3AZE B;  4X23 B;  4UUZ B;  3AZI C;  1KX3 C;  4XUJ B;  5GXQ C;  2NQB A;  4G92 B;  4Z2M G;  1P3F B;  4NE6 A;  2CV5 A;  3MGQ A;  3WKJ A;  3AYW A;  1BH8 B;  3W99 D;  5B40 D;  4J8X A;  3C1C B;  3REJ C;  5B33 D;  3TU4 A;  3AZL D;  3AZN B;  3VH5 T;  5BS7 C;  1ULY A;  3AZF C;  4YS3 A;  2Y2O A;  5AVB B;  5CPK A;  3B6F D;  2JCH A;  5BO0 B;  4YM6 B;  3WTP B;  3REH D;  5JRG A;  1M18 A;  5B0Y A;  1P3P A;  2DQN C;  3NQJ A;  2FJ7 A;  4E45 A;  3AV2 D;  4DRA A;  3H0R C;  4KUD A;  3B0C T;  3AZI A;  4UPK A;  1KX3 A;  3KWQ B;  3W97 D;  5GXQ A;  1ZLA D;  3LEL D;  5AY8 B;  1U35 D;  5DNN C;  3V9R A;  3REJ A;  5JA4 B;  1P3K D;  2ZM5 A;  5AV5 B;  5BS7 A;  5GSU D;  3AZF A;  3LZ0 D;  1EQZ B;  4WNN B;  1P3O C;  3MNN B;  5B40 B;  3LJA B;  5B32 D;  3REK B;  5B33 B;  3H0L C;  3AN2 D;  3REI D;  1P3B D;  1TZY D;  3AZG D;  5B1M D;  2F8N G;  1TAF B;  3O62 D;  5CPJ B;  3WA9 C;  5B31 D;  5BNV B;  2Y2I A;  4NE3 A;  4EO5 C;  3AV2 B;  4KHA B;  3KXB B;  1P3A D;  1F66 D;  5GT3 D;  2G5I C;  5DNN A;  1P3M C;  4WU8 D;  3W97 B;  1M1A C;  5AV9 C;  3LEL B;  1U35 B;  4R8P C;  1HQ3 B;  4J8U D;  2JSS A;  3MGS D;  3FDD A;  4H9O A;  4H9N A;  1P3O A;  2PYO C;  1P3K B;  1B6W A;  3LZ0 B;  2RIQ A;  3W98 B;  5B32 B;  2F8N H;  3UT9 D;  1TZY B;  3WA9 A;  5B1M B;  3B6G D;  4CSR B;  3O62 B;  5AV8 B;  3X1V D;  3WAA C;  1N1J A;  4Z66 C;  5B2J B;  3AZE C;  3X1S C;  1T3U A;  5B31 B;  1H3O B;  3AZH B;  4X23 C;  1P3M A;  3MVD B;  2YFV A;  1M1A A;  4XUJ C;  1P3L B;  4CAY A;  5AV9 A;  3C1B B;  4G92 C;  1P3A B;  1KU5 A;  2FFF B;  4R8P A;  1P3F C;  3UTA A;  3R45 A;  1KX4 D;  1F1E A;  4WU8 B;  2Y2M A;  3C1C C;  3REL B;  5CPI B;  4JJN D;  3AZN C;  5E5A D;  5AVB C;  5BT1 C;  1AOI A;  1JFI A;  2HIO B;  4J8V D;  4YM6 C;  1PZR A;  5AVC D;  3WTP C;  5DNM B;  3EPH A;  5B0Z B;  4H9Q A;  5AV6 D;  3X1U D;  2LY8 A;  1S32 B;  3WAA A;  5G49 B;  4Z66 A;  3AZE A;  3X1S A;  3MGP B;  3B6G B;  4KGC D;  2BG1 A;  5B1L B;  4X23 A;  4UUZ A;  2YFW B;  3KWQ C;  4XUJ A;  5GT0 D;  2Y2N A;  1P3F A;  5AY8 C;  2Y2J A;  1BH8 A;  3C1C A;  3AZN A;  5AV5 C;  5AVB A;  1P34 D;  1EQZ C;  5BO0 A;  1KX4 B;  3W96 D;  4YM6 A;  3MNN C;  3LJA C;  3A1K A;  3REK C;  4JJN B;  3VH5 W;  3WTP A;  5B33 C;  2Y2H A;  5C3I B;  2BYM B;  5BNX B;  2ZY3 A;  3AFA D;  4J8V B;  3NQU B;  4WU9 D;  2W8S A;  5CPJ C;  3AZK D;  5AVC B;  3LZ1 B;  3AZJ D;  3A6N D;  2ZY4 A;  5CP6 D;  3X1T D;  3MGR D;  3KWQ A;  3AV2 C;  2ARO B;  3AV1 B;  3KXB C;  1P3I B;  5AY8 A;  3EG5 B;  3B0C W;  5B24 B;  5JA4 A;  3KUY B;  2F8N D;  3W97 C;  4G91 B;  5AV5 A;  4HGA B;  5GT0 B;  5B2I D;  2XD1 A;  3LEL C;  1P3G D;  1U35 C;  1M19 D;  1HQ3 C;  4WNN A;  1EQZ A;  3MNN A;  2IO5 C;  5B40 A;  3LJA A;  3REK A;  1P3K C;  5B33 A;  4LD9 D;  3LZ0 C;  2NQB D;  2Y2K A;  1TAF A;  3B0D B;  3W96 B;  4ZUX D;  3W98 C;  3VH5 A;  2NZD D;  5B32 C;  5CPJ A;  2CV5 D;  4J8X D;  1TZY C;  3TU4 D;  5B1M C;  4YS3 D;  3UTB B;  5BNV A;  4WU9 B;  3O62 C;  5AV8 C;  3AV2 A;  4KHA A;  5B2J C;  3KXB A;  4NFT A;  5B31 C;  5CP6 B;  3AZH C;  3X1T B;  3F6T A;  3MVD C;  3W97 A;  5B0Y D;  1P3P D;  1P3L C;  4KUD D;  3C1B C;  3LEL A;  1P3A C;  1U35 A;  1HQ3 A;  3W99 B;  4WU8 C;  3REL C;  1P3K A;  3AZL B;  5CPI C;  2F8N B;  3LZ0 A;  3AZI D;  1KX3 D;  3B6F B;  5GXQ D;  1BH9 B;  2HIO C;  3W98 A;  4LD9 B;  5B32 A;  4AWL B;  5DNM C;  3REJ D;  3REH B;  1A7W A;  1TZY A;  5B0Z C;  2Y2P A;  5B1M A;  3AZF D;  2RVQ D;  4CSR A;  4ZUX B;  3O62 A;  1S32 C;  5AV8 A;  2NZD B;  1Z2C B;  5B2J A;  2F2A C;  3MGP C;  3B6G C;  5B31 A;  1H3O A;  3AZH A;  5B1L C;  3MVD A;  2HUE B;  1ZLA B;  1P3L A;  3C1B A;  4NE5 A;  1P3A A;  3UTA C;  3VH6 T;  3WTP E;  4WU8 A;  3REL A;  5CPI A;  5GSU B;  4KUD B;  2BYK B;  1AOI C;  2HIO A;  1KX4 C;  4H9R B;  3A1I A;  3AN2 B;  4QLC D;  5DNN D;  5DNM A;  4WZS B;  4JJN C;  3REI B;  5C3I C;  5B0Z A;  3AZG B;  1P3B B;  4J8W D;  3VH6 A;  4J8V C;  2Y2G A;  4WV4 B;  1S32 A;  2ZY5 A;  5G49 A;  5AVC C;  1P3O D;  2J8P A;  3LZ1 C;  3MGP A;  3AL0 C;  3B6G A;  5B1L A;  2YFW A;  2ARO C;  4H9P B;  3AV1 C;  1P3I C;  1F66 B;  5GT3 B;  4XZQ D;  3EPL A;  5B24 C;  3KUY C;  4G91 C;  4M6B A;  4HGA C;  4J8U B;  3MGS B;  1KX4 A;  4Z5T D;  5F99 D;  4JJN A;  1P3M D;  2BYM A;  5BNX A;  1KX5 D;  3B0D C;  4J8V A;  3NQU A;  3W96 C;  4R8P D;  5AVC A;  4QLC B;  1R4V A;  3UT9 B;  1HTA A;  2PYO D;  4H9S C;  3LZ1 A;  4J8W B;  4ZBJ B;  3UTB C;  5CHL B;  4DRB A;  3X1V B;  4WU9 C;  2ARO A;  3AV1 A;  2XD5 A;  1P3I A;  3AZM D;  1WWI A;  1ID3 D;  5CP6 C;  3X1T C;  3KSY A;  5B24 A;  3KUY A;  5GT0 A;  4XZQ B;  3W99 C;  3X1S D;  5B40 C;  3AZL C;  4X23 D;  5E5A B;  3B6F C;  4Z5T B;  3P5J B;  3W96 A;  1P3F D;  5F99 B;  4LD9 C;  4AWL C;  4H9S A;  5AV6 B;  3C1C D;  3REH C;  1KX5 B;  3X1U B;  3AFA A;  1BFM A;  3UTB A;  5AVB D;  4ZUX C;  4WU9 A;  2NZD C;  5KDM B;  2PYO B;  5FUG B;  4YM6 D;  3KFU G;  4E44 A;  4KGC B;  5CP6 A;  3X1T A;  4WJ3 C;  2HUE C;  1ZLA C;  2CWE A;  3AZM B;  3H0M C;  1ID3 B;  3W99 A;  3AZL A;  2F8N A;  5GSU C;  4KUD C;  1P34 B;  3KWQ D;  3B6F A;  1BH9 A;  4DQY B;  2JE5 A;  5AY8 D;  4LD9 A;  3MGQ D;  3AN2 C;  3AYW D;  3WKJ D;  3REI C;  1P3B C;  3REH A;  2ZY2 A;  3AZG C;  3AFA B;  5AV5 D;  4ZUX A;  5CPK D;  1EQZ D;  2NZD A;  3AZK B;  2DF4 C;  3MNN D;  3LJA D;  3REK D;  3AZJ B;  3A6N B;  2RVQ C;  3MGR B;  5JRG D;  1M18 D;  1ZLA A;  2FJ7 D;  5CPJ D;  1F66 C;  5GT3 C;  5GSU A;  5B2I B;  1P3G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...