4KGCB

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcB00
5DNMB 5AV8B 5FUGB 5KDMB 1P3IB 1ULYA 3LJAD 1AOIA 2NQBB 4EO5C 5F99B 4HGAC 5CP6C 3AZEC 5DNMA 3REHB 1KX3B 5AVCB 5F99A 3KWQD 1WWIA 3REHA 1F66C 1P3OC 3W99B 3B6GC 3MGSC 4Z2MH 4KHAB 5GT0B 3O62D 4J8XC 3LELC 1M18B 2CV5A 5B32A 3MGQA 5B33A 3REIB 3AZGA 4JJNB 4J8VD 3REJB 2HUEC 4YS3D 3WTPE 1P34D 5AV6C 3UTAB 4NE6A 5AY8C 5B0YA 5CPKA 4JJNA 1KX4D 5CP6D 4XUJB 3MVDD 3AZED 3V9RA 1ID3B 1H3OB 3RELD 4Z66B 5B2JB 3B0DC 5B1LC 3AZIC 4XUJA 1P3KD 4LD9B 1P3PC 1H3OA 3W98C 4EO5B 2HIOD 5B2JA 3B6GD 3MGSD 1U35A 5B40D 5CPIA 4ZUXB 3AFAA 3WAAC 3LELD 3WKJA 1KU5A 1TAFA 1P3LA 5B24B 4ZUXA 1M1AC 4NE3A 5AV6D 5B24A 5AY8D 5AV9A 3MNNC 4KUDA 4NE5A 5C3IB 3LZ1A 4WU9D 4KGCB 3UT9A 2HUEB 3VH5A 5AV5C 3WTPA 2IO5B 4KGCA 3WA9A 1P3PD 5B2IC 2RVQC 5GXQA 3AZKB 3KXBC 1P3BC 1WWSA 3AZHD 3AZKA 3WAAD 3AZIB 5B1LB 3MGPA 4H9SA 1AOIC 5B0ZB 4YM6A 4J8UD 1P3GA 3W98B 5B31G 5DNNA 5DNMC 4WU8B 5AV8C 5GSUB 1P3IC 5B0ZA 4QLCD 5F99C 3MNND 3MGRD 3REHC 4XZQB 5BS7A 5GSUA 5B31B 5BT1C 1EQZD 4XZQA 3C1CA 5B31A 3C1BA 3VH5T 3NQUA 2F8NG 5GT0C 5B32C 3MGQC 4ZBJC 4J8WD 2AROA 3KXBD 1P3AB 1P3BD 4NFTA 4UUZB 3REIC 1P3MD 4E44A 4JJNC 2F8NB 3REJC 5CPJA 4UUZA 5B2IB 1AOID 1P3FD 3LZ0A 3AYWB 1JFIA 1M19B 4X23A 5DNMD 3AZFA 5BO0B 5AV8D 3REKA 5BNXB 3B0BA 5BNVB 1P3ID 2NQBD 3W97B 5F99D 3AYWA 4XUJC 1TZYA 4Z2MG 5AVBD 3W97A 3AZJB 1KX3D 5AVCD 1ID3C 3B0CT 5BT1D 5B2JC 4Z66C 3A6NA 4LD9C 1S32A 3X1TA 3AZNA 3AZJA 3AFAC 3W99D 3WKJC 5GT0D 1P3LC 1BH9A 4ZUXC 1M18D 5B32G 1KX5A 5B24C 3REID 5AV9C 2FJ7A 3X1SA 3REJD 2CV5B 3UTAD 5B32B 3MGQB 4ZBJB 5B33B 3AZGB 3X1VA 4WV4B 5C3IC 3WTPC 3VH6A 4XUJD 5B0YB 3WA9C 5E5AA 4KGCC 5CPKB 1ID3D 2F8NK 1B6WA 4Z66D 3AZMA 2IO5C 5GT3A 4LD9D 3V9RB 5B1MB 2PYOB 1HQ3A 3AZKC 3MGPC 3B6FA 5B1MA 2PYOA 4YM6C 3LJAA 5DNNC 1F66D 1U35B 5B0ZC 3AN2B 5B24D 5CPIB 1P3OD 3W96B 3AFAB 3WKJB 3KUYB 4WU8C 3AV2B 3KWQA 5GSUC 3AN2A 1TAFB 1P3LB 3W96A 4J8XD 3X1UB 3KUYA 3AV2A 4XZQC 3C1CC 5B31C 3C1BC 4Z5TB 4KGCD 5AV9B 3X1UA 4KUDB 3O62A 2BYMB 3VH6T 2CWEA 3KSYA 3LZ1B 4Z5TA 2AROC 2BYMA 3UT9B 4J8VA 4CSRB 3WTPB 4YS3A 3TU4B 3NQJA 4R8PB 1P3AC 1P34A 3AZLB 3WA9B 3MVDB 5JA4B 3LZ0C 1KX4A 4CSRA 5GXQB 3TU4A 3AZID 5B1LD 5G49A 4R8PA 3RELB 2YFWA 3AZLA 2NZDB 5CP6A 5JA4A 3MVDA 5B0ZD 3AZEA 3W98D 3AYWC 1M19C 1TZYC 3RELA 4WU8D 3MGPB 3W97C 2NZDA 1P3KA 4E45A 4YM6B 3A6NC 1P3GB 4H9OA 1S32C 5DNNB 3X1TC 1A7WA 2HIOA 3AZJC 3AZNC 3B6GA 3MGSA 1ZLAB 5B40A 1M1AD 4WZSB 1ZLAA 1KX5C 3C1CB 2FJ7C 3C1BB 1P3AD 5AV6A 5AY8A 3NQUB 4H9NA 4WU9B 5AV5D 2F8ND 2AROB 2CV5C 4WU9A 5B2ID 2RVQD 3AYWD 1M19D 5B33C 5E5AC 3AZGC 2YFVA 5CPJB 1P3PA 4AWLB 3LZ0B 5B0YC 1JFIB 5GT3C 5CPKC 4X23B 3AZFB 3AZJD 3R45A 3REKB 1HQ3C 3AZHA 1TZYB 3B6FC 3WAAA 5B1MC 2PYOC 2BYKA 3A6NB 4J8UA 1S32B 3REHD 3X1TB 4CAYA 3AZNB 4DRAA 3UTBB 3VH5W 4QLCA 3KWQC 3MGRA 1U35C 3AN2C 5CPIC 1BH9B 3W96C 3UTBA 3KUYC 1EQZA 3AV2C 2CV5D 4H9QA 1KX5B 5B32D 3X1UC 5B33D 3MGQD 3AZGD 3X1SB 3O62C 3AV1B 2FJ7B 1BFMA 4J8WB 4Z5TC 5B0YD 3AV1A 5CPKD 4KUDC 4JJND 1P3MB 1BH8B 3X1VB 4WNNB 4J8WA 1P3BA 2F8NH 4YS3C 5JRGB 3LZ1C 5E5AB 1P3MA 1BH8A 3B0CW 4WNNA 2PYOD 3UT9C 1KX4C 5JRGA 3TU4C 3AZMB 4R8PC 1P3FA 5GT3B 3AZLC 3MVDC 5AV8A 1HQ3B 5AVBB 5FUGA 5KDMA 5GXQC 5B2JD 1P3IA 2NQBA 3RELC 2NZDC 3B6FB 1U35D 1P3KC 3AN2D 5CPID 5AVBA 3W96D 1KX3A 3AFAD 5AVCA 2LY8A 3WKJD 3LJAB 3KUYD 3AV2D 1HTAA 2HIOC 4H9SC 1P3LD 1P3GC 4ZUXD 3X1UD 5B40C 2JSSA 3W99A 3KWQB 4KHAA 1ZLAC 4Z5TD 5AV9D 5GT0A 4KUDD 5BS7C 1M18A 3LZ1D 4G92C 3REIA 3O62B 5CHLB 3UT9D 1F1EA 3REJA 3WTPD 3TU4D 4R8PD 3WA9D 3AZLD 3UTAA 4WU9C 4J8VB 5GXQD 4YS3B 3NQJB 1P34B 2NZDD 1ID3A 1KX4B 3AZKD 4H9RB 5G49B 4Z66A 2YFWB 3MGPD 5CPJC 4HGAB 5CP6B 4LD9A 4YM6D 3AZEB 4AWLC 1P3GD 1Q9CA 3AZHC 4X23C 5DNND 4H9RA 3AZFC 3REKC 1P3KB 1ZLAD 1F66B 4J8UC 1P3OB 4H9OB 1R4VA 2HIOB 5GSUD 3B6GB 3MGSB 1F66A 5B40B 4QLCC 1P3OA 3VH6W 4J8XB 4XZQD 3MGRC 3C1CD 3LELB 5B31D 3C1BD 3UTBC 1EQZC 4J8XA 3LELA 4M6BA 4G92B 2AROD 5AV6B 5AY8B 4H9NB 1N1JB 3AV1C 3X1SC 5CPJD 4J8WC 3LZ0D 1N1JA 4G91C 4X23D 3AZFD 1P3MC 3X1VC 3REKD 1B67A 2YFVB 3B0DB 1P3PB 5JRGC 1P3FC 1TZYD 3AZIA 5B1LA 3W97D 3R45B 2NQBC 3A6ND 3AZMC 3W98A 2L5AA 3AZHB 1S32D 3X1TD 3AZND 3WAAB 4DRBA 4WU8A 5AVBC 2BYKB 3UTBD 5AVCC 1KX3C 4J8UB 4CAYB 1M1AB 3LJAC 3W99C 4QLCB 3MNNB 1KX5D 3MGRB 1M1AA 2FJ7D 3X1SD 3AV1D 1EQZB 3MNNA 4H9QB 1M18C 5AV5B 3X1VD 1P3AA 5JRGD 5E5AD 3UTAC 5AV5A 2F8NA 3KXBB 1P3BB 3AZMD 5B2IA 4G91B 5GT3D 4H9PB 1M19A 5BO0A 1HQ3D 3KXBA 4J8VC 5BNXA 5BNVA 1AOIB 4H9PA 1P34C 1P3FB 3B6FD 5B1MD
chains in the Genus database with same CATH superfamily
5DNMB 5AV8B 5FUGB 5KDMB 1P3IB 1ULYA 3LJAD 1AOIA 2NQBB 4EO5C 5F99B 4HGAC 5CP6C 3AZEC 5DNMA 3REHB 1KX3B 5AVCB 5F99A 3KWQD 1WWIA 3EG5B 3REHA 1F66C 1P3OC 3W99B 3B6GC 3MGSC 4Z2MH 4KHAB 3H0LC 5GT0B 3O62D 4J8XC 3LELC 1M18B 2CV5A 5B32A 3MGQA 5B33A 3REIB 3AZGA 4JJNB 4J8VD 3REJB 2HUEC 4YS3D 3WTPE 1P34D 5AV6C 3UTAB 4NE6A 5AY8C 5B0YA 5CPKA 4JJNA 1KX4D 5CP6D 4XUJB 3MVDD 3AZED 3V9RA 1ID3B 1H3OB 2Y2OA 3RELD 4Z66B 5B2JB 3B0DC 5B1LC 3AZIC 4XUJA 1P3KD 4LD9B 1P3PC 1H3OA 3W98C 4EO5B 2HIOD 5B2JA 3B6GD 3MGSD 3AL0C 1U35A 5B40D 5CPIA 4ZUXB 3AFAA 3WAAC 3LELD 3WKJA 1KU5A 2FFFB 1TAFA 1P3LA 5B24B 4ZUXA 1M1AC 4NE3A 5AV6D 5B24A 5AY8D 5AV9A 3MNNC 4KUDA 4NE5A 2ZM5A 5C3IB 3LZ1A 4WU9D 4KGCB 3UT9A 2HUEB 3VH5A 5AV5C 3WTPA 2IO5B 4KGCA 2W8SA 3WA9A 1P3PD 5B2IC 2RVQC 5GXQA 3AZKB 3KXBC 1P3BC 3EPJA 1WWSA 3AZHD 3A1IA 3AZKA 3WAAD 3AZIB 5B1LB 3H0RC 3MGPA 4H9SA 3P5JB 5B0ZB 4YM6A 4J8UD 1P3GA 1AOIC 3W98B 5B31G 5DNNA 5DNMC 4WU8B 5AV8C 5GSUB 1P3IC 5B0ZA 4QLCD 5F99C 3MNND 2UWXA 3MGRD 3REHC 4XZQB 5BS7A 5GSUA 5B31B 5BT1C 1EQZD 4XZQA 3C1CA 4UPKA 5B31A 3C1BA 3VH5T 2ZY4A 3NQUA 2F8NG 5GT0C 1W2EA 5B32C 3MGQC 4ZBJC 4J8WD 2AROA 3KXBD 1P3AB 1P3BD 4NFTA 4UUZB 3REIC 1P3MD 4E44A 4JJNC 2F8NB 3REJC 5CPJA 4UUZA 5B2IB 1AOID 1P3FD 3LZ0A 3EPHA 3AYWB 1JFIA 1M19B 2Y2HA 4X23A 5DNMD 3AZFA 5BO0B 5AV8D 3REKA 5BNXB 3B0BA 5BNVB 1P3ID 2NQBD 3W97B 5F99D 3AYWA 3KFUG 4XUJC 1TZYA 2G5HC 4Z2MG 5AVBD 3W97A 3AZJB 1KX3D 5AVCD 1ID3C 3B0CT 5BT1D 5B2JC 4Z66C 3A6NA 4LD9C 1S32A 3X1TA 3A1KA 3AZNA 3AZJA 3AFAC 3W99D 3WKJC 5GT0D 1P3LC 1BH9A 4ZUXC 1M18D 2ZY5A 5B32G 1KX5A 5B24C 3REID 5AV9C 2FJ7A 3X1SA 3REJD 2CV5B 2XD1A 2Y2KA 3UTAD 5B32B 3MGQB 4ZBJB 5B33B 3AZGB 3X1VA 4WV4B 5C3IC 3WTPC 3VH6A 4XUJD 5B0YB 3WA9C 5E5AA 4KGCC 5CPKB 1ID3D 2F8NK 1B6WA 2ZY3A 2XD5A 4Z66D 3AZMA 2IO5C 5GT3A 4LD9D 3V9RB 5B1MB 2PYOB 1HQ3A 3AZKC 3MGPC 3B6FA 5B1MA 2PYOA 4YM6C 3LJAA 5DNNC 3F6TA 1F66D 1U35B 5B0ZC 3AN2B 5B24D 5CPIB 1P3OD 3W96B 3AFAB 3WKJB 3KUYB 4WU8C 3AV2B 3KWQA 5GSUC 4DQYB 3AN2A 1TAFB 1P3LB 3W96A 4J8XD 3X1UB 3KUYA 2F2AC 3AV2A 4XZQC 3C1CC 5B31C 3C1BC 4Z5TB 4KGCD 5AV9B 3X1UA 4KUDB 3O62A 2BYMB 3VH6T 2Y2PA 2CWEA 3KSYA 3LZ1B 4Z5TA 2AROC 2Y2IA 2BYMA 3UT9B 4J8VA 4CSRB 3WTPB 4YS3A 3TU4B 3NQJA 4R8PB 1P3AC 1P34A 3AZLB 3WA9B 3MVDB 5JA4B 3LZ0C 1KX4A 4CSRA 5GXQB 3TU4A 3AZID 5B1LD 5G49A 4R8PA 3RELB 2YFWA 3AZLA 2NZDB 5CP6A 5JA4A 3MVDA 5B0ZD 3AZEA 3W98D 2Y2MA 3AYWC 1M19C 1TZYC 3RELA 4WU8D 3MGPB 3W97C 2NZDA 1P3KA 4E45A 4YM6B 3A6NC 1P3GB 4H9OA 1S32C 5DNNB 1Z2CB 1A7WA 2HIOA 3AZJC 3AZNC 3X1TC 3B6GA 3MGSA 1ZLAB 2DF4C 5B40A 1M1AD 4WZSB 1ZLAA 1KX5C 3C1CB 2JE5A 2FJ7C 3C1BB 1P3AD 5AV6A 5AY8A 3NQUB 4H9NA 4WU9B 5AV5D 2F8ND 2AROB 2CV5C 2BG1A 4WU9A 5B2ID 2RVQD 3AYWD 1M19D 5B33C 5E5AC 3AZGC 2YFVA 5CPJB 1P3PA 4AWLB 3LZ0B 5B0YC 1JFIB 5GT3C 5CPKC 4X23B 3AZFB 3AZJD 3R45A 3REKB 1HQ3C 3AZHA 1TZYB 3B6FC 3WAAA 5B1MC 2PYOC 2BYKA 3A6NB 4J8UA 1S32B 3REHD 3X1TB 4CAYA 3AZNB 4DRAA 3UTBB 3VH5W 2G5IC 4QLCA 3KWQC 3FDDA 3MGRA 1U35C 3AN2C 5CPIC 1BH9B 3W96C 1T3UA 2Y2LA 3UTBA 3KUYC 1EQZA 3AV2C 2CV5D 4H9QA 1KX5B 5B32D 3X1UC 5B33D 3MGQD 3AZGD 3X1SB 3O62C 3AV1B 2FJ7B 1BFMA 4J8WB 4Z5TC 5B0YD 3AV1A 5CPKD 4KUDC 4JJND 1P3MB 1BH8B 3X1VB 2JCHA 4WNNB 4J8WA 1P3BA 2F8NH 4YS3C 5JRGB 3LZ1C 5E5AB 1P3MA 1BH8A 3B0CW 4WNNA 2PYOD 3UT9C 2Y2JA 1KX4C 5JRGA 3TU4C 3AZMB 4R8PC 1P3FA 5GT3B 3AZLC 3MVDC 5AV8A 1HQ3B 5AVBB 5FUGA 5KDMA 5GXQC 5B2JD 1P3IA 2NQBA 3RELC 2NZDC 3B6FB 1U35D 1P3KC 2Y2GA 3AN2D 5CPID 5AVBA 2ZY2A 1KX3A 3AFAD 5AVCA 3W96D 2LY8A 3WKJD 3LJAB 3KUYD 3AV2D 1HTAA 2HIOC 4H9SC 1P3LD 1P3GC 4ZUXD 3X1UD 3EPLA 5B40C 2JSSA 3W99A 3KWQB 4KHAA 1ZLAC 4Z5TD 5AV9D 5GT0A 4KUDD 5BS7C 1M18A 3LZ1D 4G92C 3REIA 3O62B 5CHLB 2DQNC 3UT9D 1F1EA 3REJA 3WTPD 3TU4D 4R8PD 3WA9D 3AZLD 3UTAA 4WU9C 4J8VB 5GXQD 4YS3B 3NQJB 1P34B 2NZDD 1ID3A 1KX4B 4WJ3C 3AZKD 4H9RB 5G49B 4Z66A 2YFWB 3MGPD 5CPJC 4HGAB 5CP6B 4LD9A 4YM6D 3AZEB 4AWLC 1P3GD 1Q9CA 3AZHC 4X23C 5DNND 4H9RA 3AZFC 3REKC 1P3KB 1ZLAD 1F66B 4J8UC 1P3OB 4H9OB 1R4VA 2HIOB 5GSUD 3B6GB 3MGSB 1F66A 5B40B 4QLCC 1P3OA 3VH6W 4J8XB 4XZQD 3MGRC 3C1CD 3LELB 2Y2QA 5B31D 3C1BD 3UTBC 1EQZC 4J8XA 3LELA 4M6BA 4G92B 2AROD 5AV6B 5AY8B 4H9NB 1N1JB 3AV1C 3X1SC 2Y2NA 5CPJD 4J8WC 3LZ0D 1N1JA 2RIQA 4G91C 4X23D 3AZFD 1P3MC 3X1VC 3REKD 1B67A 2YFVB 3B0DB 1P3PB 5JRGC 1P3FC 1TZYD 1PZRA 3AZIA 5B1LA 3W97D 3R45B 2VQRA 2NQBC 3A6ND 3AZMC 3W98A 2L5AA 3AZHB 1S32D 3X1TD 3AZND 3WAAB 4DRBA 4WU8A 5AVBC 2BYKB 3UTBD 5AVCC 1KX3C 4J8UB 4CAYB 1M1AB 3LJAC 3W99C 4QLCB 3MNNB 3H0MC 1KX5D 3MGRB 1M1AA 2FJ7D 3X1SD 3AV1D 1EQZB 3MNNA 4H9QB 1M18C 5AV5B 3X1VD 1P3AA 5JRGD 5E5AD 3UTAC 5AV5A 2F8NA 3KXBB 1P3BB 3AZMD 5B2IA 4G91B 5GT3D 4H9PB 3IP4C 1M19A 5BO0A 1HQ3D 3KXBA 4J8VC 5BNXA 5BNVA 1AOIB 4H9PA 1P34C 1P3FB 3B6FD 2J8PA 3EPKA 5B1MD
chains in the Genus database with same CATH topology
5DNMB 5AV8B 5FUGB 5KDMB 1P3IB 1ULYA 3LJAD 1AOIA 2NQBB 4EO5C 5F99B 4HGAC 5CP6C 3AZEC 5DNMA 3REHB 1KX3B 5AVCB 5F99A 3KWQD 1WWIA 3EG5B 3REHA 1F66C 1P3OC 3W99B 3B6GC 3MGSC 4Z2MH 4KHAB 3H0LC 5GT0B 3O62D 4J8XC 3LELC 1M18B 2CV5A 5B32A 3MGQA 5B33A 3REIB 3AZGA 4JJNB 4J8VD 3REJB 2HUEC 4YS3D 3WTPE 1P34D 5AV6C 3UTAB 4NE6A 5AY8C 5B0YA 5CPKA 4JJNA 1KX4D 5CP6D 4XUJB 3MVDD 3AZED 3V9RA 1ID3B 1H3OB 2Y2OA 3RELD 4Z66B 5B2JB 3B0DC 5B1LC 3AZIC 4XUJA 1P3KD 4LD9B 1P3PC 1H3OA 3W98C 4EO5B 2HIOD 5B2JA 3B6GD 3MGSD 3AL0C 1U35A 5B40D 5CPIA 4ZUXB 3AFAA 3WAAC 3LELD 3WKJA 1KU5A 2FFFB 1TAFA 1P3LA 5B24B 4ZUXA 1M1AC 4NE3A 5AV6D 5B24A 5AY8D 5AV9A 3MNNC 4KUDA 4NE5A 2ZM5A 5C3IB 3LZ1A 4WU9D 4KGCB 3UT9A 2HUEB 3VH5A 5AV5C 3WTPA 2IO5B 4KGCA 2W8SA 3WA9A 1P3PD 5B2IC 2RVQC 5GXQA 3AZKB 3KXBC 1P3BC 3EPJA 1WWSA 3AZHD 3A1IA 3AZKA 3WAAD 3AZIB 5B1LB 3H0RC 3MGPA 4H9SA 3P5JB 5B0ZB 4YM6A 4J8UD 1P3GA 1AOIC 3W98B 5B31G 5DNNA 5DNMC 4WU8B 5AV8C 5GSUB 1P3IC 5B0ZA 4QLCD 5F99C 3MNND 2UWXA 3MGRD 3REHC 4XZQB 5BS7A 5GSUA 5B31B 5BT1C 1EQZD 4XZQA 3C1CA 4UPKA 5B31A 3C1BA 3VH5T 2ZY4A 3NQUA 2F8NG 5GT0C 1W2EA 5B32C 3MGQC 4ZBJC 4J8WD 2AROA 3KXBD 1P3AB 1P3BD 4NFTA 4UUZB 3REIC 1P3MD 4E44A 4JJNC 2F8NB 3REJC 5CPJA 4UUZA 5B2IB 1AOID 1P3FD 3LZ0A 3EPHA 3AYWB 1JFIA 1M19B 2Y2HA 4X23A 5DNMD 3AZFA 5BO0B 5AV8D 3REKA 5BNXB 3B0BA 5BNVB 1P3ID 2NQBD 3W97B 5F99D 3AYWA 3KFUG 4XUJC 1TZYA 2G5HC 4Z2MG 5AVBD 3W97A 3AZJB 1KX3D 5AVCD 1ID3C 3B0CT 5BT1D 5B2JC 4Z66C 3A6NA 4LD9C 1S32A 3X1TA 3A1KA 3AZNA 3AZJA 3AFAC 3W99D 3WKJC 5GT0D 1P3LC 1BH9A 4ZUXC 1M18D 2ZY5A 5B32G 1KX5A 5B24C 3REID 5AV9C 2FJ7A 3X1SA 3REJD 2CV5B 2XD1A 2Y2KA 3UTAD 5B32B 3MGQB 4ZBJB 5B33B 3AZGB 3X1VA 4WV4B 5C3IC 3WTPC 3VH6A 4XUJD 5B0YB 3WA9C 5E5AA 4KGCC 5CPKB 1ID3D 2F8NK 1B6WA 2ZY3A 2XD5A 4Z66D 3AZMA 2IO5C 5GT3A 4LD9D 3V9RB 5B1MB 2PYOB 1HQ3A 3AZKC 3MGPC 3B6FA 5B1MA 2PYOA 4YM6C 3LJAA 5DNNC 3F6TA 1F66D 1U35B 5B0ZC 3AN2B 5B24D 5CPIB 1P3OD 3W96B 3AFAB 3WKJB 3KUYB 4WU8C 3AV2B 3KWQA 5GSUC 4DQYB 3AN2A 1TAFB 1P3LB 3W96A 4J8XD 3X1UB 3KUYA 2F2AC 3AV2A 4XZQC 3C1CC 5B31C 3C1BC 4Z5TB 4KGCD 5AV9B 3X1UA 4KUDB 3O62A 2BYMB 3VH6T 2Y2PA 2CWEA 3KSYA 3LZ1B 4Z5TA 2AROC 2Y2IA 2BYMA 3UT9B 4J8VA 4CSRB 3WTPB 4YS3A 3TU4B 3NQJA 4R8PB 1P3AC 1P34A 3AZLB 3WA9B 3MVDB 5JA4B 3LZ0C 1KX4A 4CSRA 5GXQB 3TU4A 3AZID 5B1LD 5G49A 4R8PA 3RELB 2YFWA 3AZLA 2NZDB 5CP6A 5JA4A 3MVDA 5B0ZD 3AZEA 3W98D 2Y2MA 3AYWC 1M19C 1TZYC 3RELA 4WU8D 3MGPB 3W97C 2NZDA 1P3KA 4E45A 4YM6B 3A6NC 1P3GB 4H9OA 1S32C 5DNNB 1Z2CB 1A7WA 2HIOA 3AZJC 3AZNC 3X1TC 3B6GA 3MGSA 1ZLAB 2DF4C 5B40A 1M1AD 4WZSB 1ZLAA 1KX5C 3C1CB 2JE5A 2FJ7C 3C1BB 1P3AD 5AV6A 5AY8A 3NQUB 4H9NA 4WU9B 5AV5D 2F8ND 2AROB 2CV5C 2BG1A 4WU9A 5B2ID 2RVQD 3AYWD 1M19D 5B33C 5E5AC 3AZGC 2YFVA 5CPJB 1P3PA 4AWLB 3LZ0B 5B0YC 1JFIB 5GT3C 5CPKC 4X23B 3AZFB 3AZJD 3R45A 3REKB 1HQ3C 3AZHA 1TZYB 3B6FC 3WAAA 5B1MC 2PYOC 2BYKA 3A6NB 4J8UA 1S32B 3REHD 3X1TB 4CAYA 3AZNB 4DRAA 3UTBB 3VH5W 2G5IC 4QLCA 3KWQC 3FDDA 3MGRA 1U35C 3AN2C 5CPIC 1BH9B 3W96C 1T3UA 2Y2LA 3UTBA 3KUYC 1EQZA 3AV2C 2CV5D 4H9QA 1KX5B 5B32D 3X1UC 5B33D 3MGQD 3AZGD 3X1SB 3O62C 3AV1B 2FJ7B 1BFMA 4J8WB 4Z5TC 5B0YD 3AV1A 5CPKD 4KUDC 4JJND 1P3MB 1BH8B 3X1VB 2JCHA 4WNNB 4J8WA 1P3BA 2F8NH 4YS3C 5JRGB 3LZ1C 5E5AB 1P3MA 1BH8A 3B0CW 4WNNA 2PYOD 3UT9C 2Y2JA 1KX4C 5JRGA 3TU4C 3AZMB 4R8PC 1P3FA 5GT3B 3AZLC 3MVDC 5AV8A 1HQ3B 5AVBB 5FUGA 5KDMA 5GXQC 5B2JD 1P3IA 2NQBA 3RELC 2NZDC 3B6FB 1U35D 1P3KC 2Y2GA 3AN2D 5CPID 5AVBA 2ZY2A 1KX3A 3AFAD 5AVCA 3W96D 2LY8A 3WKJD 3LJAB 3KUYD 3AV2D 1HTAA 2HIOC 4H9SC 1P3LD 1P3GC 4ZUXD 3X1UD 3EPLA 5B40C 2JSSA 3W99A 3KWQB 4KHAA 1ZLAC 4Z5TD 5AV9D 5GT0A 4KUDD 5BS7C 1M18A 3LZ1D 4G92C 3REIA 3O62B 5CHLB 2DQNC 3UT9D 1F1EA 3REJA 3WTPD 3TU4D 4R8PD 3WA9D 3AZLD 3UTAA 4WU9C 4J8VB 5GXQD 4YS3B 3NQJB 1P34B 2NZDD 1ID3A 1KX4B 4WJ3C 3AZKD 4H9RB 5G49B 4Z66A 2YFWB 3MGPD 5CPJC 4HGAB 5CP6B 4LD9A 4YM6D 3AZEB 4AWLC 1P3GD 1Q9CA 3AZHC 4X23C 5DNND 4H9RA 3AZFC 3REKC 1P3KB 1ZLAD 1F66B 4J8UC 1P3OB 4H9OB 1R4VA 2HIOB 5GSUD 3B6GB 3MGSB 1F66A 5B40B 4QLCC 1P3OA 3VH6W 4J8XB 4XZQD 3MGRC 3C1CD 3LELB 2Y2QA 5B31D 3C1BD 3UTBC 1EQZC 4J8XA 3LELA 4M6BA 4G92B 2AROD 5AV6B 5AY8B 4H9NB 1N1JB 3AV1C 3X1SC 2Y2NA 5CPJD 4J8WC 3LZ0D 1N1JA 2RIQA 4G91C 4X23D 3AZFD 1P3MC 3X1VC 3REKD 1B67A 2YFVB 3B0DB 1P3PB 5JRGC 1P3FC 1TZYD 1PZRA 3AZIA 5B1LA 3W97D 3R45B 2VQRA 2NQBC 3A6ND 3AZMC 3W98A 2L5AA 3AZHB 1S32D 3X1TD 3AZND 3WAAB 4DRBA 4WU8A 5AVBC 2BYKB 3UTBD 5AVCC 1KX3C 4J8UB 4CAYB 1M1AB 3LJAC 3W99C 4QLCB 3MNNB 3H0MC 1KX5D 3MGRB 1M1AA 2FJ7D 3X1SD 3AV1D 1EQZB 3MNNA 4H9QB 1M18C 5AV5B 3X1VD 1P3AA 5JRGD 5E5AD 3UTAC 5AV5A 2F8NA 3KXBB 1P3BB 3AZMD 5B2IA 4G91B 5GT3D 4H9PB 3IP4C 1M19A 5BO0A 1HQ3D 3KXBA 4J8VC 5BNXA 5BNVA 1AOIB 4H9PA 1P34C 1P3FB 3B6FD 2J8PA 3EPKA 5B1MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM B;  5AV8 B;  5FUG B;  5KDM B;  1P3I B;  1ULY A;  3LJA D;  1AOI A;  2NQB B;  4EO5 C;  5F99 B;  4HGA C;  5CP6 C;  3AZE C;  5DNM A;  3REH B;  1KX3 B;  5AVC B;  5F99 A;  3KWQ D;  1WWI A;  3REH A;  1F66 C;  1P3O C;  3W99 B;  3B6G C;  3MGS C;  4Z2M H;  4KHA B;  5GT0 B;  3O62 D;  4J8X C;  3LEL C;  1M18 B;  2CV5 A;  5B32 A;  3MGQ A;  5B33 A;  3REI B;  3AZG A;  4JJN B;  4J8V D;  3REJ B;  2HUE C;  4YS3 D;  3WTP E;  1P34 D;  5AV6 C;  3UTA B;  4NE6 A;  5AY8 C;  5B0Y A;  5CPK A;  4JJN A;  1KX4 D;  5CP6 D;  4XUJ B;  3MVD D;  3AZE D;  3V9R A;  1ID3 B;  1H3O B;  3REL D;  4Z66 B;  5B2J B;  3B0D C;  5B1L C;  3AZI C;  4XUJ A;  1P3K D;  4LD9 B;  1P3P C;  1H3O A;  3W98 C;  4EO5 B;  2HIO D;  5B2J A;  3B6G D;  3MGS D;  1U35 A;  5B40 D;  5CPI A;  4ZUX B;  3AFA A;  3WAA C;  3LEL D;  3WKJ A;  1KU5 A;  1TAF A;  1P3L A;  5B24 B;  4ZUX A;  1M1A C;  4NE3 A;  5AV6 D;  5B24 A;  5AY8 D;  5AV9 A;  3MNN C;  4KUD A;  4NE5 A;  5C3I B;  3LZ1 A;  4WU9 D;  4KGC B;  3UT9 A;  2HUE B;  3VH5 A;  5AV5 C;  3WTP A;  2IO5 B;  4KGC A;  3WA9 A;  1P3P D;  5B2I C;  2RVQ C;  5GXQ A;  3AZK B;  3KXB C;  1P3B C;  1WWS A;  3AZH D;  3AZK A;  3WAA D;  3AZI B;  5B1L B;  3MGP A;  4H9S A;  1AOI C;  5B0Z B;  4YM6 A;  4J8U D;  1P3G A;  3W98 B;  5B31 G;  5DNN A;  5DNM C;  4WU8 B;  5AV8 C;  5GSU B;  1P3I C;  5B0Z A;  4QLC D;  5F99 C;  3MNN D;  3MGR D;  3REH C;  4XZQ B;  5BS7 A;  5GSU A;  5B31 B;  5BT1 C;  1EQZ D;  4XZQ A;  3C1C A;  5B31 A;  3C1B A;  3VH5 T;  3NQU A;  2F8N G;  5GT0 C;  5B32 C;  3MGQ C;  4ZBJ C;  4J8W D;  2ARO A;  3KXB D;  1P3A B;  1P3B D;  4NFT A;  4UUZ B;  3REI C;  1P3M D;  4E44 A;  4JJN C;  2F8N B;  3REJ C;  5CPJ A;  4UUZ A;  5B2I B;  1AOI D;  1P3F D;  3LZ0 A;  3AYW B;  1JFI A;  1M19 B;  4X23 A;  5DNM D;  3AZF A;  5BO0 B;  5AV8 D;  3REK A;  5BNX B;  3B0B A;  5BNV B;  1P3I D;  2NQB D;  3W97 B;  5F99 D;  3AYW A;  4XUJ C;  1TZY A;  4Z2M G;  5AVB D;  3W97 A;  3AZJ B;  1KX3 D;  5AVC D;  1ID3 C;  3B0C T;  5BT1 D;  5B2J C;  4Z66 C;  3A6N A;  4LD9 C;  1S32 A;  3X1T A;  3AZN A;  3AZJ A;  3AFA C;  3W99 D;  3WKJ C;  5GT0 D;  1P3L C;  1BH9 A;  4ZUX C;  1M18 D;  5B32 G;  1KX5 A;  5B24 C;  3REI D;  5AV9 C;  2FJ7 A;  3X1S A;  3REJ D;  2CV5 B;  3UTA D;  5B32 B;  3MGQ B;  4ZBJ B;  5B33 B;  3AZG B;  3X1V A;  4WV4 B;  5C3I C;  3WTP C;  3VH6 A;  4XUJ D;  5B0Y B;  3WA9 C;  5E5A A;  4KGC C;  5CPK B;  1ID3 D;  2F8N K;  1B6W A;  4Z66 D;  3AZM A;  2IO5 C;  5GT3 A;  4LD9 D;  3V9R B;  5B1M B;  2PYO B;  1HQ3 A;  3AZK C;  3MGP C;  3B6F A;  5B1M A;  2PYO A;  4YM6 C;  3LJA A;  5DNN C;  1F66 D;  1U35 B;  5B0Z C;  3AN2 B;  5B24 D;  5CPI B;  1P3O D;  3W96 B;  3AFA B;  3WKJ B;  3KUY B;  4WU8 C;  3AV2 B;  3KWQ A;  5GSU C;  3AN2 A;  1TAF B;  1P3L B;  3W96 A;  4J8X D;  3X1U B;  3KUY A;  3AV2 A;  4XZQ C;  3C1C C;  5B31 C;  3C1B C;  4Z5T B;  4KGC D;  5AV9 B;  3X1U A;  4KUD B;  3O62 A;  2BYM B;  3VH6 T;  2CWE A;  3KSY A;  3LZ1 B;  4Z5T A;  2ARO C;  2BYM A;  3UT9 B;  4J8V A;  4CSR B;  3WTP B;  4YS3 A;  3TU4 B;  3NQJ A;  4R8P B;  1P3A C;  1P34 A;  3AZL B;  3WA9 B;  3MVD B;  5JA4 B;  3LZ0 C;  1KX4 A;  4CSR A;  5GXQ B;  3TU4 A;  3AZI D;  5B1L D;  5G49 A;  4R8P A;  3REL B;  2YFW A;  3AZL A;  2NZD B;  5CP6 A;  5JA4 A;  3MVD A;  5B0Z D;  3AZE A;  3W98 D;  3AYW C;  1M19 C;  1TZY C;  3REL A;  4WU8 D;  3MGP B;  3W97 C;  2NZD A;  1P3K A;  4E45 A;  4YM6 B;  3A6N C;  1P3G B;  4H9O A;  1S32 C;  5DNN B;  3X1T C;  1A7W A;  2HIO A;  3AZJ C;  3AZN C;  3B6G A;  3MGS A;  1ZLA B;  5B40 A;  1M1A D;  4WZS B;  1ZLA A;  1KX5 C;  3C1C B;  2FJ7 C;  3C1B B;  1P3A D;  5AV6 A;  5AY8 A;  3NQU B;  4H9N A;  4WU9 B;  5AV5 D;  2F8N D;  2ARO B;  2CV5 C;  4WU9 A;  5B2I D;  2RVQ D;  3AYW D;  1M19 D;  5B33 C;  5E5A C;  3AZG C;  2YFV A;  5CPJ B;  1P3P A;  4AWL B;  3LZ0 B;  5B0Y C;  1JFI B;  5GT3 C;  5CPK C;  4X23 B;  3AZF B;  3AZJ D;  3R45 A;  3REK B;  1HQ3 C;  3AZH A;  1TZY B;  3B6F C;  3WAA A;  5B1M C;  2PYO C;  2BYK A;  3A6N B;  4J8U A;  1S32 B;  3REH D;  3X1T B;  4CAY A;  3AZN B;  4DRA A;  3UTB B;  3VH5 W;  4QLC A;  3KWQ C;  3MGR A;  1U35 C;  3AN2 C;  5CPI C;  1BH9 B;  3W96 C;  3UTB A;  3KUY C;  1EQZ A;  3AV2 C;  2CV5 D;  4H9Q A;  1KX5 B;  5B32 D;  3X1U C;  5B33 D;  3MGQ D;  3AZG D;  3X1S B;  3O62 C;  3AV1 B;  2FJ7 B;  1BFM A;  4J8W B;  4Z5T C;  5B0Y D;  3AV1 A;  5CPK D;  4KUD C;  4JJN D;  1P3M B;  1BH8 B;  3X1V B;  4WNN B;  4J8W A;  1P3B A;  2F8N H;  4YS3 C;  5JRG B;  3LZ1 C;  5E5A B;  1P3M A;  1BH8 A;  3B0C W;  4WNN A;  2PYO D;  3UT9 C;  1KX4 C;  5JRG A;  3TU4 C;  3AZM B;  4R8P C;  1P3F A;  5GT3 B;  3AZL C;  3MVD C;  5AV8 A;  1HQ3 B;  5AVB B;  5FUG A;  5KDM A;  5GXQ C;  5B2J D;  1P3I A;  2NQB A;  3REL C;  2NZD C;  3B6F B;  1U35 D;  1P3K C;  3AN2 D;  5CPI D;  5AVB A;  3W96 D;  1KX3 A;  3AFA D;  5AVC A;  2LY8 A;  3WKJ D;  3LJA B;  3KUY D;  3AV2 D;  1HTA A;  2HIO C;  4H9S C;  1P3L D;  1P3G C;  4ZUX D;  3X1U D;  5B40 C;  2JSS A;  3W99 A;  3KWQ B;  4KHA A;  1ZLA C;  4Z5T D;  5AV9 D;  5GT0 A;  4KUD D;  5BS7 C;  1M18 A;  3LZ1 D;  4G92 C;  3REI A;  3O62 B;  5CHL B;  3UT9 D;  1F1E A;  3REJ A;  3WTP D;  3TU4 D;  4R8P D;  3WA9 D;  3AZL D;  3UTA A;  4WU9 C;  4J8V B;  5GXQ D;  4YS3 B;  3NQJ B;  1P34 B;  2NZD D;  1ID3 A;  1KX4 B;  3AZK D;  4H9R B;  5G49 B;  4Z66 A;  2YFW B;  3MGP D;  5CPJ C;  4HGA B;  5CP6 B;  4LD9 A;  4YM6 D;  3AZE B;  4AWL C;  1P3G D;  1Q9C A;  3AZH C;  4X23 C;  5DNN D;  4H9R A;  3AZF C;  3REK C;  1P3K B;  1ZLA D;  1F66 B;  4J8U C;  1P3O B;  4H9O B;  1R4V A;  2HIO B;  5GSU D;  3B6G B;  3MGS B;  1F66 A;  5B40 B;  4QLC C;  1P3O A;  3VH6 W;  4J8X B;  4XZQ D;  3MGR C;  3C1C D;  3LEL B;  5B31 D;  3C1B D;  3UTB C;  1EQZ C;  4J8X A;  3LEL A;  4M6B A;  4G92 B;  2ARO D;  5AV6 B;  5AY8 B;  4H9N B;  1N1J B;  3AV1 C;  3X1S C;  5CPJ D;  4J8W C;  3LZ0 D;  1N1J A;  4G91 C;  4X23 D;  3AZF D;  1P3M C;  3X1V C;  3REK D;  1B67 A;  2YFV B;  3B0D B;  1P3P B;  5JRG C;  1P3F C;  1TZY D;  3AZI A;  5B1L A;  3W97 D;  3R45 B;  2NQB C;  3A6N D;  3AZM C;  3W98 A;  2L5A A;  3AZH B;  1S32 D;  3X1T D;  3AZN D;  3WAA B;  4DRB A;  4WU8 A;  5AVB C;  2BYK B;  3UTB D;  5AVC C;  1KX3 C;  4J8U B;  4CAY B;  1M1A B;  3LJA C;  3W99 C;  4QLC B;  3MNN B;  1KX5 D;  3MGR B;  1M1A A;  2FJ7 D;  3X1S D;  3AV1 D;  1EQZ B;  3MNN A;  4H9Q B;  1M18 C;  5AV5 B;  3X1V D;  1P3A A;  5JRG D;  5E5A D;  3UTA C;  5AV5 A;  2F8N A;  3KXB B;  1P3B B;  3AZM D;  5B2I A;  4G91 B;  5GT3 D;  4H9P B;  1M19 A;  5BO0 A;  1HQ3 D;  3KXB A;  4J8V C;  5BNX A;  5BNV A;  1AOI B;  4H9P A;  1P34 C;  1P3F B;  3B6F D;  5B1M D; 
#chains in the Genus database with same CATH topology
 5DNM B;  5AV8 B;  5FUG B;  5KDM B;  1P3I B;  1ULY A;  3LJA D;  1AOI A;  2NQB B;  4EO5 C;  5F99 B;  4HGA C;  5CP6 C;  3AZE C;  5DNM A;  3REH B;  1KX3 B;  5AVC B;  5F99 A;  3KWQ D;  1WWI A;  3EG5 B;  3REH A;  1F66 C;  1P3O C;  3W99 B;  3B6G C;  3MGS C;  4Z2M H;  4KHA B;  3H0L C;  5GT0 B;  3O62 D;  4J8X C;  3LEL C;  1M18 B;  2CV5 A;  5B32 A;  3MGQ A;  5B33 A;  3REI B;  3AZG A;  4JJN B;  4J8V D;  3REJ B;  2HUE C;  4YS3 D;  3WTP E;  1P34 D;  5AV6 C;  3UTA B;  4NE6 A;  5AY8 C;  5B0Y A;  5CPK A;  4JJN A;  1KX4 D;  5CP6 D;  4XUJ B;  3MVD D;  3AZE D;  3V9R A;  1ID3 B;  1H3O B;  2Y2O A;  3REL D;  4Z66 B;  5B2J B;  3B0D C;  5B1L C;  3AZI C;  4XUJ A;  1P3K D;  4LD9 B;  1P3P C;  1H3O A;  3W98 C;  4EO5 B;  2HIO D;  5B2J A;  3B6G D;  3MGS D;  3AL0 C;  1U35 A;  5B40 D;  5CPI A;  4ZUX B;  3AFA A;  3WAA C;  3LEL D;  3WKJ A;  1KU5 A;  2FFF B;  1TAF A;  1P3L A;  5B24 B;  4ZUX A;  1M1A C;  4NE3 A;  5AV6 D;  5B24 A;  5AY8 D;  5AV9 A;  3MNN C;  4KUD A;  4NE5 A;  2ZM5 A;  5C3I B;  3LZ1 A;  4WU9 D;  4KGC B;  3UT9 A;  2HUE B;  3VH5 A;  5AV5 C;  3WTP A;  2IO5 B;  4KGC A;  2W8S A;  3WA9 A;  1P3P D;  5B2I C;  2RVQ C;  5GXQ A;  3AZK B;  3KXB C;  1P3B C;  3EPJ A;  1WWS A;  3AZH D;  3A1I A;  3AZK A;  3WAA D;  3AZI B;  5B1L B;  3H0R C;  3MGP A;  4H9S A;  3P5J B;  5B0Z B;  4YM6 A;  4J8U D;  1P3G A;  1AOI C;  3W98 B;  5B31 G;  5DNN A;  5DNM C;  4WU8 B;  5AV8 C;  5GSU B;  1P3I C;  5B0Z A;  4QLC D;  5F99 C;  3MNN D;  2UWX A;  3MGR D;  3REH C;  4XZQ B;  5BS7 A;  5GSU A;  5B31 B;  5BT1 C;  1EQZ D;  4XZQ A;  3C1C A;  4UPK A;  5B31 A;  3C1B A;  3VH5 T;  2ZY4 A;  3NQU A;  2F8N G;  5GT0 C;  1W2E A;  5B32 C;  3MGQ C;  4ZBJ C;  4J8W D;  2ARO A;  3KXB D;  1P3A B;  1P3B D;  4NFT A;  4UUZ B;  3REI C;  1P3M D;  4E44 A;  4JJN C;  2F8N B;  3REJ C;  5CPJ A;  4UUZ A;  5B2I B;  1AOI D;  1P3F D;  3LZ0 A;  3EPH A;  3AYW B;  1JFI A;  1M19 B;  2Y2H A;  4X23 A;  5DNM D;  3AZF A;  5BO0 B;  5AV8 D;  3REK A;  5BNX B;  3B0B A;  5BNV B;  1P3I D;  2NQB D;  3W97 B;  5F99 D;  3AYW A;  3KFU G;  4XUJ C;  1TZY A;  2G5H C;  4Z2M G;  5AVB D;  3W97 A;  3AZJ B;  1KX3 D;  5AVC D;  1ID3 C;  3B0C T;  5BT1 D;  5B2J C;  4Z66 C;  3A6N A;  4LD9 C;  1S32 A;  3X1T A;  3A1K A;  3AZN A;  3AZJ A;  3AFA C;  3W99 D;  3WKJ C;  5GT0 D;  1P3L C;  1BH9 A;  4ZUX C;  1M18 D;  2ZY5 A;  5B32 G;  1KX5 A;  5B24 C;  3REI D;  5AV9 C;  2FJ7 A;  3X1S A;  3REJ D;  2CV5 B;  2XD1 A;  2Y2K A;  3UTA D;  5B32 B;  3MGQ B;  4ZBJ B;  5B33 B;  3AZG B;  3X1V A;  4WV4 B;  5C3I C;  3WTP C;  3VH6 A;  4XUJ D;  5B0Y B;  3WA9 C;  5E5A A;  4KGC C;  5CPK B;  1ID3 D;  2F8N K;  1B6W A;  2ZY3 A;  2XD5 A;  4Z66 D;  3AZM A;  2IO5 C;  5GT3 A;  4LD9 D;  3V9R B;  5B1M B;  2PYO B;  1HQ3 A;  3AZK C;  3MGP C;  3B6F A;  5B1M A;  2PYO A;  4YM6 C;  3LJA A;  5DNN C;  3F6T A;  1F66 D;  1U35 B;  5B0Z C;  3AN2 B;  5B24 D;  5CPI B;  1P3O D;  3W96 B;  3AFA B;  3WKJ B;  3KUY B;  4WU8 C;  3AV2 B;  3KWQ A;  5GSU C;  4DQY B;  3AN2 A;  1TAF B;  1P3L B;  3W96 A;  4J8X D;  3X1U B;  3KUY A;  2F2A C;  3AV2 A;  4XZQ C;  3C1C C;  5B31 C;  3C1B C;  4Z5T B;  4KGC D;  5AV9 B;  3X1U A;  4KUD B;  3O62 A;  2BYM B;  3VH6 T;  2Y2P A;  2CWE A;  3KSY A;  3LZ1 B;  4Z5T A;  2ARO C;  2Y2I A;  2BYM A;  3UT9 B;  4J8V A;  4CSR B;  3WTP B;  4YS3 A;  3TU4 B;  3NQJ A;  4R8P B;  1P3A C;  1P34 A;  3AZL B;  3WA9 B;  3MVD B;  5JA4 B;  3LZ0 C;  1KX4 A;  4CSR A;  5GXQ B;  3TU4 A;  3AZI D;  5B1L D;  5G49 A;  4R8P A;  3REL B;  2YFW A;  3AZL A;  2NZD B;  5CP6 A;  5JA4 A;  3MVD A;  5B0Z D;  3AZE A;  3W98 D;  2Y2M A;  3AYW C;  1M19 C;  1TZY C;  3REL A;  4WU8 D;  3MGP B;  3W97 C;  2NZD A;  1P3K A;  4E45 A;  4YM6 B;  3A6N C;  1P3G B;  4H9O A;  1S32 C;  5DNN B;  1Z2C B;  1A7W A;  2HIO A;  3AZJ C;  3AZN C;  3X1T C;  3B6G A;  3MGS A;  1ZLA B;  2DF4 C;  5B40 A;  1M1A D;  4WZS B;  1ZLA A;  1KX5 C;  3C1C B;  2JE5 A;  2FJ7 C;  3C1B B;  1P3A D;  5AV6 A;  5AY8 A;  3NQU B;  4H9N A;  4WU9 B;  5AV5 D;  2F8N D;  2ARO B;  2CV5 C;  2BG1 A;  4WU9 A;  5B2I D;  2RVQ D;  3AYW D;  1M19 D;  5B33 C;  5E5A C;  3AZG C;  2YFV A;  5CPJ B;  1P3P A;  4AWL B;  3LZ0 B;  5B0Y C;  1JFI B;  5GT3 C;  5CPK C;  4X23 B;  3AZF B;  3AZJ D;  3R45 A;  3REK B;  1HQ3 C;  3AZH A;  1TZY B;  3B6F C;  3WAA A;  5B1M C;  2PYO C;  2BYK A;  3A6N B;  4J8U A;  1S32 B;  3REH D;  3X1T B;  4CAY A;  3AZN B;  4DRA A;  3UTB B;  3VH5 W;  2G5I C;  4QLC A;  3KWQ C;  3FDD A;  3MGR A;  1U35 C;  3AN2 C;  5CPI C;  1BH9 B;  3W96 C;  1T3U A;  2Y2L A;  3UTB A;  3KUY C;  1EQZ A;  3AV2 C;  2CV5 D;  4H9Q A;  1KX5 B;  5B32 D;  3X1U C;  5B33 D;  3MGQ D;  3AZG D;  3X1S B;  3O62 C;  3AV1 B;  2FJ7 B;  1BFM A;  4J8W B;  4Z5T C;  5B0Y D;  3AV1 A;  5CPK D;  4KUD C;  4JJN D;  1P3M B;  1BH8 B;  3X1V B;  2JCH A;  4WNN B;  4J8W A;  1P3B A;  2F8N H;  4YS3 C;  5JRG B;  3LZ1 C;  5E5A B;  1P3M A;  1BH8 A;  3B0C W;  4WNN A;  2PYO D;  3UT9 C;  2Y2J A;  1KX4 C;  5JRG A;  3TU4 C;  3AZM B;  4R8P C;  1P3F A;  5GT3 B;  3AZL C;  3MVD C;  5AV8 A;  1HQ3 B;  5AVB B;  5FUG A;  5KDM A;  5GXQ C;  5B2J D;  1P3I A;  2NQB A;  3REL C;  2NZD C;  3B6F B;  1U35 D;  1P3K C;  2Y2G A;  3AN2 D;  5CPI D;  5AVB A;  2ZY2 A;  1KX3 A;  3AFA D;  5AVC A;  3W96 D;  2LY8 A;  3WKJ D;  3LJA B;  3KUY D;  3AV2 D;  1HTA A;  2HIO C;  4H9S C;  1P3L D;  1P3G C;  4ZUX D;  3X1U D;  3EPL A;  5B40 C;  2JSS A;  3W99 A;  3KWQ B;  4KHA A;  1ZLA C;  4Z5T D;  5AV9 D;  5GT0 A;  4KUD D;  5BS7 C;  1M18 A;  3LZ1 D;  4G92 C;  3REI A;  3O62 B;  5CHL B;  2DQN C;  3UT9 D;  1F1E A;  3REJ A;  3WTP D;  3TU4 D;  4R8P D;  3WA9 D;  3AZL D;  3UTA A;  4WU9 C;  4J8V B;  5GXQ D;  4YS3 B;  3NQJ B;  1P34 B;  2NZD D;  1ID3 A;  1KX4 B;  4WJ3 C;  3AZK D;  4H9R B;  5G49 B;  4Z66 A;  2YFW B;  3MGP D;  5CPJ C;  4HGA B;  5CP6 B;  4LD9 A;  4YM6 D;  3AZE B;  4AWL C;  1P3G D;  1Q9C A;  3AZH C;  4X23 C;  5DNN D;  4H9R A;  3AZF C;  3REK C;  1P3K B;  1ZLA D;  1F66 B;  4J8U C;  1P3O B;  4H9O B;  1R4V A;  2HIO B;  5GSU D;  3B6G B;  3MGS B;  1F66 A;  5B40 B;  4QLC C;  1P3O A;  3VH6 W;  4J8X B;  4XZQ D;  3MGR C;  3C1C D;  3LEL B;  2Y2Q A;  5B31 D;  3C1B D;  3UTB C;  1EQZ C;  4J8X A;  3LEL A;  4M6B A;  4G92 B;  2ARO D;  5AV6 B;  5AY8 B;  4H9N B;  1N1J B;  3AV1 C;  3X1S C;  2Y2N A;  5CPJ D;  4J8W C;  3LZ0 D;  1N1J A;  2RIQ A;  4G91 C;  4X23 D;  3AZF D;  1P3M C;  3X1V C;  3REK D;  1B67 A;  2YFV B;  3B0D B;  1P3P B;  5JRG C;  1P3F C;  1TZY D;  1PZR A;  3AZI A;  5B1L A;  3W97 D;  3R45 B;  2VQR A;  2NQB C;  3A6N D;  3AZM C;  3W98 A;  2L5A A;  3AZH B;  1S32 D;  3X1T D;  3AZN D;  3WAA B;  4DRB A;  4WU8 A;  5AVB C;  2BYK B;  3UTB D;  5AVC C;  1KX3 C;  4J8U B;  4CAY B;  1M1A B;  3LJA C;  3W99 C;  4QLC B;  3MNN B;  3H0M C;  1KX5 D;  3MGR B;  1M1A A;  2FJ7 D;  3X1S D;  3AV1 D;  1EQZ B;  3MNN A;  4H9Q B;  1M18 C;  5AV5 B;  3X1V D;  1P3A A;  5JRG D;  5E5A D;  3UTA C;  5AV5 A;  2F8N A;  3KXB B;  1P3B B;  3AZM D;  5B2I A;  4G91 B;  5GT3 D;  4H9P B;  3IP4 C;  1M19 A;  5BO0 A;  1HQ3 D;  3KXB A;  4J8V C;  5BNX A;  5BNV A;  1AOI B;  4H9P A;  1P34 C;  1P3F B;  3B6F D;  2J8P A;  3EPK A;  5B1M D; 
#chains in the Genus database with same CATH homology
 5DNM B;  5AV8 B;  5FUG B;  5KDM B;  1P3I B;  1ULY A;  3LJA D;  1AOI A;  2NQB B;  4EO5 C;  5F99 B;  4HGA C;  5CP6 C;  3AZE C;  5DNM A;  3REH B;  1KX3 B;  5AVC B;  5F99 A;  3KWQ D;  1WWI A;  3EG5 B;  3REH A;  1F66 C;  1P3O C;  3W99 B;  3B6G C;  3MGS C;  4Z2M H;  4KHA B;  3H0L C;  5GT0 B;  3O62 D;  4J8X C;  3LEL C;  1M18 B;  2CV5 A;  5B32 A;  3MGQ A;  5B33 A;  3REI B;  3AZG A;  4JJN B;  4J8V D;  3REJ B;  2HUE C;  4YS3 D;  3WTP E;  1P34 D;  5AV6 C;  3UTA B;  4NE6 A;  5AY8 C;  5B0Y A;  5CPK A;  4JJN A;  1KX4 D;  5CP6 D;  4XUJ B;  3MVD D;  3AZE D;  3V9R A;  1ID3 B;  1H3O B;  2Y2O A;  3REL D;  4Z66 B;  5B2J B;  3B0D C;  5B1L C;  3AZI C;  4XUJ A;  1P3K D;  4LD9 B;  1P3P C;  1H3O A;  3W98 C;  4EO5 B;  2HIO D;  5B2J A;  3B6G D;  3MGS D;  3AL0 C;  1U35 A;  5B40 D;  5CPI A;  4ZUX B;  3AFA A;  3WAA C;  3LEL D;  3WKJ A;  1KU5 A;  2FFF B;  1TAF A;  1P3L A;  5B24 B;  4ZUX A;  1M1A C;  4NE3 A;  5AV6 D;  5B24 A;  5AY8 D;  5AV9 A;  3MNN C;  4KUD A;  4NE5 A;  2ZM5 A;  5C3I B;  3LZ1 A;  4WU9 D;  4KGC B;  3UT9 A;  2HUE B;  3VH5 A;  5AV5 C;  3WTP A;  2IO5 B;  4KGC A;  2W8S A;  3WA9 A;  1P3P D;  5B2I C;  2RVQ C;  5GXQ A;  3AZK B;  3KXB C;  1P3B C;  3EPJ A;  1WWS A;  3AZH D;  3A1I A;  3AZK A;  3WAA D;  3AZI B;  5B1L B;  3H0R C;  3MGP A;  4H9S A;  3P5J B;  5B0Z B;  4YM6 A;  4J8U D;  1P3G A;  1AOI C;  3W98 B;  5B31 G;  5DNN A;  5DNM C;  4WU8 B;  5AV8 C;  5GSU B;  1P3I C;  5B0Z A;  4QLC D;  5F99 C;  3MNN D;  2UWX A;  3MGR D;  3REH C;  4XZQ B;  5BS7 A;  5GSU A;  5B31 B;  5BT1 C;  1EQZ D;  4XZQ A;  3C1C A;  4UPK A;  5B31 A;  3C1B A;  3VH5 T;  2ZY4 A;  3NQU A;  2F8N G;  5GT0 C;  1W2E A;  5B32 C;  3MGQ C;  4ZBJ C;  4J8W D;  2ARO A;  3KXB D;  1P3A B;  1P3B D;  4NFT A;  4UUZ B;  3REI C;  1P3M D;  4E44 A;  4JJN C;  2F8N B;  3REJ C;  5CPJ A;  4UUZ A;  5B2I B;  1AOI D;  1P3F D;  3LZ0 A;  3EPH A;  3AYW B;  1JFI A;  1M19 B;  2Y2H A;  4X23 A;  5DNM D;  3AZF A;  5BO0 B;  5AV8 D;  3REK A;  5BNX B;  3B0B A;  5BNV B;  1P3I D;  2NQB D;  3W97 B;  5F99 D;  3AYW A;  3KFU G;  4XUJ C;  1TZY A;  2G5H C;  4Z2M G;  5AVB D;  3W97 A;  3AZJ B;  1KX3 D;  5AVC D;  1ID3 C;  3B0C T;  5BT1 D;  5B2J C;  4Z66 C;  3A6N A;  4LD9 C;  1S32 A;  3X1T A;  3A1K A;  3AZN A;  3AZJ A;  3AFA C;  3W99 D;  3WKJ C;  5GT0 D;  1P3L C;  1BH9 A;  4ZUX C;  1M18 D;  2ZY5 A;  5B32 G;  1KX5 A;  5B24 C;  3REI D;  5AV9 C;  2FJ7 A;  3X1S A;  3REJ D;  2CV5 B;  2XD1 A;  2Y2K A;  3UTA D;  5B32 B;  3MGQ B;  4ZBJ B;  5B33 B;  3AZG B;  3X1V A;  4WV4 B;  5C3I C;  3WTP C;  3VH6 A;  4XUJ D;  5B0Y B;  3WA9 C;  5E5A A;  4KGC C;  5CPK B;  1ID3 D;  2F8N K;  1B6W A;  2ZY3 A;  2XD5 A;  4Z66 D;  3AZM A;  2IO5 C;  5GT3 A;  4LD9 D;  3V9R B;  5B1M B;  2PYO B;  1HQ3 A;  3AZK C;  3MGP C;  3B6F A;  5B1M A;  2PYO A;  4YM6 C;  3LJA A;  5DNN C;  3F6T A;  1F66 D;  1U35 B;  5B0Z C;  3AN2 B;  5B24 D;  5CPI B;  1P3O D;  3W96 B;  3AFA B;  3WKJ B;  3KUY B;  4WU8 C;  3AV2 B;  3KWQ A;  5GSU C;  4DQY B;  3AN2 A;  1TAF B;  1P3L B;  3W96 A;  4J8X D;  3X1U B;  3KUY A;  2F2A C;  3AV2 A;  4XZQ C;  3C1C C;  5B31 C;  3C1B C;  4Z5T B;  4KGC D;  5AV9 B;  3X1U A;  4KUD B;  3O62 A;  2BYM B;  3VH6 T;  2Y2P A;  2CWE A;  3KSY A;  3LZ1 B;  4Z5T A;  2ARO C;  2Y2I A;  2BYM A;  3UT9 B;  4J8V A;  4CSR B;  3WTP B;  4YS3 A;  3TU4 B;  3NQJ A;  4R8P B;  1P3A C;  1P34 A;  3AZL B;  3WA9 B;  3MVD B;  5JA4 B;  3LZ0 C;  1KX4 A;  4CSR A;  5GXQ B;  3TU4 A;  3AZI D;  5B1L D;  5G49 A;  4R8P A;  3REL B;  2YFW A;  3AZL A;  2NZD B;  5CP6 A;  5JA4 A;  3MVD A;  5B0Z D;  3AZE A;  3W98 D;  2Y2M A;  3AYW C;  1M19 C;  1TZY C;  3REL A;  4WU8 D;  3MGP B;  3W97 C;  2NZD A;  1P3K A;  4E45 A;  4YM6 B;  3A6N C;  1P3G B;  4H9O A;  1S32 C;  5DNN B;  1Z2C B;  1A7W A;  2HIO A;  3AZJ C;  3AZN C;  3X1T C;  3B6G A;  3MGS A;  1ZLA B;  2DF4 C;  5B40 A;  1M1A D;  4WZS B;  1ZLA A;  1KX5 C;  3C1C B;  2JE5 A;  2FJ7 C;  3C1B B;  1P3A D;  5AV6 A;  5AY8 A;  3NQU B;  4H9N A;  4WU9 B;  5AV5 D;  2F8N D;  2ARO B;  2CV5 C;  2BG1 A;  4WU9 A;  5B2I D;  2RVQ D;  3AYW D;  1M19 D;  5B33 C;  5E5A C;  3AZG C;  2YFV A;  5CPJ B;  1P3P A;  4AWL B;  3LZ0 B;  5B0Y C;  1JFI B;  5GT3 C;  5CPK C;  4X23 B;  3AZF B;  3AZJ D;  3R45 A;  3REK B;  1HQ3 C;  3AZH A;  1TZY B;  3B6F C;  3WAA A;  5B1M C;  2PYO C;  2BYK A;  3A6N B;  4J8U A;  1S32 B;  3REH D;  3X1T B;  4CAY A;  3AZN B;  4DRA A;  3UTB B;  3VH5 W;  2G5I C;  4QLC A;  3KWQ C;  3FDD A;  3MGR A;  1U35 C;  3AN2 C;  5CPI C;  1BH9 B;  3W96 C;  1T3U A;  2Y2L A;  3UTB A;  3KUY C;  1EQZ A;  3AV2 C;  2CV5 D;  4H9Q A;  1KX5 B;  5B32 D;  3X1U C;  5B33 D;  3MGQ D;  3AZG D;  3X1S B;  3O62 C;  3AV1 B;  2FJ7 B;  1BFM A;  4J8W B;  4Z5T C;  5B0Y D;  3AV1 A;  5CPK D;  4KUD C;  4JJN D;  1P3M B;  1BH8 B;  3X1V B;  2JCH A;  4WNN B;  4J8W A;  1P3B A;  2F8N H;  4YS3 C;  5JRG B;  3LZ1 C;  5E5A B;  1P3M A;  1BH8 A;  3B0C W;  4WNN A;  2PYO D;  3UT9 C;  2Y2J A;  1KX4 C;  5JRG A;  3TU4 C;  3AZM B;  4R8P C;  1P3F A;  5GT3 B;  3AZL C;  3MVD C;  5AV8 A;  1HQ3 B;  5AVB B;  5FUG A;  5KDM A;  5GXQ C;  5B2J D;  1P3I A;  2NQB A;  3REL C;  2NZD C;  3B6F B;  1U35 D;  1P3K C;  2Y2G A;  3AN2 D;  5CPI D;  5AVB A;  2ZY2 A;  1KX3 A;  3AFA D;  5AVC A;  3W96 D;  2LY8 A;  3WKJ D;  3LJA B;  3KUY D;  3AV2 D;  1HTA A;  2HIO C;  4H9S C;  1P3L D;  1P3G C;  4ZUX D;  3X1U D;  3EPL A;  5B40 C;  2JSS A;  3W99 A;  3KWQ B;  4KHA A;  1ZLA C;  4Z5T D;  5AV9 D;  5GT0 A;  4KUD D;  5BS7 C;  1M18 A;  3LZ1 D;  4G92 C;  3REI A;  3O62 B;  5CHL B;  2DQN C;  3UT9 D;  1F1E A;  3REJ A;  3WTP D;  3TU4 D;  4R8P D;  3WA9 D;  3AZL D;  3UTA A;  4WU9 C;  4J8V B;  5GXQ D;  4YS3 B;  3NQJ B;  1P34 B;  2NZD D;  1ID3 A;  1KX4 B;  4WJ3 C;  3AZK D;  4H9R B;  5G49 B;  4Z66 A;  2YFW B;  3MGP D;  5CPJ C;  4HGA B;  5CP6 B;  4LD9 A;  4YM6 D;  3AZE B;  4AWL C;  1P3G D;  1Q9C A;  3AZH C;  4X23 C;  5DNN D;  4H9R A;  3AZF C;  3REK C;  1P3K B;  1ZLA D;  1F66 B;  4J8U C;  1P3O B;  4H9O B;  1R4V A;  2HIO B;  5GSU D;  3B6G B;  3MGS B;  1F66 A;  5B40 B;  4QLC C;  1P3O A;  3VH6 W;  4J8X B;  4XZQ D;  3MGR C;  3C1C D;  3LEL B;  2Y2Q A;  5B31 D;  3C1B D;  3UTB C;  1EQZ C;  4J8X A;  3LEL A;  4M6B A;  4G92 B;  2ARO D;  5AV6 B;  5AY8 B;  4H9N B;  1N1J B;  3AV1 C;  3X1S C;  2Y2N A;  5CPJ D;  4J8W C;  3LZ0 D;  1N1J A;  2RIQ A;  4G91 C;  4X23 D;  3AZF D;  1P3M C;  3X1V C;  3REK D;  1B67 A;  2YFV B;  3B0D B;  1P3P B;  5JRG C;  1P3F C;  1TZY D;  1PZR A;  3AZI A;  5B1L A;  3W97 D;  3R45 B;  2VQR A;  2NQB C;  3A6N D;  3AZM C;  3W98 A;  2L5A A;  3AZH B;  1S32 D;  3X1T D;  3AZN D;  3WAA B;  4DRB A;  4WU8 A;  5AVB C;  2BYK B;  3UTB D;  5AVC C;  1KX3 C;  4J8U B;  4CAY B;  1M1A B;  3LJA C;  3W99 C;  4QLC B;  3MNN B;  3H0M C;  1KX5 D;  3MGR B;  1M1A A;  2FJ7 D;  3X1S D;  3AV1 D;  1EQZ B;  3MNN A;  4H9Q B;  1M18 C;  5AV5 B;  3X1V D;  1P3A A;  5JRG D;  5E5A D;  3UTA C;  5AV5 A;  2F8N A;  3KXB B;  1P3B B;  3AZM D;  5B2I A;  4G91 B;  5GT3 D;  4H9P B;  3IP4 C;  1M19 A;  5BO0 A;  1HQ3 D;  3KXB A;  4J8V C;  5BNX A;  5BNV A;  1AOI B;  4H9P A;  1P34 C;  1P3F B;  3B6F D;  2J8P A;  3EPK A;  5B1M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...