4KGCC

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcC00
3MGQA 1HTAA 3AN2C 4YM6B 5DNMC 3AYWD 3WTPA 4KHAB 3X1VC 1P3AD 2RVQC 4J8WC 4YM6A 1P3FA 4Z5TB 4KHAA 1P34C 3B6FB 3LZ0B 3AZNA 3REHD 5B40B 4Z5TA 3LZ0A 1KX3C 1N1JB 1P3BB 4H9OB 3AZMB 3W96D 4LD9B 3X1UA 3LZ1B 3AN2B 5GT0A 2AROC 2HIOC 3MGSD 4NE5A 1P3BA 4H9OA 1M1AD 5DNMB 1JFIB 4LD9A 3REJC 3X1VB 3LZ1A 4J8WB 3AZID 4KGCC 5G49B 5AVCC 1JFIA 5DNMA 1P34B 4DRBA 5AV8A 4J8WA 5AY8C 1P34A 3MGRD 1KX3B 1HQ3D 2PYOC 2IO5C 5B31D 3MVDD 3W99C 5B31G 3A6ND 1TZYC 1KX3A 2AROB 5CPID 2HIOB 4Z66A 2CV5C 3REJB 3AV2C 3B0CT 1Q9CA 4J8XC 5F99C 3MNNC 4KGCB 2HIOA 5AVCB 3AZJD 1P3PC 2YFVA 3REJA 3VH6T 4H9QB 4KGCA 4J8VD 4QLCD 3V9RA 5AY8B 2YFWB 1P3GA 1B67A 3B6GA 4H9QA 2PYOB 2IO5B 5AY8A 2YFWA 1M19C 4CSRB 3W99B 5BT1C 5AV9C 3UTAC 3NQUA 1TZYB 5B1MA 4X23A 3MGQD 3AZKA 5B33D 1P3ID 2CV5B 3AFAD 1KX5C 3AV2B 4J8XB 1TZYA 5F99B 5CP6C 3MNNB 3WAAD 5CPJC 3X1SC 3O62C 1KX4A 1P3FD 1P3PB 2BYMB 5F99A 3MNNA 3KXBC 3AZND 3UTBC 1EQZC 3RELC 2F8ND 2F8NG 4KUDA 1P3PA 2BYMA 3X1TC 5BO0A 3KUYD 1P3LD 1M19B 3WA9C 5AV9B 3UTAB 3X1UD 1BH9B 3WTPE 4WNNA 5GT0D 3WKJD 3VH6A 1P3BD 1KX5B 5CP6B 5CPJB 5AV6A 3X1SB 3O62B 5GSUC 5DNMD 5B2IA 1KX5A 2BYKA 3KXBB 5CP6A 1EQZB 3UTBB 5AV8D 3RELB 1ZLAC 1ID3C 2NQBA 3X1SA 5B0ZD 5B0YD 3AZEC 2FJ7D 4XZQC 1EQZA 1F1EA 3UTBA 3RELA 4NE3A 3WA9B 3NQJA 3X1TA 5B32C 5BS7C 3REIC 3AZGD 4Z66D 1M18C 4WU9C 3AZLA 4ZUXD 5B1LB 5GSUB 5GT3A 1P3MD 1ZLAB 2NZDD 1ID3B 4J8UA 3LELC 3AZEB 1P3GD 4XZQB 3B6GD 3UT9C 1ZLAA 1ID3A 5B24C 4WU8D 1AOIC 3AZHD 5B1MD 5B32B 4X23D 3AZKD 3REIB 3B6FA 1M18B 5B40A 4WU9B 5CPKD 5BS7A 5B2JC 3REIA 1M18A 3W97D 1KX4D 1N1JA 3KSYA 5JRGC 3W98C 3AZMA 4Z2MH 1P3OC 3REKC 4JJNC 3LELB 3MGPD 4KUDD 3AN2A 3TU4C 4G91C 4ZBJC 3UT9B 1S32C 5B24B 4YS3D 3X1VA 1AOIB 1F66C 3LELA 4H9PB 3R45B 5DNNC 4XUJC 3AV1D 5G49A 1U35C 3VH5W 3UT9A 2JSSA 1AOIA 2HUEC 4H9PA 3R45A 3AZFC 3KWQC 3C1BC 1P3KD 5AVBC 5B2JB 3C1CC 1BFMA 5AV6D 2LY8A 5B2ID 5JRGB 3LJAD 2F8NK 3W98B 3AYWC 1P3OB 5B2JA 3REKB 4JJNB 1P3AC 2NQBD 2AROA 3TU4B 5AV5D 5JRGA 3W98A 4G91B 4ZBJB 1S32B 1F66B 3REHC 5DNNB 4XUJB 3TU4A 3X1TD 5AVCA 1U35B 1S32A 4E44A 4H9RB 2HUEB 5E5AD 3AZFB 1U35A 3KWQB 3AZLD 3C1BB 5AVBB 4H9NB 3W96C 3C1CB 4H9RA 5GT3D 2PYOA 3MGSC 3C1BA 4CSRA 1M1AC 5AVBA 4H9NA 3AYWB 3W99A 3C1CA 3WTPD 1P3AB 4J8UD 5BNVB 3AZIC 4YM6D 3AYWA 2CV5A 3AV2A 1P3AA 3VH5T 4J8XA 3REHB 2F8NH 4DRAA 4Z5TD 3MGRC 3B6FD 3REHA 3LZ0D 1HQ3C 5B40D 4EO5C 3MVDC 3W96B 3A6NC 4G92C 5CPIC 3MGSB 1M19A 1M1AB 5AV9A 3UTAA 3AZMD 4R8PC 4LD9D 3LZ1D 1BH9A 4CAYB 5B1LC 3AZIB 3AN2D 3MGSA 3AZJC 4E45A 3X1VD 5GXQC 4CAYA 2RVQD 3AZIA 4J8VC 4QLCC 4J8WD 5CPJA 4WV4B 3O62A 1P34D 1AOID 3MGRB 3KXBA 1HQ3B 4EO5B 3MVDB 3A6NB 3MGRA 4G92B 3MGQC 4AWLC 1KX3D 5CPIB 3MVDA 5B33C 1P3IC 3WA9A 3AFAC 4R8PB 3WAAC 2AROD 2HIOD 3AZJB 4NFTA 1P3FC 4R8PA 3REJD 5GXQB 3AZNC 5B1LA 4J8VB 4QLCB 4KGCD 5GSUA 5AVCD 5FUGB 5GXQA 1H3OB 4J8VA 4QLCA 3KUYC 1P3LC 3AZEA 5AY8D 4WZSB 4XZQA 3X1UC 5FUGA 1H3OA 3MGQB 4AWLB 5GT0C 2PYOD 3WKJC 4H9SC 5B33B 1P3IB 3W99D 3AFAB 3C1CD 5CHLB 3WAAB 5B32A 1TZYD 5B33A 1P3IA 1P3FB 4WU9A 3AFAA 2CV5D 3AV2D 3WAAA 4J8XD 5F99D 5AV8C 3MNND 3AZNB 2F8NB 5B0ZC 5B0YC 3B0CW 2FJ7C 1P3PD 2F8NA 3KUYB 1P3LB 3VH6W 3X1UB 5GT0B 5B24A 3WKJB 3KUYA 1P3LA 3AZGC 4Z66C 1M19D 1B6WA 5BT1D 5AV9D 3UTAD 4ZUXC 3WKJA 4H9SA 1KX5D 1P3MC 4UUZB 4Z2MG 5AV8B 5CP6D 2NZDC 5CPJD 5B0ZB 5B0YB 3X1SD 3O62D 1P3GC 2FJ7B 4UUZA 3B6GC 3KXBD 1P3OA 1EQZD 3UTBD 3RELD 5B0ZA 3REKA 5B0YA 4JJNA 4WU8C 2FJ7A 1BH8B 3AZHC 3B0DC 5B1MC 4X23C 3AZKC 1F66A 1A7WA 3AZGB 4Z66B 3WA9D 4XUJA 1BH8A 5DNNA 5CPKC 4ZUXB 3AZGA 3W97C 1KX4C 2YFVB 3AZFA 4R8PD 3KWQA 1P3MB 4ZUXA 2NZDB 5B1LD 3V9RB 3MGPC 4KUDC 5GSUD 1P3GB 1P3MA 3B6GB 5GXQD 2NZDA 4YS3C 4WU8B 1ZLAD 1ID3D 5C3IC 3AZED 5BNVA 3AZHB 3AV1C 3B0DB 4XZQD 3NQUB 5B1MB 4X23B 3AZKB 4WU8A 1WWIA 3AZHA 5CPKB 1P3KC 5B31C 1KU5A 5B32D 5B32G 5AV6C 3W97B 3REID 1M18D 1KX4B 5B2IC 4WU9D 3LJAC 5CPKA 3W96A 2NQBC 3W97A 3MGPB 4KUDB 3B0BA 5AV5C 1M1AA 1TAFB 4YS3B 5BO0B 5KDMB 4NE6A 3MGPA 5C3IB 3LELD 5JA4B 3AV1B 2L5AA 1TAFA 4YS3A 3UT9D 4WNNB 5KDMA 5B24D 5E5AC 5JA4A 3AV1A 3AZLC 4HGAC 1P3KB 5B31B 5AV6B 5GT3C 1HQ3A 5B2IB 3LJAB 2BYKB 3VH5A 5B31A 1P3KA 2CWEA 5B2JD 3WTPC 3A6NA 2NQBB 4J8UC 5CPIA 5AV5B 3LJAA 5JRGD 3W98D 4YM6C 1P3OD 3REKD 1R4VA 4JJND 3NQJB 5AV5A 3X1TB 3TU4D 3AZJA 1WWSA 1S32D 4Z5TC 1F66D 3B6FC 5E5AB 3LZ0C 5B40C 4XUJD 5DNND 5BNXB 3AZLB 4HGAB 1U35D 1ULYA 5GT3B 5E5AA 3AZFD 4M6BA 5BNXA 3KWQD 1P3BC 3C1BD 3AZMC 5AVBD 4LD9C 3WTPB 3LZ1C 4J8UB
chains in the Genus database with same CATH superfamily
1W2EA 3MGQA 1HTAA 3AN2C 4YM6B 5DNMC 3AYWD 3WTPA 4KHAB 3X1VC 1P3AD 2RVQC 4J8WC 4YM6A 1P3FA 4Z5TB 4KHAA 1P34C 3B6FB 3LZ0B 3AZNA 3REHD 2FFFB 5B40B 4Z5TA 3LZ0A 1KX3C 1N1JB 1P3BB 4H9OB 3AZMB 3W96D 4LD9B 3X1UA 3LZ1B 3AN2B 5GT0A 2AROC 2HIOC 3MGSD 4NE5A 1P3BA 2Y2NA 4H9OA 5DNMB 1M1AD 1JFIB 4LD9A 2Y2JA 3REJC 3X1VB 3LZ1A 4J8WB 3AZID 4KGCC 5G49B 5AVCC 1JFIA 5DNMA 1P34B 4DRBA 5AV8A 4J8WA 5AY8C 1P34A 3MGRD 1KX3B 1HQ3D 2PYOC 2IO5C 5B31D 3MVDD 3W99C 5B31G 3A6ND 1TZYC 1KX3A 2AROB 5CPID 2HIOB 4Z66A 2CV5C 3REJB 2J8PA 3AV2C 3B0CT 1Q9CA 4J8XC 5F99C 3MNNC 4KGCB 2HIOA 5AVCB 3AZJD 1P3PC 2YFVA 3REJA 3VH6T 4H9QB 4KGCA 4J8VD 4QLCD 3V9RA 5AY8B 2YFWB 1P3GA 1B67A 3B6GA 4H9QA 2PYOB 2IO5B 5AY8A 2YFWA 1M19C 4CSRB 3W99B 5BT1C 5AV9C 3UTAC 3EPKA 3NQUA 1TZYB 5B1MA 4X23A 3MGQD 3AZKA 5B33D 1P3ID 2CV5B 3AFAD 1KX5C 2ZM5A 3AV2B 3EPHA 4J8XB 1TZYA 5F99B 5CP6C 3MNNB 3WAAD 5CPJC 3X1SC 3O62C 1KX4A 1P3FD 1P3PB 2BYMB 5F99A 3MNNA 3KXBC 3AZND 3UTBC 1EQZC 3RELC 2F8ND 2F8NG 4KUDA 1P3PA 2BYMA 3X1TC 2JE5A 4UPKA 5BO0A 3KUYD 1P3LD 1M19B 3WA9C 5AV9B 3UTAB 3X1UD 1BH9B 4WNNA 5GT0D 3WTPE 3WKJD 3VH6A 1P3BD 1KX5B 5CP6B 5CPJB 5AV6A 3X1SB 3O62B 3AL0C 5GSUC 5DNMD 5B2IA 1KX5A 2BYKA 3KXBB 5CP6A 1EQZB 3EPJA 5AV8D 3RELB 3UTBB 1ID3C 1ZLAC 3X1SA 5B0ZD 2NQBA 5B0YD 3AZEC 2FJ7D 4XZQC 1EQZA 1F1EA 3EPLA 3RELA 4NE3A 3UTBA 3WA9B 3NQJA 3X1TA 1PZRA 5B32C 2Y2OA 5BS7C 3EG5B 3REIC 3AZGD 4Z66D 1M18C 4WU9C 3AZLA 3H0RC 4ZUXD 5B1LB 5GSUB 5GT3A 1P3MD 1ZLAB 2NZDD 1ID3B 4J8UA 3LELC 3AZEB 1P3GD 4XZQB 3B6GD 3UT9C 1ZLAA 1ID3A 5B24C 4WU8D 1AOIC 3AZHD 5B1MD 5B32B 4X23D 3AZKD 3P5JB 3REIB 1M18B 3B6FA 5B40A 4WU9B 5CPKD 2BG1A 5BS7A 5B2JC 3REIA 1M18A 3W97D 1KX4D 1N1JA 3KSYA 5JRGC 3W98C 3AZMA 4Z2MH 1P3OC 3REKC 4JJNC 3LELB 3MGPD 4KUDD 3AN2A 3TU4C 4G91C 4ZBJC 3UT9B 1S32C 5B24B 4YS3D 3X1VA 1AOIB 1F66C 3LELA 4H9PB 3R45B 5DNNC 4XUJC 3AV1D 5G49A 1U35C 3VH5W 3UT9A 2JSSA 1AOIA 2HUEC 4H9PA 3R45A 3H0LC 3AZFC 3KWQC 3C1BC 1P3KD 5AVBC 5B2JB 3C1CC 1BFMA 5AV6D 2LY8A 5B2ID 5JRGB 3LJAD 2F8NK 3W98B 3AYWC 1P3OB 2G5IC 5B2JA 3REKB 4JJNB 1P3AC 2NQBD 2Y2MA 2AROA 3TU4B 5AV5D 5JRGA 3W98A 4G91B 4ZBJB 1S32B 1F66B 2ZY3A 3REHC 5DNNB 4XUJB 3TU4A 3IP4C 3X1TD 5AVCA 1U35B 1S32A 4E44A 4H9RB 2HUEB 5E5AD 3AZFB 2Y2HA 1U35A 3KWQB 3AZLD 3C1BB 5AVBB 4H9NB 3W96C 3C1CB 4H9RA 5GT3D 2PYOA 3MGSC 3C1BA 4CSRA 1M1AC 5AVBA 4H9NA 3AYWB 3W99A 3C1CA 3WTPD 1P3AB 4J8UD 5BNVB 3AZIC 2VQRA 4YM6D 2Y2IA 3AYWA 2CV5A 3AV2A 1P3AA 3VH5T 4J8XA 3REHB 2ZY4A 2F8NH 4DRAA 4Z5TD 3MGRC 3B6FD 3REHA 3LZ0D 1HQ3C 5B40D 4EO5C 3MVDC 3W96B 3A6NC 4G92C 5CPIC 3MGSB 1M19A 1M1AB 5AV9A 3UTAA 3AZMD 4R8PC 4LD9D 3LZ1D 1BH9A 4CAYB 5B1LC 3AZIB 3AN2D 3MGSA 2Y2LA 3AZJC 3F6TA 4E45A 3X1VD 5GXQC 4CAYA 2ZY5A 2RVQD 3AZIA 4J8VC 4QLCC 4J8WD 5CPJA 4WV4B 3O62A 1P34D 1T3UA 3MGRB 1AOID 3KXBA 1HQ3B 1Z2CB 4EO5B 2Y2GA 3MVDB 3A6NB 3MGRA 4G92B 3MGQC 4AWLC 1KX3D 5CPIB 4WJ3C 3MVDA 5B33C 1P3IC 3WA9A 3AFAC 4R8PB 2DQNC 3WAAC 3A1KA 2AROD 2HIOD 3AZJB 4NFTA 1P3FC 4R8PA 3REJD 5GXQB 3AZNC 5B1LA 4J8VB 4QLCB 4KGCD 5GSUA 5AVCD 5FUGB 5GXQA 1H3OB 4J8VA 4QLCA 3KUYC 1P3LC 3AZEA 5AY8D 4WZSB 4XZQA 2W8SA 3X1UC 5FUGA 1H3OA 3MGQB 4AWLB 5GT0C 2PYOD 3WKJC 4H9SC 5B33B 2ZY2A 1P3IB 3W99D 3AFAB 3C1CD 5CHLB 3WAAB 5B32A 1TZYD 5B33A 1P3IA 1P3FB 4WU9A 3AFAA 2CV5D 3AV2D 3WAAA 4J8XD 5F99D 5AV8C 3MNND 3AZNB 2F8NB 5B0ZC 5B0YC 3B0CW 2FJ7C 1P3PD 3FDDA 2F8NA 3KUYB 1P3LB 3VH6W 2JCHA 3X1UB 5GT0B 5B24A 3WKJB 3KUYA 1P3LA 3AZGC 4Z66C 1M19D 1B6WA 5BT1D 5AV9D 3UTAD 4ZUXC 3WKJA 4H9SA 1KX5D 1P3MC 4UUZB 4Z2MG 5AV8B 5CP6D 2NZDC 5CPJD 5B0ZB 5B0YB 3X1SD 3O62D 1P3GC 2FJ7B 4UUZA 3B6GC 3KXBD 1P3OA 1EQZD 2DF4C 3UTBD 3RELD 5B0ZA 3REKA 5B0YA 4JJNA 4WU8C 2FJ7A 1BH8B 3AZHC 3B0DC 5B1MC 4X23C 3AZKC 1F66A 1A7WA 3AZGB 4Z66B 2G5HC 3WA9D 2Y2KA 1BH8A 4XUJA 5DNNA 5CPKC 4ZUXB 3AZGA 3W97C 1KX4C 2YFVB 2XD5A 3AZFA 4R8PD 3KWQA 1P3MB 4ZUXA 2NZDB 5B1LD 3V9RB 3MGPC 4KUDC 5GSUD 1P3GB 1P3MA 3B6GB 5GXQD 2NZDA 4YS3C 4WU8B 1ZLAD 1ID3D 5C3IC 3AZED 5BNVA 2Y2QA 3AZHB 3AV1C 3B0DB 4XZQD 3NQUB 5B1MB 4X23B 3AZKB 4WU8A 1WWIA 3AZHA 5CPKB 1P3KC 5B31C 1KU5A 5B32D 5B32G 5AV6C 3W97B 3REID 1M18D 1KX4B 2XD1A 2UWXA 5B2IC 4WU9D 3LJAC 5CPKA 3W96A 3KFUG 2NQBC 3W97A 3MGPB 4KUDB 4DQYB 3B0BA 5AV5C 1M1AA 1TAFB 4YS3B 5BO0B 5KDMB 4NE6A 3MGPA 5C3IB 3LELD 5JA4B 3AV1B 2Y2PA 2L5AA 1TAFA 3A1IA 3H0MC 2F2AC 3UT9D 4WNNB 4YS3A 5KDMA 5B24D 5E5AC 5JA4A 3AV1A 3AZLC 4HGAC 1P3KB 5B31B 5AV6B 5GT3C 1HQ3A 5B2IB 3LJAB 2BYKB 3VH5A 5B31A 1P3KA 2CWEA 5B2JD 3WTPC 3A6NA 2NQBB 4J8UC 5CPIA 5AV5B 3LJAA 5JRGD 3W98D 4YM6C 1P3OD 3REKD 1R4VA 4JJND 3NQJB 5AV5A 3X1TB 3TU4D 3AZJA 1WWSA 2RIQA 1S32D 4Z5TC 1F66D 3B6FC 5E5AB 3LZ0C 5B40C 4XUJD 5DNND 5BNXB 3AZLB 4HGAB 1U35D 1ULYA 5GT3B 5E5AA 3AZFD 4M6BA 5BNXA 3KWQD 1P3BC 3C1BD 3AZMC 5AVBD 4LD9C 3WTPB 3LZ1C 4J8UB
chains in the Genus database with same CATH topology
1W2EA 3MGQA 1HTAA 3AN2C 4YM6B 5DNMC 3AYWD 3WTPA 4KHAB 3X1VC 1P3AD 2RVQC 4J8WC 4YM6A 1P3FA 4Z5TB 4KHAA 1P34C 3B6FB 3LZ0B 3AZNA 3REHD 2FFFB 5B40B 4Z5TA 3LZ0A 1KX3C 1N1JB 1P3BB 4H9OB 3AZMB 3W96D 4LD9B 3X1UA 3LZ1B 3AN2B 5GT0A 2AROC 2HIOC 3MGSD 4NE5A 1P3BA 2Y2NA 4H9OA 5DNMB 1M1AD 1JFIB 4LD9A 2Y2JA 3REJC 3X1VB 3LZ1A 4J8WB 3AZID 4KGCC 5G49B 5AVCC 1JFIA 5DNMA 1P34B 4DRBA 5AV8A 4J8WA 5AY8C 1P34A 3MGRD 1KX3B 1HQ3D 2PYOC 2IO5C 5B31D 3MVDD 3W99C 5B31G 3A6ND 1TZYC 1KX3A 2AROB 5CPID 2HIOB 4Z66A 2CV5C 3REJB 2J8PA 3AV2C 3B0CT 1Q9CA 4J8XC 5F99C 3MNNC 4KGCB 2HIOA 5AVCB 3AZJD 1P3PC 2YFVA 3REJA 3VH6T 4H9QB 4KGCA 4J8VD 4QLCD 3V9RA 5AY8B 2YFWB 1P3GA 1B67A 3B6GA 4H9QA 2PYOB 2IO5B 5AY8A 2YFWA 1M19C 4CSRB 3W99B 5BT1C 5AV9C 3UTAC 3EPKA 3NQUA 1TZYB 5B1MA 4X23A 3MGQD 3AZKA 5B33D 1P3ID 2CV5B 3AFAD 1KX5C 2ZM5A 3AV2B 3EPHA 4J8XB 1TZYA 5F99B 5CP6C 3MNNB 3WAAD 5CPJC 3X1SC 3O62C 1KX4A 1P3FD 1P3PB 2BYMB 5F99A 3MNNA 3KXBC 3AZND 3UTBC 1EQZC 3RELC 2F8ND 2F8NG 4KUDA 1P3PA 2BYMA 3X1TC 2JE5A 4UPKA 5BO0A 3KUYD 1P3LD 1M19B 3WA9C 5AV9B 3UTAB 3X1UD 1BH9B 4WNNA 5GT0D 3WTPE 3WKJD 3VH6A 1P3BD 1KX5B 5CP6B 5CPJB 5AV6A 3X1SB 3O62B 3AL0C 5GSUC 5DNMD 5B2IA 1KX5A 2BYKA 3KXBB 5CP6A 1EQZB 3EPJA 5AV8D 3RELB 3UTBB 1ID3C 1ZLAC 3X1SA 5B0ZD 2NQBA 5B0YD 3AZEC 2FJ7D 4XZQC 1EQZA 1F1EA 3EPLA 3RELA 4NE3A 3UTBA 3WA9B 3NQJA 3X1TA 1PZRA 5B32C 2Y2OA 5BS7C 3EG5B 3REIC 3AZGD 4Z66D 1M18C 4WU9C 3AZLA 3H0RC 4ZUXD 5B1LB 5GSUB 5GT3A 1P3MD 1ZLAB 2NZDD 1ID3B 4J8UA 3LELC 3AZEB 1P3GD 4XZQB 3B6GD 3UT9C 1ZLAA 1ID3A 5B24C 4WU8D 1AOIC 3AZHD 5B1MD 5B32B 4X23D 3AZKD 3P5JB 3REIB 1M18B 3B6FA 5B40A 4WU9B 5CPKD 2BG1A 5BS7A 5B2JC 3REIA 1M18A 3W97D 1KX4D 1N1JA 3KSYA 5JRGC 3W98C 3AZMA 4Z2MH 1P3OC 3REKC 4JJNC 3LELB 3MGPD 4KUDD 3AN2A 3TU4C 4G91C 4ZBJC 3UT9B 1S32C 5B24B 4YS3D 3X1VA 1AOIB 1F66C 3LELA 4H9PB 3R45B 5DNNC 4XUJC 3AV1D 5G49A 1U35C 3VH5W 3UT9A 2JSSA 1AOIA 2HUEC 4H9PA 3R45A 3H0LC 3AZFC 3KWQC 3C1BC 1P3KD 5AVBC 5B2JB 3C1CC 1BFMA 5AV6D 2LY8A 5B2ID 5JRGB 3LJAD 2F8NK 3W98B 3AYWC 1P3OB 2G5IC 5B2JA 3REKB 4JJNB 1P3AC 2NQBD 2Y2MA 2AROA 3TU4B 5AV5D 5JRGA 3W98A 4G91B 4ZBJB 1S32B 1F66B 2ZY3A 3REHC 5DNNB 4XUJB 3TU4A 3IP4C 3X1TD 5AVCA 1U35B 1S32A 4E44A 4H9RB 2HUEB 5E5AD 3AZFB 2Y2HA 1U35A 3KWQB 3AZLD 3C1BB 5AVBB 4H9NB 3W96C 3C1CB 4H9RA 5GT3D 2PYOA 3MGSC 3C1BA 4CSRA 1M1AC 5AVBA 4H9NA 3AYWB 3W99A 3C1CA 3WTPD 1P3AB 4J8UD 5BNVB 3AZIC 2VQRA 4YM6D 2Y2IA 3AYWA 2CV5A 3AV2A 1P3AA 3VH5T 4J8XA 3REHB 2ZY4A 2F8NH 4DRAA 4Z5TD 3MGRC 3B6FD 3REHA 3LZ0D 1HQ3C 5B40D 4EO5C 3MVDC 3W96B 3A6NC 4G92C 5CPIC 3MGSB 1M19A 1M1AB 5AV9A 3UTAA 3AZMD 4R8PC 4LD9D 3LZ1D 1BH9A 4CAYB 5B1LC 3AZIB 3AN2D 3MGSA 2Y2LA 3AZJC 3F6TA 4E45A 3X1VD 5GXQC 4CAYA 2ZY5A 2RVQD 3AZIA 4J8VC 4QLCC 4J8WD 5CPJA 4WV4B 3O62A 1P34D 1T3UA 3MGRB 1AOID 3KXBA 1HQ3B 1Z2CB 4EO5B 2Y2GA 3MVDB 3A6NB 3MGRA 4G92B 3MGQC 4AWLC 1KX3D 5CPIB 4WJ3C 3MVDA 5B33C 1P3IC 3WA9A 3AFAC 4R8PB 2DQNC 3WAAC 3A1KA 2AROD 2HIOD 3AZJB 4NFTA 1P3FC 4R8PA 3REJD 5GXQB 3AZNC 5B1LA 4J8VB 4QLCB 4KGCD 5GSUA 5AVCD 5FUGB 5GXQA 1H3OB 4J8VA 4QLCA 3KUYC 1P3LC 3AZEA 5AY8D 4WZSB 4XZQA 2W8SA 3X1UC 5FUGA 1H3OA 3MGQB 4AWLB 5GT0C 2PYOD 3WKJC 4H9SC 5B33B 2ZY2A 1P3IB 3W99D 3AFAB 3C1CD 5CHLB 3WAAB 5B32A 1TZYD 5B33A 1P3IA 1P3FB 4WU9A 3AFAA 2CV5D 3AV2D 3WAAA 4J8XD 5F99D 5AV8C 3MNND 3AZNB 2F8NB 5B0ZC 5B0YC 3B0CW 2FJ7C 1P3PD 3FDDA 2F8NA 3KUYB 1P3LB 3VH6W 2JCHA 3X1UB 5GT0B 5B24A 3WKJB 3KUYA 1P3LA 3AZGC 4Z66C 1M19D 1B6WA 5BT1D 5AV9D 3UTAD 4ZUXC 3WKJA 4H9SA 1KX5D 1P3MC 4UUZB 4Z2MG 5AV8B 5CP6D 2NZDC 5CPJD 5B0ZB 5B0YB 3X1SD 3O62D 1P3GC 2FJ7B 4UUZA 3B6GC 3KXBD 1P3OA 1EQZD 2DF4C 3UTBD 3RELD 5B0ZA 3REKA 5B0YA 4JJNA 4WU8C 2FJ7A 1BH8B 3AZHC 3B0DC 5B1MC 4X23C 3AZKC 1F66A 1A7WA 3AZGB 4Z66B 2G5HC 3WA9D 2Y2KA 1BH8A 4XUJA 5DNNA 5CPKC 4ZUXB 3AZGA 3W97C 1KX4C 2YFVB 2XD5A 3AZFA 4R8PD 3KWQA 1P3MB 4ZUXA 2NZDB 5B1LD 3V9RB 3MGPC 4KUDC 5GSUD 1P3GB 1P3MA 3B6GB 5GXQD 2NZDA 4YS3C 4WU8B 1ZLAD 1ID3D 5C3IC 3AZED 5BNVA 2Y2QA 3AZHB 3AV1C 3B0DB 4XZQD 3NQUB 5B1MB 4X23B 3AZKB 4WU8A 1WWIA 3AZHA 5CPKB 1P3KC 5B31C 1KU5A 5B32D 5B32G 5AV6C 3W97B 3REID 1M18D 1KX4B 2XD1A 2UWXA 5B2IC 4WU9D 3LJAC 5CPKA 3W96A 3KFUG 2NQBC 3W97A 3MGPB 4KUDB 4DQYB 3B0BA 5AV5C 1M1AA 1TAFB 4YS3B 5BO0B 5KDMB 4NE6A 3MGPA 5C3IB 3LELD 5JA4B 3AV1B 2Y2PA 2L5AA 1TAFA 3A1IA 3H0MC 2F2AC 3UT9D 4WNNB 4YS3A 5KDMA 5B24D 5E5AC 5JA4A 3AV1A 3AZLC 4HGAC 1P3KB 5B31B 5AV6B 5GT3C 1HQ3A 5B2IB 3LJAB 2BYKB 3VH5A 5B31A 1P3KA 2CWEA 5B2JD 3WTPC 3A6NA 2NQBB 4J8UC 5CPIA 5AV5B 3LJAA 5JRGD 3W98D 4YM6C 1P3OD 3REKD 1R4VA 4JJND 3NQJB 5AV5A 3X1TB 3TU4D 3AZJA 1WWSA 2RIQA 1S32D 4Z5TC 1F66D 3B6FC 5E5AB 3LZ0C 5B40C 4XUJD 5DNND 5BNXB 3AZLB 4HGAB 1U35D 1ULYA 5GT3B 5E5AA 3AZFD 4M6BA 5BNXA 3KWQD 1P3BC 3C1BD 3AZMC 5AVBD 4LD9C 3WTPB 3LZ1C 4J8UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ A;  1HTA A;  3AN2 C;  4YM6 B;  5DNM C;  3AYW D;  3WTP A;  4KHA B;  3X1V C;  1P3A D;  2RVQ C;  4J8W C;  4YM6 A;  1P3F A;  4Z5T B;  4KHA A;  1P34 C;  3B6F B;  3LZ0 B;  3AZN A;  3REH D;  5B40 B;  4Z5T A;  3LZ0 A;  1KX3 C;  1N1J B;  1P3B B;  4H9O B;  3AZM B;  3W96 D;  4LD9 B;  3X1U A;  3LZ1 B;  3AN2 B;  5GT0 A;  2ARO C;  2HIO C;  3MGS D;  4NE5 A;  1P3B A;  4H9O A;  1M1A D;  5DNM B;  1JFI B;  4LD9 A;  3REJ C;  3X1V B;  3LZ1 A;  4J8W B;  3AZI D;  4KGC C;  5G49 B;  5AVC C;  1JFI A;  5DNM A;  1P34 B;  4DRB A;  5AV8 A;  4J8W A;  5AY8 C;  1P34 A;  3MGR D;  1KX3 B;  1HQ3 D;  2PYO C;  2IO5 C;  5B31 D;  3MVD D;  3W99 C;  5B31 G;  3A6N D;  1TZY C;  1KX3 A;  2ARO B;  5CPI D;  2HIO B;  4Z66 A;  2CV5 C;  3REJ B;  3AV2 C;  3B0C T;  1Q9C A;  4J8X C;  5F99 C;  3MNN C;  4KGC B;  2HIO A;  5AVC B;  3AZJ D;  1P3P C;  2YFV A;  3REJ A;  3VH6 T;  4H9Q B;  4KGC A;  4J8V D;  4QLC D;  3V9R A;  5AY8 B;  2YFW B;  1P3G A;  1B67 A;  3B6G A;  4H9Q A;  2PYO B;  2IO5 B;  5AY8 A;  2YFW A;  1M19 C;  4CSR B;  3W99 B;  5BT1 C;  5AV9 C;  3UTA C;  3NQU A;  1TZY B;  5B1M A;  4X23 A;  3MGQ D;  3AZK A;  5B33 D;  1P3I D;  2CV5 B;  3AFA D;  1KX5 C;  3AV2 B;  4J8X B;  1TZY A;  5F99 B;  5CP6 C;  3MNN B;  3WAA D;  5CPJ C;  3X1S C;  3O62 C;  1KX4 A;  1P3F D;  1P3P B;  2BYM B;  5F99 A;  3MNN A;  3KXB C;  3AZN D;  3UTB C;  1EQZ C;  3REL C;  2F8N D;  2F8N G;  4KUD A;  1P3P A;  2BYM A;  3X1T C;  5BO0 A;  3KUY D;  1P3L D;  1M19 B;  3WA9 C;  5AV9 B;  3UTA B;  3X1U D;  1BH9 B;  3WTP E;  4WNN A;  5GT0 D;  3WKJ D;  3VH6 A;  1P3B D;  1KX5 B;  5CP6 B;  5CPJ B;  5AV6 A;  3X1S B;  3O62 B;  5GSU C;  5DNM D;  5B2I A;  1KX5 A;  2BYK A;  3KXB B;  5CP6 A;  1EQZ B;  3UTB B;  5AV8 D;  3REL B;  1ZLA C;  1ID3 C;  2NQB A;  3X1S A;  5B0Z D;  5B0Y D;  3AZE C;  2FJ7 D;  4XZQ C;  1EQZ A;  1F1E A;  3UTB A;  3REL A;  4NE3 A;  3WA9 B;  3NQJ A;  3X1T A;  5B32 C;  5BS7 C;  3REI C;  3AZG D;  4Z66 D;  1M18 C;  4WU9 C;  3AZL A;  4ZUX D;  5B1L B;  5GSU B;  5GT3 A;  1P3M D;  1ZLA B;  2NZD D;  1ID3 B;  4J8U A;  3LEL C;  3AZE B;  1P3G D;  4XZQ B;  3B6G D;  3UT9 C;  1ZLA A;  1ID3 A;  5B24 C;  4WU8 D;  1AOI C;  3AZH D;  5B1M D;  5B32 B;  4X23 D;  3AZK D;  3REI B;  3B6F A;  1M18 B;  5B40 A;  4WU9 B;  5CPK D;  5BS7 A;  5B2J C;  3REI A;  1M18 A;  3W97 D;  1KX4 D;  1N1J A;  3KSY A;  5JRG C;  3W98 C;  3AZM A;  4Z2M H;  1P3O C;  3REK C;  4JJN C;  3LEL B;  3MGP D;  4KUD D;  3AN2 A;  3TU4 C;  4G91 C;  4ZBJ C;  3UT9 B;  1S32 C;  5B24 B;  4YS3 D;  3X1V A;  1AOI B;  1F66 C;  3LEL A;  4H9P B;  3R45 B;  5DNN C;  4XUJ C;  3AV1 D;  5G49 A;  1U35 C;  3VH5 W;  3UT9 A;  2JSS A;  1AOI A;  2HUE C;  4H9P A;  3R45 A;  3AZF C;  3KWQ C;  3C1B C;  1P3K D;  5AVB C;  5B2J B;  3C1C C;  1BFM A;  5AV6 D;  2LY8 A;  5B2I D;  5JRG B;  3LJA D;  2F8N K;  3W98 B;  3AYW C;  1P3O B;  5B2J A;  3REK B;  4JJN B;  1P3A C;  2NQB D;  2ARO A;  3TU4 B;  5AV5 D;  5JRG A;  3W98 A;  4G91 B;  4ZBJ B;  1S32 B;  1F66 B;  3REH C;  5DNN B;  4XUJ B;  3TU4 A;  3X1T D;  5AVC A;  1U35 B;  1S32 A;  4E44 A;  4H9R B;  2HUE B;  5E5A D;  3AZF B;  1U35 A;  3KWQ B;  3AZL D;  3C1B B;  5AVB B;  4H9N B;  3W96 C;  3C1C B;  4H9R A;  5GT3 D;  2PYO A;  3MGS C;  3C1B A;  4CSR A;  1M1A C;  5AVB A;  4H9N A;  3AYW B;  3W99 A;  3C1C A;  3WTP D;  1P3A B;  4J8U D;  5BNV B;  3AZI C;  4YM6 D;  3AYW A;  2CV5 A;  3AV2 A;  1P3A A;  3VH5 T;  4J8X A;  3REH B;  2F8N H;  4DRA A;  4Z5T D;  3MGR C;  3B6F D;  3REH A;  3LZ0 D;  1HQ3 C;  5B40 D;  4EO5 C;  3MVD C;  3W96 B;  3A6N C;  4G92 C;  5CPI C;  3MGS B;  1M19 A;  1M1A B;  5AV9 A;  3UTA A;  3AZM D;  4R8P C;  4LD9 D;  3LZ1 D;  1BH9 A;  4CAY B;  5B1L C;  3AZI B;  3AN2 D;  3MGS A;  3AZJ C;  4E45 A;  3X1V D;  5GXQ C;  4CAY A;  2RVQ D;  3AZI A;  4J8V C;  4QLC C;  4J8W D;  5CPJ A;  4WV4 B;  3O62 A;  1P34 D;  1AOI D;  3MGR B;  3KXB A;  1HQ3 B;  4EO5 B;  3MVD B;  3A6N B;  3MGR A;  4G92 B;  3MGQ C;  4AWL C;  1KX3 D;  5CPI B;  3MVD A;  5B33 C;  1P3I C;  3WA9 A;  3AFA C;  4R8P B;  3WAA C;  2ARO D;  2HIO D;  3AZJ B;  4NFT A;  1P3F C;  4R8P A;  3REJ D;  5GXQ B;  3AZN C;  5B1L A;  4J8V B;  4QLC B;  4KGC D;  5GSU A;  5AVC D;  5FUG B;  5GXQ A;  1H3O B;  4J8V A;  4QLC A;  3KUY C;  1P3L C;  3AZE A;  5AY8 D;  4WZS B;  4XZQ A;  3X1U C;  5FUG A;  1H3O A;  3MGQ B;  4AWL B;  5GT0 C;  2PYO D;  3WKJ C;  4H9S C;  5B33 B;  1P3I B;  3W99 D;  3AFA B;  3C1C D;  5CHL B;  3WAA B;  5B32 A;  1TZY D;  5B33 A;  1P3I A;  1P3F B;  4WU9 A;  3AFA A;  2CV5 D;  3AV2 D;  3WAA A;  4J8X D;  5F99 D;  5AV8 C;  3MNN D;  3AZN B;  2F8N B;  5B0Z C;  5B0Y C;  3B0C W;  2FJ7 C;  1P3P D;  2F8N A;  3KUY B;  1P3L B;  3VH6 W;  3X1U B;  5GT0 B;  5B24 A;  3WKJ B;  3KUY A;  1P3L A;  3AZG C;  4Z66 C;  1M19 D;  1B6W A;  5BT1 D;  5AV9 D;  3UTA D;  4ZUX C;  3WKJ A;  4H9S A;  1KX5 D;  1P3M C;  4UUZ B;  4Z2M G;  5AV8 B;  5CP6 D;  2NZD C;  5CPJ D;  5B0Z B;  5B0Y B;  3X1S D;  3O62 D;  1P3G C;  2FJ7 B;  4UUZ A;  3B6G C;  3KXB D;  1P3O A;  1EQZ D;  3UTB D;  3REL D;  5B0Z A;  3REK A;  5B0Y A;  4JJN A;  4WU8 C;  2FJ7 A;  1BH8 B;  3AZH C;  3B0D C;  5B1M C;  4X23 C;  3AZK C;  1F66 A;  1A7W A;  3AZG B;  4Z66 B;  3WA9 D;  4XUJ A;  1BH8 A;  5DNN A;  5CPK C;  4ZUX B;  3AZG A;  3W97 C;  1KX4 C;  2YFV B;  3AZF A;  4R8P D;  3KWQ A;  1P3M B;  4ZUX A;  2NZD B;  5B1L D;  3V9R B;  3MGP C;  4KUD C;  5GSU D;  1P3G B;  1P3M A;  3B6G B;  5GXQ D;  2NZD A;  4YS3 C;  4WU8 B;  1ZLA D;  1ID3 D;  5C3I C;  3AZE D;  5BNV A;  3AZH B;  3AV1 C;  3B0D B;  4XZQ D;  3NQU B;  5B1M B;  4X23 B;  3AZK B;  4WU8 A;  1WWI A;  3AZH A;  5CPK B;  1P3K C;  5B31 C;  1KU5 A;  5B32 D;  5B32 G;  5AV6 C;  3W97 B;  3REI D;  1M18 D;  1KX4 B;  5B2I C;  4WU9 D;  3LJA C;  5CPK A;  3W96 A;  2NQB C;  3W97 A;  3MGP B;  4KUD B;  3B0B A;  5AV5 C;  1M1A A;  1TAF B;  4YS3 B;  5BO0 B;  5KDM B;  4NE6 A;  3MGP A;  5C3I B;  3LEL D;  5JA4 B;  3AV1 B;  2L5A A;  1TAF A;  4YS3 A;  3UT9 D;  4WNN B;  5KDM A;  5B24 D;  5E5A C;  5JA4 A;  3AV1 A;  3AZL C;  4HGA C;  1P3K B;  5B31 B;  5AV6 B;  5GT3 C;  1HQ3 A;  5B2I B;  3LJA B;  2BYK B;  3VH5 A;  5B31 A;  1P3K A;  2CWE A;  5B2J D;  3WTP C;  3A6N A;  2NQB B;  4J8U C;  5CPI A;  5AV5 B;  3LJA A;  5JRG D;  3W98 D;  4YM6 C;  1P3O D;  3REK D;  1R4V A;  4JJN D;  3NQJ B;  5AV5 A;  3X1T B;  3TU4 D;  3AZJ A;  1WWS A;  1S32 D;  4Z5T C;  1F66 D;  3B6F C;  5E5A B;  3LZ0 C;  5B40 C;  4XUJ D;  5DNN D;  5BNX B;  3AZL B;  4HGA B;  1U35 D;  1ULY A;  5GT3 B;  5E5A A;  3AZF D;  4M6B A;  5BNX A;  3KWQ D;  1P3B C;  3C1B D;  3AZM C;  5AVB D;  4LD9 C;  3WTP B;  3LZ1 C;  4J8U B; 
#chains in the Genus database with same CATH topology
 1W2E A;  3MGQ A;  1HTA A;  3AN2 C;  4YM6 B;  5DNM C;  3AYW D;  3WTP A;  4KHA B;  3X1V C;  1P3A D;  2RVQ C;  4J8W C;  4YM6 A;  1P3F A;  4Z5T B;  4KHA A;  1P34 C;  3B6F B;  3LZ0 B;  3AZN A;  3REH D;  2FFF B;  5B40 B;  4Z5T A;  3LZ0 A;  1KX3 C;  1N1J B;  1P3B B;  4H9O B;  3AZM B;  3W96 D;  4LD9 B;  3X1U A;  3LZ1 B;  3AN2 B;  5GT0 A;  2ARO C;  2HIO C;  3MGS D;  4NE5 A;  1P3B A;  2Y2N A;  4H9O A;  5DNM B;  1M1A D;  1JFI B;  4LD9 A;  2Y2J A;  3REJ C;  3X1V B;  3LZ1 A;  4J8W B;  3AZI D;  4KGC C;  5G49 B;  5AVC C;  1JFI A;  5DNM A;  1P34 B;  4DRB A;  5AV8 A;  4J8W A;  5AY8 C;  1P34 A;  3MGR D;  1KX3 B;  1HQ3 D;  2PYO C;  2IO5 C;  5B31 D;  3MVD D;  3W99 C;  5B31 G;  3A6N D;  1TZY C;  1KX3 A;  2ARO B;  5CPI D;  2HIO B;  4Z66 A;  2CV5 C;  3REJ B;  2J8P A;  3AV2 C;  3B0C T;  1Q9C A;  4J8X C;  5F99 C;  3MNN C;  4KGC B;  2HIO A;  5AVC B;  3AZJ D;  1P3P C;  2YFV A;  3REJ A;  3VH6 T;  4H9Q B;  4KGC A;  4J8V D;  4QLC D;  3V9R A;  5AY8 B;  2YFW B;  1P3G A;  1B67 A;  3B6G A;  4H9Q A;  2PYO B;  2IO5 B;  5AY8 A;  2YFW A;  1M19 C;  4CSR B;  3W99 B;  5BT1 C;  5AV9 C;  3UTA C;  3EPK A;  3NQU A;  1TZY B;  5B1M A;  4X23 A;  3MGQ D;  3AZK A;  5B33 D;  1P3I D;  2CV5 B;  3AFA D;  1KX5 C;  2ZM5 A;  3AV2 B;  3EPH A;  4J8X B;  1TZY A;  5F99 B;  5CP6 C;  3MNN B;  3WAA D;  5CPJ C;  3X1S C;  3O62 C;  1KX4 A;  1P3F D;  1P3P B;  2BYM B;  5F99 A;  3MNN A;  3KXB C;  3AZN D;  3UTB C;  1EQZ C;  3REL C;  2F8N D;  2F8N G;  4KUD A;  1P3P A;  2BYM A;  3X1T C;  2JE5 A;  4UPK A;  5BO0 A;  3KUY D;  1P3L D;  1M19 B;  3WA9 C;  5AV9 B;  3UTA B;  3X1U D;  1BH9 B;  4WNN A;  5GT0 D;  3WTP E;  3WKJ D;  3VH6 A;  1P3B D;  1KX5 B;  5CP6 B;  5CPJ B;  5AV6 A;  3X1S B;  3O62 B;  3AL0 C;  5GSU C;  5DNM D;  5B2I A;  1KX5 A;  2BYK A;  3KXB B;  5CP6 A;  1EQZ B;  3EPJ A;  5AV8 D;  3REL B;  3UTB B;  1ID3 C;  1ZLA C;  3X1S A;  5B0Z D;  2NQB A;  5B0Y D;  3AZE C;  2FJ7 D;  4XZQ C;  1EQZ A;  1F1E A;  3EPL A;  3REL A;  4NE3 A;  3UTB A;  3WA9 B;  3NQJ A;  3X1T A;  1PZR A;  5B32 C;  2Y2O A;  5BS7 C;  3EG5 B;  3REI C;  3AZG D;  4Z66 D;  1M18 C;  4WU9 C;  3AZL A;  3H0R C;  4ZUX D;  5B1L B;  5GSU B;  5GT3 A;  1P3M D;  1ZLA B;  2NZD D;  1ID3 B;  4J8U A;  3LEL C;  3AZE B;  1P3G D;  4XZQ B;  3B6G D;  3UT9 C;  1ZLA A;  1ID3 A;  5B24 C;  4WU8 D;  1AOI C;  3AZH D;  5B1M D;  5B32 B;  4X23 D;  3AZK D;  3P5J B;  3REI B;  1M18 B;  3B6F A;  5B40 A;  4WU9 B;  5CPK D;  2BG1 A;  5BS7 A;  5B2J C;  3REI A;  1M18 A;  3W97 D;  1KX4 D;  1N1J A;  3KSY A;  5JRG C;  3W98 C;  3AZM A;  4Z2M H;  1P3O C;  3REK C;  4JJN C;  3LEL B;  3MGP D;  4KUD D;  3AN2 A;  3TU4 C;  4G91 C;  4ZBJ C;  3UT9 B;  1S32 C;  5B24 B;  4YS3 D;  3X1V A;  1AOI B;  1F66 C;  3LEL A;  4H9P B;  3R45 B;  5DNN C;  4XUJ C;  3AV1 D;  5G49 A;  1U35 C;  3VH5 W;  3UT9 A;  2JSS A;  1AOI A;  2HUE C;  4H9P A;  3R45 A;  3H0L C;  3AZF C;  3KWQ C;  3C1B C;  1P3K D;  5AVB C;  5B2J B;  3C1C C;  1BFM A;  5AV6 D;  2LY8 A;  5B2I D;  5JRG B;  3LJA D;  2F8N K;  3W98 B;  3AYW C;  1P3O B;  2G5I C;  5B2J A;  3REK B;  4JJN B;  1P3A C;  2NQB D;  2Y2M A;  2ARO A;  3TU4 B;  5AV5 D;  5JRG A;  3W98 A;  4G91 B;  4ZBJ B;  1S32 B;  1F66 B;  2ZY3 A;  3REH C;  5DNN B;  4XUJ B;  3TU4 A;  3IP4 C;  3X1T D;  5AVC A;  1U35 B;  1S32 A;  4E44 A;  4H9R B;  2HUE B;  5E5A D;  3AZF B;  2Y2H A;  1U35 A;  3KWQ B;  3AZL D;  3C1B B;  5AVB B;  4H9N B;  3W96 C;  3C1C B;  4H9R A;  5GT3 D;  2PYO A;  3MGS C;  3C1B A;  4CSR A;  1M1A C;  5AVB A;  4H9N A;  3AYW B;  3W99 A;  3C1C A;  3WTP D;  1P3A B;  4J8U D;  5BNV B;  3AZI C;  2VQR A;  4YM6 D;  2Y2I A;  3AYW A;  2CV5 A;  3AV2 A;  1P3A A;  3VH5 T;  4J8X A;  3REH B;  2ZY4 A;  2F8N H;  4DRA A;  4Z5T D;  3MGR C;  3B6F D;  3REH A;  3LZ0 D;  1HQ3 C;  5B40 D;  4EO5 C;  3MVD C;  3W96 B;  3A6N C;  4G92 C;  5CPI C;  3MGS B;  1M19 A;  1M1A B;  5AV9 A;  3UTA A;  3AZM D;  4R8P C;  4LD9 D;  3LZ1 D;  1BH9 A;  4CAY B;  5B1L C;  3AZI B;  3AN2 D;  3MGS A;  2Y2L A;  3AZJ C;  3F6T A;  4E45 A;  3X1V D;  5GXQ C;  4CAY A;  2ZY5 A;  2RVQ D;  3AZI A;  4J8V C;  4QLC C;  4J8W D;  5CPJ A;  4WV4 B;  3O62 A;  1P34 D;  1T3U A;  3MGR B;  1AOI D;  3KXB A;  1HQ3 B;  1Z2C B;  4EO5 B;  2Y2G A;  3MVD B;  3A6N B;  3MGR A;  4G92 B;  3MGQ C;  4AWL C;  1KX3 D;  5CPI B;  4WJ3 C;  3MVD A;  5B33 C;  1P3I C;  3WA9 A;  3AFA C;  4R8P B;  2DQN C;  3WAA C;  3A1K A;  2ARO D;  2HIO D;  3AZJ B;  4NFT A;  1P3F C;  4R8P A;  3REJ D;  5GXQ B;  3AZN C;  5B1L A;  4J8V B;  4QLC B;  4KGC D;  5GSU A;  5AVC D;  5FUG B;  5GXQ A;  1H3O B;  4J8V A;  4QLC A;  3KUY C;  1P3L C;  3AZE A;  5AY8 D;  4WZS B;  4XZQ A;  2W8S A;  3X1U C;  5FUG A;  1H3O A;  3MGQ B;  4AWL B;  5GT0 C;  2PYO D;  3WKJ C;  4H9S C;  5B33 B;  2ZY2 A;  1P3I B;  3W99 D;  3AFA B;  3C1C D;  5CHL B;  3WAA B;  5B32 A;  1TZY D;  5B33 A;  1P3I A;  1P3F B;  4WU9 A;  3AFA A;  2CV5 D;  3AV2 D;  3WAA A;  4J8X D;  5F99 D;  5AV8 C;  3MNN D;  3AZN B;  2F8N B;  5B0Z C;  5B0Y C;  3B0C W;  2FJ7 C;  1P3P D;  3FDD A;  2F8N A;  3KUY B;  1P3L B;  3VH6 W;  2JCH A;  3X1U B;  5GT0 B;  5B24 A;  3WKJ B;  3KUY A;  1P3L A;  3AZG C;  4Z66 C;  1M19 D;  1B6W A;  5BT1 D;  5AV9 D;  3UTA D;  4ZUX C;  3WKJ A;  4H9S A;  1KX5 D;  1P3M C;  4UUZ B;  4Z2M G;  5AV8 B;  5CP6 D;  2NZD C;  5CPJ D;  5B0Z B;  5B0Y B;  3X1S D;  3O62 D;  1P3G C;  2FJ7 B;  4UUZ A;  3B6G C;  3KXB D;  1P3O A;  1EQZ D;  2DF4 C;  3UTB D;  3REL D;  5B0Z A;  3REK A;  5B0Y A;  4JJN A;  4WU8 C;  2FJ7 A;  1BH8 B;  3AZH C;  3B0D C;  5B1M C;  4X23 C;  3AZK C;  1F66 A;  1A7W A;  3AZG B;  4Z66 B;  2G5H C;  3WA9 D;  2Y2K A;  1BH8 A;  4XUJ A;  5DNN A;  5CPK C;  4ZUX B;  3AZG A;  3W97 C;  1KX4 C;  2YFV B;  2XD5 A;  3AZF A;  4R8P D;  3KWQ A;  1P3M B;  4ZUX A;  2NZD B;  5B1L D;  3V9R B;  3MGP C;  4KUD C;  5GSU D;  1P3G B;  1P3M A;  3B6G B;  5GXQ D;  2NZD A;  4YS3 C;  4WU8 B;  1ZLA D;  1ID3 D;  5C3I C;  3AZE D;  5BNV A;  2Y2Q A;  3AZH B;  3AV1 C;  3B0D B;  4XZQ D;  3NQU B;  5B1M B;  4X23 B;  3AZK B;  4WU8 A;  1WWI A;  3AZH A;  5CPK B;  1P3K C;  5B31 C;  1KU5 A;  5B32 D;  5B32 G;  5AV6 C;  3W97 B;  3REI D;  1M18 D;  1KX4 B;  2XD1 A;  2UWX A;  5B2I C;  4WU9 D;  3LJA C;  5CPK A;  3W96 A;  3KFU G;  2NQB C;  3W97 A;  3MGP B;  4KUD B;  4DQY B;  3B0B A;  5AV5 C;  1M1A A;  1TAF B;  4YS3 B;  5BO0 B;  5KDM B;  4NE6 A;  3MGP A;  5C3I B;  3LEL D;  5JA4 B;  3AV1 B;  2Y2P A;  2L5A A;  1TAF A;  3A1I A;  3H0M C;  2F2A C;  3UT9 D;  4WNN B;  4YS3 A;  5KDM A;  5B24 D;  5E5A C;  5JA4 A;  3AV1 A;  3AZL C;  4HGA C;  1P3K B;  5B31 B;  5AV6 B;  5GT3 C;  1HQ3 A;  5B2I B;  3LJA B;  2BYK B;  3VH5 A;  5B31 A;  1P3K A;  2CWE A;  5B2J D;  3WTP C;  3A6N A;  2NQB B;  4J8U C;  5CPI A;  5AV5 B;  3LJA A;  5JRG D;  3W98 D;  4YM6 C;  1P3O D;  3REK D;  1R4V A;  4JJN D;  3NQJ B;  5AV5 A;  3X1T B;  3TU4 D;  3AZJ A;  1WWS A;  2RIQ A;  1S32 D;  4Z5T C;  1F66 D;  3B6F C;  5E5A B;  3LZ0 C;  5B40 C;  4XUJ D;  5DNN D;  5BNX B;  3AZL B;  4HGA B;  1U35 D;  1ULY A;  5GT3 B;  5E5A A;  3AZF D;  4M6B A;  5BNX A;  3KWQ D;  1P3B C;  3C1B D;  3AZM C;  5AVB D;  4LD9 C;  3WTP B;  3LZ1 C;  4J8U B; 
#chains in the Genus database with same CATH homology
 1W2E A;  3MGQ A;  1HTA A;  3AN2 C;  4YM6 B;  5DNM C;  3AYW D;  3WTP A;  4KHA B;  3X1V C;  1P3A D;  2RVQ C;  4J8W C;  4YM6 A;  1P3F A;  4Z5T B;  4KHA A;  1P34 C;  3B6F B;  3LZ0 B;  3AZN A;  3REH D;  2FFF B;  5B40 B;  4Z5T A;  3LZ0 A;  1KX3 C;  1N1J B;  1P3B B;  4H9O B;  3AZM B;  3W96 D;  4LD9 B;  3X1U A;  3LZ1 B;  3AN2 B;  5GT0 A;  2ARO C;  2HIO C;  3MGS D;  4NE5 A;  1P3B A;  2Y2N A;  4H9O A;  5DNM B;  1M1A D;  1JFI B;  4LD9 A;  2Y2J A;  3REJ C;  3X1V B;  3LZ1 A;  4J8W B;  3AZI D;  4KGC C;  5G49 B;  5AVC C;  1JFI A;  5DNM A;  1P34 B;  4DRB A;  5AV8 A;  4J8W A;  5AY8 C;  1P34 A;  3MGR D;  1KX3 B;  1HQ3 D;  2PYO C;  2IO5 C;  5B31 D;  3MVD D;  3W99 C;  5B31 G;  3A6N D;  1TZY C;  1KX3 A;  2ARO B;  5CPI D;  2HIO B;  4Z66 A;  2CV5 C;  3REJ B;  2J8P A;  3AV2 C;  3B0C T;  1Q9C A;  4J8X C;  5F99 C;  3MNN C;  4KGC B;  2HIO A;  5AVC B;  3AZJ D;  1P3P C;  2YFV A;  3REJ A;  3VH6 T;  4H9Q B;  4KGC A;  4J8V D;  4QLC D;  3V9R A;  5AY8 B;  2YFW B;  1P3G A;  1B67 A;  3B6G A;  4H9Q A;  2PYO B;  2IO5 B;  5AY8 A;  2YFW A;  1M19 C;  4CSR B;  3W99 B;  5BT1 C;  5AV9 C;  3UTA C;  3EPK A;  3NQU A;  1TZY B;  5B1M A;  4X23 A;  3MGQ D;  3AZK A;  5B33 D;  1P3I D;  2CV5 B;  3AFA D;  1KX5 C;  2ZM5 A;  3AV2 B;  3EPH A;  4J8X B;  1TZY A;  5F99 B;  5CP6 C;  3MNN B;  3WAA D;  5CPJ C;  3X1S C;  3O62 C;  1KX4 A;  1P3F D;  1P3P B;  2BYM B;  5F99 A;  3MNN A;  3KXB C;  3AZN D;  3UTB C;  1EQZ C;  3REL C;  2F8N D;  2F8N G;  4KUD A;  1P3P A;  2BYM A;  3X1T C;  2JE5 A;  4UPK A;  5BO0 A;  3KUY D;  1P3L D;  1M19 B;  3WA9 C;  5AV9 B;  3UTA B;  3X1U D;  1BH9 B;  4WNN A;  5GT0 D;  3WTP E;  3WKJ D;  3VH6 A;  1P3B D;  1KX5 B;  5CP6 B;  5CPJ B;  5AV6 A;  3X1S B;  3O62 B;  3AL0 C;  5GSU C;  5DNM D;  5B2I A;  1KX5 A;  2BYK A;  3KXB B;  5CP6 A;  1EQZ B;  3EPJ A;  5AV8 D;  3REL B;  3UTB B;  1ID3 C;  1ZLA C;  3X1S A;  5B0Z D;  2NQB A;  5B0Y D;  3AZE C;  2FJ7 D;  4XZQ C;  1EQZ A;  1F1E A;  3EPL A;  3REL A;  4NE3 A;  3UTB A;  3WA9 B;  3NQJ A;  3X1T A;  1PZR A;  5B32 C;  2Y2O A;  5BS7 C;  3EG5 B;  3REI C;  3AZG D;  4Z66 D;  1M18 C;  4WU9 C;  3AZL A;  3H0R C;  4ZUX D;  5B1L B;  5GSU B;  5GT3 A;  1P3M D;  1ZLA B;  2NZD D;  1ID3 B;  4J8U A;  3LEL C;  3AZE B;  1P3G D;  4XZQ B;  3B6G D;  3UT9 C;  1ZLA A;  1ID3 A;  5B24 C;  4WU8 D;  1AOI C;  3AZH D;  5B1M D;  5B32 B;  4X23 D;  3AZK D;  3P5J B;  3REI B;  1M18 B;  3B6F A;  5B40 A;  4WU9 B;  5CPK D;  2BG1 A;  5BS7 A;  5B2J C;  3REI A;  1M18 A;  3W97 D;  1KX4 D;  1N1J A;  3KSY A;  5JRG C;  3W98 C;  3AZM A;  4Z2M H;  1P3O C;  3REK C;  4JJN C;  3LEL B;  3MGP D;  4KUD D;  3AN2 A;  3TU4 C;  4G91 C;  4ZBJ C;  3UT9 B;  1S32 C;  5B24 B;  4YS3 D;  3X1V A;  1AOI B;  1F66 C;  3LEL A;  4H9P B;  3R45 B;  5DNN C;  4XUJ C;  3AV1 D;  5G49 A;  1U35 C;  3VH5 W;  3UT9 A;  2JSS A;  1AOI A;  2HUE C;  4H9P A;  3R45 A;  3H0L C;  3AZF C;  3KWQ C;  3C1B C;  1P3K D;  5AVB C;  5B2J B;  3C1C C;  1BFM A;  5AV6 D;  2LY8 A;  5B2I D;  5JRG B;  3LJA D;  2F8N K;  3W98 B;  3AYW C;  1P3O B;  2G5I C;  5B2J A;  3REK B;  4JJN B;  1P3A C;  2NQB D;  2Y2M A;  2ARO A;  3TU4 B;  5AV5 D;  5JRG A;  3W98 A;  4G91 B;  4ZBJ B;  1S32 B;  1F66 B;  2ZY3 A;  3REH C;  5DNN B;  4XUJ B;  3TU4 A;  3IP4 C;  3X1T D;  5AVC A;  1U35 B;  1S32 A;  4E44 A;  4H9R B;  2HUE B;  5E5A D;  3AZF B;  2Y2H A;  1U35 A;  3KWQ B;  3AZL D;  3C1B B;  5AVB B;  4H9N B;  3W96 C;  3C1C B;  4H9R A;  5GT3 D;  2PYO A;  3MGS C;  3C1B A;  4CSR A;  1M1A C;  5AVB A;  4H9N A;  3AYW B;  3W99 A;  3C1C A;  3WTP D;  1P3A B;  4J8U D;  5BNV B;  3AZI C;  2VQR A;  4YM6 D;  2Y2I A;  3AYW A;  2CV5 A;  3AV2 A;  1P3A A;  3VH5 T;  4J8X A;  3REH B;  2ZY4 A;  2F8N H;  4DRA A;  4Z5T D;  3MGR C;  3B6F D;  3REH A;  3LZ0 D;  1HQ3 C;  5B40 D;  4EO5 C;  3MVD C;  3W96 B;  3A6N C;  4G92 C;  5CPI C;  3MGS B;  1M19 A;  1M1A B;  5AV9 A;  3UTA A;  3AZM D;  4R8P C;  4LD9 D;  3LZ1 D;  1BH9 A;  4CAY B;  5B1L C;  3AZI B;  3AN2 D;  3MGS A;  2Y2L A;  3AZJ C;  3F6T A;  4E45 A;  3X1V D;  5GXQ C;  4CAY A;  2ZY5 A;  2RVQ D;  3AZI A;  4J8V C;  4QLC C;  4J8W D;  5CPJ A;  4WV4 B;  3O62 A;  1P34 D;  1T3U A;  3MGR B;  1AOI D;  3KXB A;  1HQ3 B;  1Z2C B;  4EO5 B;  2Y2G A;  3MVD B;  3A6N B;  3MGR A;  4G92 B;  3MGQ C;  4AWL C;  1KX3 D;  5CPI B;  4WJ3 C;  3MVD A;  5B33 C;  1P3I C;  3WA9 A;  3AFA C;  4R8P B;  2DQN C;  3WAA C;  3A1K A;  2ARO D;  2HIO D;  3AZJ B;  4NFT A;  1P3F C;  4R8P A;  3REJ D;  5GXQ B;  3AZN C;  5B1L A;  4J8V B;  4QLC B;  4KGC D;  5GSU A;  5AVC D;  5FUG B;  5GXQ A;  1H3O B;  4J8V A;  4QLC A;  3KUY C;  1P3L C;  3AZE A;  5AY8 D;  4WZS B;  4XZQ A;  2W8S A;  3X1U C;  5FUG A;  1H3O A;  3MGQ B;  4AWL B;  5GT0 C;  2PYO D;  3WKJ C;  4H9S C;  5B33 B;  2ZY2 A;  1P3I B;  3W99 D;  3AFA B;  3C1C D;  5CHL B;  3WAA B;  5B32 A;  1TZY D;  5B33 A;  1P3I A;  1P3F B;  4WU9 A;  3AFA A;  2CV5 D;  3AV2 D;  3WAA A;  4J8X D;  5F99 D;  5AV8 C;  3MNN D;  3AZN B;  2F8N B;  5B0Z C;  5B0Y C;  3B0C W;  2FJ7 C;  1P3P D;  3FDD A;  2F8N A;  3KUY B;  1P3L B;  3VH6 W;  2JCH A;  3X1U B;  5GT0 B;  5B24 A;  3WKJ B;  3KUY A;  1P3L A;  3AZG C;  4Z66 C;  1M19 D;  1B6W A;  5BT1 D;  5AV9 D;  3UTA D;  4ZUX C;  3WKJ A;  4H9S A;  1KX5 D;  1P3M C;  4UUZ B;  4Z2M G;  5AV8 B;  5CP6 D;  2NZD C;  5CPJ D;  5B0Z B;  5B0Y B;  3X1S D;  3O62 D;  1P3G C;  2FJ7 B;  4UUZ A;  3B6G C;  3KXB D;  1P3O A;  1EQZ D;  2DF4 C;  3UTB D;  3REL D;  5B0Z A;  3REK A;  5B0Y A;  4JJN A;  4WU8 C;  2FJ7 A;  1BH8 B;  3AZH C;  3B0D C;  5B1M C;  4X23 C;  3AZK C;  1F66 A;  1A7W A;  3AZG B;  4Z66 B;  2G5H C;  3WA9 D;  2Y2K A;  1BH8 A;  4XUJ A;  5DNN A;  5CPK C;  4ZUX B;  3AZG A;  3W97 C;  1KX4 C;  2YFV B;  2XD5 A;  3AZF A;  4R8P D;  3KWQ A;  1P3M B;  4ZUX A;  2NZD B;  5B1L D;  3V9R B;  3MGP C;  4KUD C;  5GSU D;  1P3G B;  1P3M A;  3B6G B;  5GXQ D;  2NZD A;  4YS3 C;  4WU8 B;  1ZLA D;  1ID3 D;  5C3I C;  3AZE D;  5BNV A;  2Y2Q A;  3AZH B;  3AV1 C;  3B0D B;  4XZQ D;  3NQU B;  5B1M B;  4X23 B;  3AZK B;  4WU8 A;  1WWI A;  3AZH A;  5CPK B;  1P3K C;  5B31 C;  1KU5 A;  5B32 D;  5B32 G;  5AV6 C;  3W97 B;  3REI D;  1M18 D;  1KX4 B;  2XD1 A;  2UWX A;  5B2I C;  4WU9 D;  3LJA C;  5CPK A;  3W96 A;  3KFU G;  2NQB C;  3W97 A;  3MGP B;  4KUD B;  4DQY B;  3B0B A;  5AV5 C;  1M1A A;  1TAF B;  4YS3 B;  5BO0 B;  5KDM B;  4NE6 A;  3MGP A;  5C3I B;  3LEL D;  5JA4 B;  3AV1 B;  2Y2P A;  2L5A A;  1TAF A;  3A1I A;  3H0M C;  2F2A C;  3UT9 D;  4WNN B;  4YS3 A;  5KDM A;  5B24 D;  5E5A C;  5JA4 A;  3AV1 A;  3AZL C;  4HGA C;  1P3K B;  5B31 B;  5AV6 B;  5GT3 C;  1HQ3 A;  5B2I B;  3LJA B;  2BYK B;  3VH5 A;  5B31 A;  1P3K A;  2CWE A;  5B2J D;  3WTP C;  3A6N A;  2NQB B;  4J8U C;  5CPI A;  5AV5 B;  3LJA A;  5JRG D;  3W98 D;  4YM6 C;  1P3O D;  3REK D;  1R4V A;  4JJN D;  3NQJ B;  5AV5 A;  3X1T B;  3TU4 D;  3AZJ A;  1WWS A;  2RIQ A;  1S32 D;  4Z5T C;  1F66 D;  3B6F C;  5E5A B;  3LZ0 C;  5B40 C;  4XUJ D;  5DNN D;  5BNX B;  3AZL B;  4HGA B;  1U35 D;  1ULY A;  5GT3 B;  5E5A A;  3AZF D;  4M6B A;  5BNX A;  3KWQ D;  1P3B C;  3C1B D;  3AZM C;  5AVB D;  4LD9 C;  3WTP B;  3LZ1 C;  4J8U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...