4KGCD

Nucleosome core particle containing (eta6-p-cymene)-(1, 2-ethylenediamine)-ruthenium
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kgcD00
5B31G 1EQZA 1P34D 5B24D 1P3OB 5AVCD 4M6BA 1AOIC 3LJAB 1AOIA 3MGQB 4WU8D 5B32G 4QLCB 3AYWD 3B0DB 1N1JB 3W96B 5F99B 1B6WA 3MGRD 3REIC 3O62D 4Z66C 4J8VB 4Z66A 4H9RB 1P34C 1KX4B 1A7WA 5B24C 1P34A 5AVCC 4H9SC 5B24A 5AVCA 4XZQD 4H9SA 2F8ND 5AV9D 2BYMB 4H9PA 1H3OB 4H9NA 5GSUA 4WU8C 3W97B 5AVBB 3AYWC 3NQUB 3AYWA 1JFIB 5CP6D 4WNNB 3MGRC 3O62C 1B67A 3MGRA 4J8WD 3O62A 3UTAD 2FJ7B 3AZGB 3KUYD 4ZBJB 3REHB 1TZYD 5JRGB 1P3GD 3AV1D 3MGPC 3MGPA 5AV8B 2LY8A 4XZQC 4XZQA 5AV9C 2F8NA 5B0ZD 5AV9A 3LELD 3AZKB 3X1VD 5G49A 4NE3A 5B1LB 1P3KB 5CP6C 4J8WC 2BYKA 3UTAC 4J8WA 3UTAA 3KUYC 1AOIB 1TAFA 3KUYA 5DNMB 1TZYC 1P3GC 3AV1C 1TZYA 5GT3D 2JSSA 3AV1A 1P3GA 3AZMA 3TU4B 3W98A 5B0ZC 3REIB 5B0ZA 3LELC 2AROB 4Z66B 3LELA 3VH6T 4WU9D 3X1VC 1F66D 1M1AC 3X1VA 1M1AA 1P34B 5B24B 5AVCB 3KSYA 1KX3D 3NQJA 1M18D 4H9NB 1BH9A 4WU8B 3AZLD 3AZNA 3KWQB 5GT3C 4HGAB 5BT1D 4WZSB 5GT3A 1ZLAB 4KGCD 4JJND 2YFVA 3MGRB 4KUDD 5E5AB 4H9QA 4WU9C 1F66C 4WU9A 5CPID 5GXQD 3V9RA 4XZQB 5BO0B 2F8NB 1M19D 5B32B 1KX3C 5AV9B 1HQ3D 4DRBA 1KX3A 1M18C 3UT9D 1P3BD 3RELB 1M18A 3C1BD 3AZLC 3AZLA 5BT1C 1EQZD 4KGCC 3B6FD 5CP6B 4JJNC 1KX5D 1BH8A 4KGCA 1U35B 2BYKB 3B0CW 4JJNA 4KUDC 3AZID 4J8WB 4KUDA 3UTAB 1TAFB 4EO5C 3KUYB 5CPIC 5B2ID 5CPIA 1TZYB 1P3GB 3AV1B 4KHAA 5GXQC 1S32D 5GXQA 3R45B 1M19C 1HQ3C 1M19A 5B0ZB 5BNXA 1HQ3A 5C3IC 3LZ0A 3LELB 3UT9C 1P3BC 3UT9A 3C1BC 3X1VB 1P3BA 3C1BA 2HUEC 1EQZC 1WWSA 3WTPD 1P3FD 3B6FC 1KX5C 3B6FA 1KX5A 3AZIC 3NQJB 3AZIA 4ZUXD 4WV4B 5B2IC 5B2IA 5GSUD 2F8NG 5GT3B 1S32C 1S32A 2YFVB 4LD9C 4YS3D 3REKD 4LD9A 4H9QB 3AN2D 4WU9B 1F66B 3WAAD 1ID3B 2IO5C 4Z5TD 3REJD 3WTPC 1P3FC 3V9RB 3WTPA 1P3FA 4AWLC 3MGPD 1P3AD 1KX3B 4ZUXC 1M18B 1R4VA 4ZUXA 3AV2A 5GSUC 4CSRA 3AZLB 4NFTA 3C1CD 1BH8B 5AV5D 4YS3C 3REKC 3WA9D 4KGCB 3REKA 4YS3A 4E45A 3AN2C 3AN2A 3WAAC 2NZDC 4EO5B 2HIOD 3WAAA 2NZDA 3AFAD 4Z5TC 3REJC 4H9OA 3X1TB 4Z5TA 3REJA 2YFWA 1Q9CA 3AZMD 1M19B 1P3AC 5BNXB 1HQ3B 5B33B 1P3AA 3W98D 3B6GA 3VH5W 5C3IB 1P3BB 3C1BB 4YM6A 1M1AD 1BFMA 3C1CC 2HUEB 1EQZB 5AV5C 3C1CA 3B6FB 1KX5B 3WA9C 1HTAA 5AV5A 3WA9A 3AZIB 3X1UD 2F8NH 2HIOC 5GT0D 5B2IB 2HIOA 3AFAC 1P3PD 3AFAA 3AZND 1S32B 3AZMC 5KDMA 3W98C 2IO5B 4R8PD 3UTBD 3WTPB 1P3FB 3W99D 4NE6A 4ZUXB 3X1UC 5GT0C 4H9PB 3X1UA 5GT0A 4CAYA 2CWEA 4CSRB 5GSUB 1P3PC 1P3PA 3AZNC 5CPJD 5B40D 1P3ID 4Z2MG 3AYWB 2CV5D 3REKB 4J8UD 4YS3B 4J8XD 3O62B 4X23D 3WAAB 4UUZA 5B2JA 3REJB 4R8PC 3UTBC 3W99C 4R8PA 3UTBA 3W99A 5BNVA 3MGPB 1P3AB 4NE5A 1P3OA 3LZ0D 5G49B 5CPJC 5B40C 3C1CB 1P3IC 5CPJA 5B40A 5AV5B 2CV5C 1P3IA 4J8UC 3WA9B 2CV5A 3B0DC 4J8UA 4J8XC 1N1JA 4X23C 4J8XA 3AZFD 4G92C 3AZHD 3VH6W 4X23A 3MVDD 3A6ND 3AFAB 1KU5A 4H9RA 5KDMB 3AZMB 3MNND 1F1EA 4LD9D 3W98B 3LZ0C 5FUGA 2PYOD 5B0YD 2BYMA 3LZ1D 1M1AB 5AVBC 5DNND 3W97A 5AVBA 5B1LD 1P3LD 5AY8D 3NQUA 1JFIA 3AZFC 3AZHC 3AZFA 3MVDC 5GT0B 3AZHA 3A6NC 1BH9B 3MVDA 3AV2D 3A6NA 4Z2MH 1P3PB 3AZNB 3AZED 3MNNC 3MNNA 3WKJB 3TU4D 2PYOC 5B0YC 5B1MD 2PYOA 5B0YA 3X1SD 3LZ1C 2NZDD 2AROD 5AV6D 3LZ1A 4R8PB 3UTBB 5DNNC 3W99B 5BNVB 5DNNA 5B1LC 1P3KC 1P3LC 5B1LA 5AY8C 1P3KA 1P3LA 5AY8A 3B6GD 3AV2C 4G91C 2NQBD 3VH5T 4YM6D 3AZEC 5DNMC 3AZEA 5CPJB 5B40B 5DNMA 1P3IB 3KWQD 2CV5B 4J8UB 4JJNB 3TU4C 4J8XB 1ZLAD 4KUDB 5BS7C 3TU4A 4X23B 5B1MC 5B31D 5BS7A 4G92B 3X1SC 5B1MA 3REIA 5E5AD 2AROC 3KXBD 3X1SA 5AV6C 2AROA 5CPIB 5AV6A 4XUJD 1P3MD 4KHAB 5GXQB 3WTPE 5FUGB 3B6GC 3LZ0B 5B32D 2NQBC 3UT9B 3AZJD 2NQBA 4YM6C 3RELD 4WU8A 3KWQC 4HGAC 3KWQA 1ZLAC 1ZLAA 3AZFB 5B31C 3AZHB 4E44A 1U35D 5B31A 5E5AC 3MVDB 3KXBC 3A6NB 5E5AA 3B0BA 3KXBA 4XUJC 1P3MC 4XUJA 1P3MA 3MNNB 4LD9B 5B32C 5BO0A 2PYOB 5B32A 5B0YB 3MGSD 3AZJC 3LZ1B 5B2JD 3RELC 3AZJA 3VH5A 3RELA 1WWIA 5DNNB 5CPKD 3WKJD 1P3LB 5AY8B 4AWLB 1U35C 5CP6A 1P3OD 1U35A 3AV2B 4G91B 5CHLB 3AZEB 3LJAD 3MGQD 4QLCD 3R45A 5B1MB 3AN2B 5F99D 3B0CT 3MGSC 3X1SB 3W96D 2NZDB 5B2JC 3MGSA 5AV6B 5JA4A 4H9OB 1ID3D 4Z5TB 4J8VD 5CPKC 2F8NK 2YFWB 3WKJC 5CPKA 3WKJA 2L5AA 1KX4D 1P3OC 3B6GB 2NQBB 4YM6B 3LJAC 3LJAA 3MGQC 3W97D 4QLCC 5AVBD 3MGQA 4QLCA 2RVQD 3W96C 5B31B 5F99C 3W96A 5F99A 3KXBB 2HIOB 1ID3C 4XUJB 1P3MB 4J8VC 3AZGD 1F66A 1ID3A 2FJ7D 4J8VA 3REHD 3X1TD 5JRGD 1KX4C 1KX4A 5AV8D 5B33D 3AZJB 1H3OA 3AZKD 3W97C 1P3KD 2RVQC 4WNNA 3X1UB 4CAYB 2FJ7C 3AZGC 1AOID 2FJ7A 4ZBJC 3VH6A 3REHC 3AZGA 5DNMD 3REHA 3X1TC 3X1TA 5JRGC 5JRGA 1ULYA 5AV8C 5B33C 5AV8A 5B33A 3MGSB 4DRAA 3REID 4UUZB 5B2JB 5JA4B 4Z66D 3AZKC 5CPKB 3AZKA
chains in the Genus database with same CATH superfamily
5B31G 1EQZA 1P34D 5B24D 1P3OB 5AVCD 2XD1A 3AL0C 4WJ3C 4M6BA 1AOIC 3LJAB 1AOIA 3MGQB 4WU8D 3A1KA 5B32G 4QLCB 3AYWD 3B0DB 1N1JB 3W96B 5F99B 1B6WA 3MGRD 3REIC 3O62D 4Z66C 4J8VB 4Z66A 4H9RB 1P34C 1KX4B 1A7WA 1T3UA 5B24C 1P34A 5AVCC 4H9SC 5B24A 2RIQA 5AVCA 4XZQD 4H9SA 2F8ND 5AV9D 2BYMB 4H9PA 1H3OB 4H9NA 5GSUA 4WU8C 3W97B 5AVBB 3AYWC 3NQUB 3AYWA 1JFIB 5CP6D 4WNNB 3MGRC 3O62C 1B67A 3MGRA 4J8WD 3O62A 3UTAD 2Y2PA 2FJ7B 3AZGB 3KUYD 4ZBJB 3REHB 1TZYD 5JRGB 3H0RC 1P3GD 3AV1D 3MGPC 2Y2NA 3MGPA 5AV8B 2LY8A 4XZQC 4XZQA 5AV9C 2F8NA 5B0ZD 5AV9A 3LELD 3AZKB 3X1VD 5G49A 4NE3A 5B1LB 1P3KB 5CP6C 4J8WC 2BYKA 3UTAC 4J8WA 3UTAA 3KUYC 1AOIB 1TAFA 3KUYA 5DNMB 1TZYC 1P3GC 3AV1C 1TZYA 2JCHA 5GT3D 2JSSA 3AV1A 1P3GA 3AZMA 3TU4B 3W98A 5B0ZC 3REIB 5B0ZA 3LELC 3EG5B 2AROB 4Z66B 3LELA 3VH6T 4WU9D 3X1VC 1F66D 1M1AC 3X1VA 1M1AA 1P34B 5B24B 5AVCB 3KSYA 1KX3D 3NQJA 1M18D 4H9NB 1BH9A 4WU8B 3AZLD 3AZNA 3KWQB 5GT3C 4HGAB 5BT1D 4WZSB 5GT3A 1ZLAB 4KGCD 4JJND 2YFVA 3MGRB 4KUDD 5E5AB 4H9QA 2ZM5A 4WU9C 1F66C 4WU9A 5CPID 5GXQD 3V9RA 2VQRA 4XZQB 5BO0B 2F8NB 1M19D 5B32B 1KX3C 5AV9B 1HQ3D 3F6TA 4DRBA 1KX3A 1M18C 2F2AC 3UT9D 1P3BD 3RELB 1M18A 3C1BD 3AZLC 3AZLA 5BT1C 1EQZD 4KGCC 3B6FD 5CP6B 4JJNC 1KX5D 1BH8A 4KGCA 1U35B 2BYKB 3B0CW 4JJNA 4KUDC 3AZID 4J8WB 4KUDA 3UTAB 1TAFB 4EO5C 3KUYB 5CPIC 5B2ID 5CPIA 1TZYB 1P3GB 3AV1B 4KHAA 5GXQC 1S32D 5GXQA 3R45B 1M19C 1HQ3C 1M19A 5B0ZB 5BNXA 1HQ3A 5C3IC 3LZ0A 3LELB 3UT9C 1P3BC 3UT9A 3C1BC 3X1VB 1P3BA 3C1BA 2HUEC 1EQZC 1WWSA 3WTPD 1P3FD 3B6FC 1KX5C 3B6FA 1KX5A 3AZIC 3NQJB 3AZIA 4ZUXD 4WV4B 5B2IC 5B2IA 5GSUD 2F8NG 5GT3B 1S32C 1S32A 2YFVB 4LD9C 4YS3D 3REKD 4LD9A 4H9QB 3AN2D 4WU9B 1PZRA 1F66B 3WAAD 1ID3B 2IO5C 4Z5TD 3REJD 3WTPC 1P3FC 3V9RB 3WTPA 1P3FA 4AWLC 3MGPD 1P3AD 1KX3B 4ZUXC 1M18B 1R4VA 4ZUXA 3AV2A 5GSUC 4CSRA 3AZLB 4NFTA 3C1CD 1BH8B 5AV5D 4YS3C 3REKC 3WA9D 4KGCB 3REKA 4YS3A 4E45A 3AN2C 3AN2A 3WAAC 2NZDC 4EO5B 2HIOD 3WAAA 2NZDA 3KFUG 3AFAD 4Z5TC 3REJC 4H9OA 3X1TB 4Z5TA 3REJA 2YFWA 1Q9CA 3AZMD 1M19B 1P3AC 5BNXB 1HQ3B 5B33B 1P3AA 3W98D 3B6GA 3VH5W 5C3IB 3EPHA 1P3BB 3C1BB 2XD5A 4YM6A 1M1AD 1BFMA 3C1CC 2HUEB 1EQZB 5AV5C 3C1CA 3B6FB 1KX5B 3WA9C 1HTAA 5AV5A 3WA9A 3AZIB 3X1UD 2G5HC 2HIOC 5GT0D 2F8NH 5B2IB 2HIOA 3AFAC 1P3PD 3AFAA 3AZND 1S32B 3AZMC 5KDMA 3W98C 2IO5B 4R8PD 3UTBD 3WTPB 1P3FB 3W99D 3H0MC 1W2EA 4NE6A 4ZUXB 3X1UC 5GT0C 4H9PB 3X1UA 5GT0A 4CAYA 2CWEA 4CSRB 5GSUB 1P3PC 1P3PA 3AZNC 2BG1A 5CPJD 5B40D 2Y2HA 1P3ID 4Z2MG 3AYWB 2CV5D 3REKB 4J8UD 4YS3B 4J8XD 3O62B 3H0LC 4X23D 3WAAB 4UUZA 5B2JA 1Z2CB 3REJB 4R8PC 3UTBC 3W99C 4R8PA 3UTBA 3W99A 5BNVA 3MGPB 1P3AB 4NE5A 1P3OA 3LZ0D 5G49B 5CPJC 5B40C 3C1CB 1P3IC 5CPJA 5B40A 5AV5B 2CV5C 1P3IA 4J8UC 3WA9B 2CV5A 3B0DC 4J8UA 4J8XC 1N1JA 4X23C 4J8XA 3AZFD 4G92C 3AZHD 3VH6W 4X23A 3MVDD 3A6ND 3AFAB 1KU5A 3FDDA 4H9RA 5KDMB 3AZMB 3MNND 1F1EA 4LD9D 3W98B 3P5JB 3LZ0C 5FUGA 2PYOD 5B0YD 2BYMA 3LZ1D 1M1AB 5AVBC 5DNND 3W97A 5AVBA 5B1LD 1P3LD 2UWXA 3NQUA 5AY8D 1JFIA 3AZFC 3AZHC 3AZFA 3MVDC 5GT0B 3AZHA 3A6NC 1BH9B 3MVDA 3AV2D 3A6NA 4Z2MH 1P3PB 2Y2OA 3AZNB 3AZED 3MNNC 3MNNA 3WKJB 3TU4D 2PYOC 5B0YC 5B1MD 2PYOA 5B0YA 3X1SD 3LZ1C 2NZDD 2AROD 5AV6D 3LZ1A 4R8PB 3UTBB 5DNNC 3W99B 2Y2KA 5BNVB 5DNNA 5B1LC 1P3KC 1P3LC 5B1LA 5AY8C 1P3KA 1P3LA 5AY8A 2J8PA 3B6GD 3AV2C 4G91C 2NQBD 3VH5T 4YM6D 3AZEC 2ZY5A 5DNMC 3AZEA 5CPJB 5B40B 5DNMA 1P3IB 3KWQD 2CV5B 4J8UB 4JJNB 3TU4C 4J8XB 1ZLAD 2Y2LA 4KUDB 5BS7C 3TU4A 4X23B 5B1MC 5B31D 5BS7A 4G92B 3X1SC 2DQNC 5B1MA 5E5AD 2AROC 3KXBD 3X1SA 2DF4C 5AV6C 3REIA 2AROA 5CPIB 5AV6A 4XUJD 1P3MD 4KHAB 2G5IC 5GXQB 5FUGB 3WTPE 3B6GC 3LZ0B 5B32D 2NQBC 3UT9B 3AZJD 2NQBA 4YM6C 3RELD 3A1IA 2Y2IA 4WU8A 3KWQC 4HGAC 3KWQA 1ZLAC 1ZLAA 3AZFB 5B31C 3AZHB 4E44A 1U35D 5B31A 5E5AC 3MVDB 2FFFB 3KXBC 3A6NB 5E5AA 3B0BA 3KXBA 4XUJC 1P3MC 4XUJA 1P3MA 3MNNB 4LD9B 5B32C 5BO0A 2PYOB 5B32A 5B0YB 3MGSD 3AZJC 3LZ1B 5B2JD 3EPJA 3RELC 3AZJA 3VH5A 4DQYB 1WWIA 3RELA 5DNNB 2W8SA 5CPKD 3WKJD 4UPKA 1P3LB 5AY8B 4AWLB 1U35C 5CP6A 1P3OD 1U35A 3AV2B 4G91B 5CHLB 3AZEB 2ZY3A 2ZY2A 3LJAD 3EPLA 3MGQD 4QLCD 3R45A 5B1MB 3AN2B 5F99D 3B0CT 3MGSC 3X1SB 3W96D 2Y2MA 5B2JC 3MGSA 5AV6B 2NZDB 5JA4A 4H9OB 1ID3D 4Z5TB 4J8VD 5CPKC 2F8NK 2YFWB 3WKJC 5CPKA 3WKJA 2Y2GA 2L5AA 2Y2JA 2Y2QA 1KX4D 1P3OC 3B6GB 2NQBB 4YM6B 3LJAC 3LJAA 3MGQC 3W97D 4QLCC 5AVBD 3MGQA 4QLCA 3IP4C 2RVQD 3W96C 5B31B 5F99C 3W96A 5F99A 3KXBB 2HIOB 1ID3C 4XUJB 1P3MB 4J8VC 3AZGD 1F66A 1ID3A 2FJ7D 4J8VA 3REHD 2ZY4A 3X1TD 2JE5A 5JRGD 1KX4C 1KX4A 5AV8D 5B33D 3AZJB 1H3OA 3AZKD 3EPKA 3W97C 1P3KD 2RVQC 4WNNA 3X1UB 4CAYB 2FJ7C 3AZGC 1AOID 2FJ7A 4ZBJC 3VH6A 3REHC 3AZGA 5DNMD 3REHA 3X1TC 3X1TA 5JRGC 5JRGA 1ULYA 5AV8C 5B33C 5AV8A 5B33A 3MGSB 4DRAA 3REID 4UUZB 5B2JB 5JA4B 4Z66D 3AZKC 5CPKB 3AZKA
chains in the Genus database with same CATH topology
5B31G 1EQZA 1P34D 5B24D 1P3OB 5AVCD 2XD1A 3AL0C 4WJ3C 4M6BA 1AOIC 3LJAB 1AOIA 3MGQB 4WU8D 3A1KA 5B32G 4QLCB 3AYWD 3B0DB 1N1JB 3W96B 5F99B 1B6WA 3MGRD 3REIC 3O62D 4Z66C 4J8VB 4Z66A 4H9RB 1P34C 1KX4B 1A7WA 1T3UA 5B24C 1P34A 5AVCC 4H9SC 5B24A 2RIQA 5AVCA 4XZQD 4H9SA 2F8ND 5AV9D 2BYMB 4H9PA 1H3OB 4H9NA 5GSUA 4WU8C 3W97B 5AVBB 3AYWC 3NQUB 3AYWA 1JFIB 5CP6D 4WNNB 3MGRC 3O62C 1B67A 3MGRA 4J8WD 3O62A 3UTAD 2Y2PA 2FJ7B 3AZGB 3KUYD 4ZBJB 3REHB 1TZYD 5JRGB 3H0RC 1P3GD 3AV1D 3MGPC 2Y2NA 3MGPA 5AV8B 2LY8A 4XZQC 4XZQA 5AV9C 2F8NA 5B0ZD 5AV9A 3LELD 3AZKB 3X1VD 5G49A 4NE3A 5B1LB 1P3KB 5CP6C 4J8WC 2BYKA 3UTAC 4J8WA 3UTAA 3KUYC 1AOIB 1TAFA 3KUYA 5DNMB 1TZYC 1P3GC 3AV1C 1TZYA 2JCHA 5GT3D 2JSSA 3AV1A 1P3GA 3AZMA 3TU4B 3W98A 5B0ZC 3REIB 5B0ZA 3LELC 3EG5B 2AROB 4Z66B 3LELA 3VH6T 4WU9D 3X1VC 1F66D 1M1AC 3X1VA 1M1AA 1P34B 5B24B 5AVCB 3KSYA 1KX3D 3NQJA 1M18D 4H9NB 1BH9A 4WU8B 3AZLD 3AZNA 3KWQB 5GT3C 4HGAB 5BT1D 4WZSB 5GT3A 1ZLAB 4KGCD 4JJND 2YFVA 3MGRB 4KUDD 5E5AB 4H9QA 2ZM5A 4WU9C 1F66C 4WU9A 5CPID 5GXQD 3V9RA 2VQRA 4XZQB 5BO0B 2F8NB 1M19D 5B32B 1KX3C 5AV9B 1HQ3D 3F6TA 4DRBA 1KX3A 1M18C 2F2AC 3UT9D 1P3BD 3RELB 1M18A 3C1BD 3AZLC 3AZLA 5BT1C 1EQZD 4KGCC 3B6FD 5CP6B 4JJNC 1KX5D 1BH8A 4KGCA 1U35B 2BYKB 3B0CW 4JJNA 4KUDC 3AZID 4J8WB 4KUDA 3UTAB 1TAFB 4EO5C 3KUYB 5CPIC 5B2ID 5CPIA 1TZYB 1P3GB 3AV1B 4KHAA 5GXQC 1S32D 5GXQA 3R45B 1M19C 1HQ3C 1M19A 5B0ZB 5BNXA 1HQ3A 5C3IC 3LZ0A 3LELB 3UT9C 1P3BC 3UT9A 3C1BC 3X1VB 1P3BA 3C1BA 2HUEC 1EQZC 1WWSA 3WTPD 1P3FD 3B6FC 1KX5C 3B6FA 1KX5A 3AZIC 3NQJB 3AZIA 4ZUXD 4WV4B 5B2IC 5B2IA 5GSUD 2F8NG 5GT3B 1S32C 1S32A 2YFVB 4LD9C 4YS3D 3REKD 4LD9A 4H9QB 3AN2D 4WU9B 1PZRA 1F66B 3WAAD 1ID3B 2IO5C 4Z5TD 3REJD 3WTPC 1P3FC 3V9RB 3WTPA 1P3FA 4AWLC 3MGPD 1P3AD 1KX3B 4ZUXC 1M18B 1R4VA 4ZUXA 3AV2A 5GSUC 4CSRA 3AZLB 4NFTA 3C1CD 1BH8B 5AV5D 4YS3C 3REKC 3WA9D 4KGCB 3REKA 4YS3A 4E45A 3AN2C 3AN2A 3WAAC 2NZDC 4EO5B 2HIOD 3WAAA 2NZDA 3KFUG 3AFAD 4Z5TC 3REJC 4H9OA 3X1TB 4Z5TA 3REJA 2YFWA 1Q9CA 3AZMD 1M19B 1P3AC 5BNXB 1HQ3B 5B33B 1P3AA 3W98D 3B6GA 3VH5W 5C3IB 3EPHA 1P3BB 3C1BB 2XD5A 4YM6A 1M1AD 1BFMA 3C1CC 2HUEB 1EQZB 5AV5C 3C1CA 3B6FB 1KX5B 3WA9C 1HTAA 5AV5A 3WA9A 3AZIB 3X1UD 2G5HC 2HIOC 5GT0D 2F8NH 5B2IB 2HIOA 3AFAC 1P3PD 3AFAA 3AZND 1S32B 3AZMC 5KDMA 3W98C 2IO5B 4R8PD 3UTBD 3WTPB 1P3FB 3W99D 3H0MC 1W2EA 4NE6A 4ZUXB 3X1UC 5GT0C 4H9PB 3X1UA 5GT0A 4CAYA 2CWEA 4CSRB 5GSUB 1P3PC 1P3PA 3AZNC 2BG1A 5CPJD 5B40D 2Y2HA 1P3ID 4Z2MG 3AYWB 2CV5D 3REKB 4J8UD 4YS3B 4J8XD 3O62B 3H0LC 4X23D 3WAAB 4UUZA 5B2JA 1Z2CB 3REJB 4R8PC 3UTBC 3W99C 4R8PA 3UTBA 3W99A 5BNVA 3MGPB 1P3AB 4NE5A 1P3OA 3LZ0D 5G49B 5CPJC 5B40C 3C1CB 1P3IC 5CPJA 5B40A 5AV5B 2CV5C 1P3IA 4J8UC 3WA9B 2CV5A 3B0DC 4J8UA 4J8XC 1N1JA 4X23C 4J8XA 3AZFD 4G92C 3AZHD 3VH6W 4X23A 3MVDD 3A6ND 3AFAB 1KU5A 3FDDA 4H9RA 5KDMB 3AZMB 3MNND 1F1EA 4LD9D 3W98B 3P5JB 3LZ0C 5FUGA 2PYOD 5B0YD 2BYMA 3LZ1D 1M1AB 5AVBC 5DNND 3W97A 5AVBA 5B1LD 1P3LD 2UWXA 3NQUA 5AY8D 1JFIA 3AZFC 3AZHC 3AZFA 3MVDC 5GT0B 3AZHA 3A6NC 1BH9B 3MVDA 3AV2D 3A6NA 4Z2MH 1P3PB 2Y2OA 3AZNB 3AZED 3MNNC 3MNNA 3WKJB 3TU4D 2PYOC 5B0YC 5B1MD 2PYOA 5B0YA 3X1SD 3LZ1C 2NZDD 2AROD 5AV6D 3LZ1A 4R8PB 3UTBB 5DNNC 3W99B 2Y2KA 5BNVB 5DNNA 5B1LC 1P3KC 1P3LC 5B1LA 5AY8C 1P3KA 1P3LA 5AY8A 2J8PA 3B6GD 3AV2C 4G91C 2NQBD 3VH5T 4YM6D 3AZEC 2ZY5A 5DNMC 3AZEA 5CPJB 5B40B 5DNMA 1P3IB 3KWQD 2CV5B 4J8UB 4JJNB 3TU4C 4J8XB 1ZLAD 2Y2LA 4KUDB 5BS7C 3TU4A 4X23B 5B1MC 5B31D 5BS7A 4G92B 3X1SC 2DQNC 5B1MA 5E5AD 2AROC 3KXBD 3X1SA 2DF4C 5AV6C 3REIA 2AROA 5CPIB 5AV6A 4XUJD 1P3MD 4KHAB 2G5IC 5GXQB 5FUGB 3WTPE 3B6GC 3LZ0B 5B32D 2NQBC 3UT9B 3AZJD 2NQBA 4YM6C 3RELD 3A1IA 2Y2IA 4WU8A 3KWQC 4HGAC 3KWQA 1ZLAC 1ZLAA 3AZFB 5B31C 3AZHB 4E44A 1U35D 5B31A 5E5AC 3MVDB 2FFFB 3KXBC 3A6NB 5E5AA 3B0BA 3KXBA 4XUJC 1P3MC 4XUJA 1P3MA 3MNNB 4LD9B 5B32C 5BO0A 2PYOB 5B32A 5B0YB 3MGSD 3AZJC 3LZ1B 5B2JD 3EPJA 3RELC 3AZJA 3VH5A 4DQYB 1WWIA 3RELA 5DNNB 2W8SA 5CPKD 3WKJD 4UPKA 1P3LB 5AY8B 4AWLB 1U35C 5CP6A 1P3OD 1U35A 3AV2B 4G91B 5CHLB 3AZEB 2ZY3A 2ZY2A 3LJAD 3EPLA 3MGQD 4QLCD 3R45A 5B1MB 3AN2B 5F99D 3B0CT 3MGSC 3X1SB 3W96D 2Y2MA 5B2JC 3MGSA 5AV6B 2NZDB 5JA4A 4H9OB 1ID3D 4Z5TB 4J8VD 5CPKC 2F8NK 2YFWB 3WKJC 5CPKA 3WKJA 2Y2GA 2L5AA 2Y2JA 2Y2QA 1KX4D 1P3OC 3B6GB 2NQBB 4YM6B 3LJAC 3LJAA 3MGQC 3W97D 4QLCC 5AVBD 3MGQA 4QLCA 3IP4C 2RVQD 3W96C 5B31B 5F99C 3W96A 5F99A 3KXBB 2HIOB 1ID3C 4XUJB 1P3MB 4J8VC 3AZGD 1F66A 1ID3A 2FJ7D 4J8VA 3REHD 2ZY4A 3X1TD 2JE5A 5JRGD 1KX4C 1KX4A 5AV8D 5B33D 3AZJB 1H3OA 3AZKD 3EPKA 3W97C 1P3KD 2RVQC 4WNNA 3X1UB 4CAYB 2FJ7C 3AZGC 1AOID 2FJ7A 4ZBJC 3VH6A 3REHC 3AZGA 5DNMD 3REHA 3X1TC 3X1TA 5JRGC 5JRGA 1ULYA 5AV8C 5B33C 5AV8A 5B33A 3MGSB 4DRAA 3REID 4UUZB 5B2JB 5JA4B 4Z66D 3AZKC 5CPKB 3AZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 G;  1EQZ A;  1P34 D;  5B24 D;  1P3O B;  5AVC D;  4M6B A;  1AOI C;  3LJA B;  1AOI A;  3MGQ B;  4WU8 D;  5B32 G;  4QLC B;  3AYW D;  3B0D B;  1N1J B;  3W96 B;  5F99 B;  1B6W A;  3MGR D;  3REI C;  3O62 D;  4Z66 C;  4J8V B;  4Z66 A;  4H9R B;  1P34 C;  1KX4 B;  1A7W A;  5B24 C;  1P34 A;  5AVC C;  4H9S C;  5B24 A;  5AVC A;  4XZQ D;  4H9S A;  2F8N D;  5AV9 D;  2BYM B;  4H9P A;  1H3O B;  4H9N A;  5GSU A;  4WU8 C;  3W97 B;  5AVB B;  3AYW C;  3NQU B;  3AYW A;  1JFI B;  5CP6 D;  4WNN B;  3MGR C;  3O62 C;  1B67 A;  3MGR A;  4J8W D;  3O62 A;  3UTA D;  2FJ7 B;  3AZG B;  3KUY D;  4ZBJ B;  3REH B;  1TZY D;  5JRG B;  1P3G D;  3AV1 D;  3MGP C;  3MGP A;  5AV8 B;  2LY8 A;  4XZQ C;  4XZQ A;  5AV9 C;  2F8N A;  5B0Z D;  5AV9 A;  3LEL D;  3AZK B;  3X1V D;  5G49 A;  4NE3 A;  5B1L B;  1P3K B;  5CP6 C;  4J8W C;  2BYK A;  3UTA C;  4J8W A;  3UTA A;  3KUY C;  1AOI B;  1TAF A;  3KUY A;  5DNM B;  1TZY C;  1P3G C;  3AV1 C;  1TZY A;  5GT3 D;  2JSS A;  3AV1 A;  1P3G A;  3AZM A;  3TU4 B;  3W98 A;  5B0Z C;  3REI B;  5B0Z A;  3LEL C;  2ARO B;  4Z66 B;  3LEL A;  3VH6 T;  4WU9 D;  3X1V C;  1F66 D;  1M1A C;  3X1V A;  1M1A A;  1P34 B;  5B24 B;  5AVC B;  3KSY A;  1KX3 D;  3NQJ A;  1M18 D;  4H9N B;  1BH9 A;  4WU8 B;  3AZL D;  3AZN A;  3KWQ B;  5GT3 C;  4HGA B;  5BT1 D;  4WZS B;  5GT3 A;  1ZLA B;  4KGC D;  4JJN D;  2YFV A;  3MGR B;  4KUD D;  5E5A B;  4H9Q A;  4WU9 C;  1F66 C;  4WU9 A;  5CPI D;  5GXQ D;  3V9R A;  4XZQ B;  5BO0 B;  2F8N B;  1M19 D;  5B32 B;  1KX3 C;  5AV9 B;  1HQ3 D;  4DRB A;  1KX3 A;  1M18 C;  3UT9 D;  1P3B D;  3REL B;  1M18 A;  3C1B D;  3AZL C;  3AZL A;  5BT1 C;  1EQZ D;  4KGC C;  3B6F D;  5CP6 B;  4JJN C;  1KX5 D;  1BH8 A;  4KGC A;  1U35 B;  2BYK B;  3B0C W;  4JJN A;  4KUD C;  3AZI D;  4J8W B;  4KUD A;  3UTA B;  1TAF B;  4EO5 C;  3KUY B;  5CPI C;  5B2I D;  5CPI A;  1TZY B;  1P3G B;  3AV1 B;  4KHA A;  5GXQ C;  1S32 D;  5GXQ A;  3R45 B;  1M19 C;  1HQ3 C;  1M19 A;  5B0Z B;  5BNX A;  1HQ3 A;  5C3I C;  3LZ0 A;  3LEL B;  3UT9 C;  1P3B C;  3UT9 A;  3C1B C;  3X1V B;  1P3B A;  3C1B A;  2HUE C;  1EQZ C;  1WWS A;  3WTP D;  1P3F D;  3B6F C;  1KX5 C;  3B6F A;  1KX5 A;  3AZI C;  3NQJ B;  3AZI A;  4ZUX D;  4WV4 B;  5B2I C;  5B2I A;  5GSU D;  2F8N G;  5GT3 B;  1S32 C;  1S32 A;  2YFV B;  4LD9 C;  4YS3 D;  3REK D;  4LD9 A;  4H9Q B;  3AN2 D;  4WU9 B;  1F66 B;  3WAA D;  1ID3 B;  2IO5 C;  4Z5T D;  3REJ D;  3WTP C;  1P3F C;  3V9R B;  3WTP A;  1P3F A;  4AWL C;  3MGP D;  1P3A D;  1KX3 B;  4ZUX C;  1M18 B;  1R4V A;  4ZUX A;  3AV2 A;  5GSU C;  4CSR A;  3AZL B;  4NFT A;  3C1C D;  1BH8 B;  5AV5 D;  4YS3 C;  3REK C;  3WA9 D;  4KGC B;  3REK A;  4YS3 A;  4E45 A;  3AN2 C;  3AN2 A;  3WAA C;  2NZD C;  4EO5 B;  2HIO D;  3WAA A;  2NZD A;  3AFA D;  4Z5T C;  3REJ C;  4H9O A;  3X1T B;  4Z5T A;  3REJ A;  2YFW A;  1Q9C A;  3AZM D;  1M19 B;  1P3A C;  5BNX B;  1HQ3 B;  5B33 B;  1P3A A;  3W98 D;  3B6G A;  3VH5 W;  5C3I B;  1P3B B;  3C1B B;  4YM6 A;  1M1A D;  1BFM A;  3C1C C;  2HUE B;  1EQZ B;  5AV5 C;  3C1C A;  3B6F B;  1KX5 B;  3WA9 C;  1HTA A;  5AV5 A;  3WA9 A;  3AZI B;  3X1U D;  2F8N H;  2HIO C;  5GT0 D;  5B2I B;  2HIO A;  3AFA C;  1P3P D;  3AFA A;  3AZN D;  1S32 B;  3AZM C;  5KDM A;  3W98 C;  2IO5 B;  4R8P D;  3UTB D;  3WTP B;  1P3F B;  3W99 D;  4NE6 A;  4ZUX B;  3X1U C;  5GT0 C;  4H9P B;  3X1U A;  5GT0 A;  4CAY A;  2CWE A;  4CSR B;  5GSU B;  1P3P C;  1P3P A;  3AZN C;  5CPJ D;  5B40 D;  1P3I D;  4Z2M G;  3AYW B;  2CV5 D;  3REK B;  4J8U D;  4YS3 B;  4J8X D;  3O62 B;  4X23 D;  3WAA B;  4UUZ A;  5B2J A;  3REJ B;  4R8P C;  3UTB C;  3W99 C;  4R8P A;  3UTB A;  3W99 A;  5BNV A;  3MGP B;  1P3A B;  4NE5 A;  1P3O A;  3LZ0 D;  5G49 B;  5CPJ C;  5B40 C;  3C1C B;  1P3I C;  5CPJ A;  5B40 A;  5AV5 B;  2CV5 C;  1P3I A;  4J8U C;  3WA9 B;  2CV5 A;  3B0D C;  4J8U A;  4J8X C;  1N1J A;  4X23 C;  4J8X A;  3AZF D;  4G92 C;  3AZH D;  3VH6 W;  4X23 A;  3MVD D;  3A6N D;  3AFA B;  1KU5 A;  4H9R A;  5KDM B;  3AZM B;  3MNN D;  1F1E A;  4LD9 D;  3W98 B;  3LZ0 C;  5FUG A;  2PYO D;  5B0Y D;  2BYM A;  3LZ1 D;  1M1A B;  5AVB C;  5DNN D;  3W97 A;  5AVB A;  5B1L D;  1P3L D;  5AY8 D;  3NQU A;  1JFI A;  3AZF C;  3AZH C;  3AZF A;  3MVD C;  5GT0 B;  3AZH A;  3A6N C;  1BH9 B;  3MVD A;  3AV2 D;  3A6N A;  4Z2M H;  1P3P B;  3AZN B;  3AZE D;  3MNN C;  3MNN A;  3WKJ B;  3TU4 D;  2PYO C;  5B0Y C;  5B1M D;  2PYO A;  5B0Y A;  3X1S D;  3LZ1 C;  2NZD D;  2ARO D;  5AV6 D;  3LZ1 A;  4R8P B;  3UTB B;  5DNN C;  3W99 B;  5BNV B;  5DNN A;  5B1L C;  1P3K C;  1P3L C;  5B1L A;  5AY8 C;  1P3K A;  1P3L A;  5AY8 A;  3B6G D;  3AV2 C;  4G91 C;  2NQB D;  3VH5 T;  4YM6 D;  3AZE C;  5DNM C;  3AZE A;  5CPJ B;  5B40 B;  5DNM A;  1P3I B;  3KWQ D;  2CV5 B;  4J8U B;  4JJN B;  3TU4 C;  4J8X B;  1ZLA D;  4KUD B;  5BS7 C;  3TU4 A;  4X23 B;  5B1M C;  5B31 D;  5BS7 A;  4G92 B;  3X1S C;  5B1M A;  3REI A;  5E5A D;  2ARO C;  3KXB D;  3X1S A;  5AV6 C;  2ARO A;  5CPI B;  5AV6 A;  4XUJ D;  1P3M D;  4KHA B;  5GXQ B;  3WTP E;  5FUG B;  3B6G C;  3LZ0 B;  5B32 D;  2NQB C;  3UT9 B;  3AZJ D;  2NQB A;  4YM6 C;  3REL D;  4WU8 A;  3KWQ C;  4HGA C;  3KWQ A;  1ZLA C;  1ZLA A;  3AZF B;  5B31 C;  3AZH B;  4E44 A;  1U35 D;  5B31 A;  5E5A C;  3MVD B;  3KXB C;  3A6N B;  5E5A A;  3B0B A;  3KXB A;  4XUJ C;  1P3M C;  4XUJ A;  1P3M A;  3MNN B;  4LD9 B;  5B32 C;  5BO0 A;  2PYO B;  5B32 A;  5B0Y B;  3MGS D;  3AZJ C;  3LZ1 B;  5B2J D;  3REL C;  3AZJ A;  3VH5 A;  3REL A;  1WWI A;  5DNN B;  5CPK D;  3WKJ D;  1P3L B;  5AY8 B;  4AWL B;  1U35 C;  5CP6 A;  1P3O D;  1U35 A;  3AV2 B;  4G91 B;  5CHL B;  3AZE B;  3LJA D;  3MGQ D;  4QLC D;  3R45 A;  5B1M B;  3AN2 B;  5F99 D;  3B0C T;  3MGS C;  3X1S B;  3W96 D;  2NZD B;  5B2J C;  3MGS A;  5AV6 B;  5JA4 A;  4H9O B;  1ID3 D;  4Z5T B;  4J8V D;  5CPK C;  2F8N K;  2YFW B;  3WKJ C;  5CPK A;  3WKJ A;  2L5A A;  1KX4 D;  1P3O C;  3B6G B;  2NQB B;  4YM6 B;  3LJA C;  3LJA A;  3MGQ C;  3W97 D;  4QLC C;  5AVB D;  3MGQ A;  4QLC A;  2RVQ D;  3W96 C;  5B31 B;  5F99 C;  3W96 A;  5F99 A;  3KXB B;  2HIO B;  1ID3 C;  4XUJ B;  1P3M B;  4J8V C;  3AZG D;  1F66 A;  1ID3 A;  2FJ7 D;  4J8V A;  3REH D;  3X1T D;  5JRG D;  1KX4 C;  1KX4 A;  5AV8 D;  5B33 D;  3AZJ B;  1H3O A;  3AZK D;  3W97 C;  1P3K D;  2RVQ C;  4WNN A;  3X1U B;  4CAY B;  2FJ7 C;  3AZG C;  1AOI D;  2FJ7 A;  4ZBJ C;  3VH6 A;  3REH C;  3AZG A;  5DNM D;  3REH A;  3X1T C;  3X1T A;  5JRG C;  5JRG A;  1ULY A;  5AV8 C;  5B33 C;  5AV8 A;  5B33 A;  3MGS B;  4DRA A;  3REI D;  4UUZ B;  5B2J B;  5JA4 B;  4Z66 D;  3AZK C;  5CPK B;  3AZK A; 
#chains in the Genus database with same CATH topology
 5B31 G;  1EQZ A;  1P34 D;  5B24 D;  1P3O B;  5AVC D;  2XD1 A;  3AL0 C;  4WJ3 C;  4M6B A;  1AOI C;  3LJA B;  1AOI A;  3MGQ B;  4WU8 D;  3A1K A;  5B32 G;  4QLC B;  3AYW D;  3B0D B;  1N1J B;  3W96 B;  5F99 B;  1B6W A;  3MGR D;  3REI C;  3O62 D;  4Z66 C;  4J8V B;  4Z66 A;  4H9R B;  1P34 C;  1KX4 B;  1A7W A;  1T3U A;  5B24 C;  1P34 A;  5AVC C;  4H9S C;  5B24 A;  2RIQ A;  5AVC A;  4XZQ D;  4H9S A;  2F8N D;  5AV9 D;  2BYM B;  4H9P A;  1H3O B;  4H9N A;  5GSU A;  4WU8 C;  3W97 B;  5AVB B;  3AYW C;  3NQU B;  3AYW A;  1JFI B;  5CP6 D;  4WNN B;  3MGR C;  3O62 C;  1B67 A;  3MGR A;  4J8W D;  3O62 A;  3UTA D;  2Y2P A;  2FJ7 B;  3AZG B;  3KUY D;  4ZBJ B;  3REH B;  1TZY D;  5JRG B;  3H0R C;  1P3G D;  3AV1 D;  3MGP C;  2Y2N A;  3MGP A;  5AV8 B;  2LY8 A;  4XZQ C;  4XZQ A;  5AV9 C;  2F8N A;  5B0Z D;  5AV9 A;  3LEL D;  3AZK B;  3X1V D;  5G49 A;  4NE3 A;  5B1L B;  1P3K B;  5CP6 C;  4J8W C;  2BYK A;  3UTA C;  4J8W A;  3UTA A;  3KUY C;  1AOI B;  1TAF A;  3KUY A;  5DNM B;  1TZY C;  1P3G C;  3AV1 C;  1TZY A;  2JCH A;  5GT3 D;  2JSS A;  3AV1 A;  1P3G A;  3AZM A;  3TU4 B;  3W98 A;  5B0Z C;  3REI B;  5B0Z A;  3LEL C;  3EG5 B;  2ARO B;  4Z66 B;  3LEL A;  3VH6 T;  4WU9 D;  3X1V C;  1F66 D;  1M1A C;  3X1V A;  1M1A A;  1P34 B;  5B24 B;  5AVC B;  3KSY A;  1KX3 D;  3NQJ A;  1M18 D;  4H9N B;  1BH9 A;  4WU8 B;  3AZL D;  3AZN A;  3KWQ B;  5GT3 C;  4HGA B;  5BT1 D;  4WZS B;  5GT3 A;  1ZLA B;  4KGC D;  4JJN D;  2YFV A;  3MGR B;  4KUD D;  5E5A B;  4H9Q A;  2ZM5 A;  4WU9 C;  1F66 C;  4WU9 A;  5CPI D;  5GXQ D;  3V9R A;  2VQR A;  4XZQ B;  5BO0 B;  2F8N B;  1M19 D;  5B32 B;  1KX3 C;  5AV9 B;  1HQ3 D;  3F6T A;  4DRB A;  1KX3 A;  1M18 C;  2F2A C;  3UT9 D;  1P3B D;  3REL B;  1M18 A;  3C1B D;  3AZL C;  3AZL A;  5BT1 C;  1EQZ D;  4KGC C;  3B6F D;  5CP6 B;  4JJN C;  1KX5 D;  1BH8 A;  4KGC A;  1U35 B;  2BYK B;  3B0C W;  4JJN A;  4KUD C;  3AZI D;  4J8W B;  4KUD A;  3UTA B;  1TAF B;  4EO5 C;  3KUY B;  5CPI C;  5B2I D;  5CPI A;  1TZY B;  1P3G B;  3AV1 B;  4KHA A;  5GXQ C;  1S32 D;  5GXQ A;  3R45 B;  1M19 C;  1HQ3 C;  1M19 A;  5B0Z B;  5BNX A;  1HQ3 A;  5C3I C;  3LZ0 A;  3LEL B;  3UT9 C;  1P3B C;  3UT9 A;  3C1B C;  3X1V B;  1P3B A;  3C1B A;  2HUE C;  1EQZ C;  1WWS A;  3WTP D;  1P3F D;  3B6F C;  1KX5 C;  3B6F A;  1KX5 A;  3AZI C;  3NQJ B;  3AZI A;  4ZUX D;  4WV4 B;  5B2I C;  5B2I A;  5GSU D;  2F8N G;  5GT3 B;  1S32 C;  1S32 A;  2YFV B;  4LD9 C;  4YS3 D;  3REK D;  4LD9 A;  4H9Q B;  3AN2 D;  4WU9 B;  1PZR A;  1F66 B;  3WAA D;  1ID3 B;  2IO5 C;  4Z5T D;  3REJ D;  3WTP C;  1P3F C;  3V9R B;  3WTP A;  1P3F A;  4AWL C;  3MGP D;  1P3A D;  1KX3 B;  4ZUX C;  1M18 B;  1R4V A;  4ZUX A;  3AV2 A;  5GSU C;  4CSR A;  3AZL B;  4NFT A;  3C1C D;  1BH8 B;  5AV5 D;  4YS3 C;  3REK C;  3WA9 D;  4KGC B;  3REK A;  4YS3 A;  4E45 A;  3AN2 C;  3AN2 A;  3WAA C;  2NZD C;  4EO5 B;  2HIO D;  3WAA A;  2NZD A;  3KFU G;  3AFA D;  4Z5T C;  3REJ C;  4H9O A;  3X1T B;  4Z5T A;  3REJ A;  2YFW A;  1Q9C A;  3AZM D;  1M19 B;  1P3A C;  5BNX B;  1HQ3 B;  5B33 B;  1P3A A;  3W98 D;  3B6G A;  3VH5 W;  5C3I B;  3EPH A;  1P3B B;  3C1B B;  2XD5 A;  4YM6 A;  1M1A D;  1BFM A;  3C1C C;  2HUE B;  1EQZ B;  5AV5 C;  3C1C A;  3B6F B;  1KX5 B;  3WA9 C;  1HTA A;  5AV5 A;  3WA9 A;  3AZI B;  3X1U D;  2G5H C;  2HIO C;  5GT0 D;  2F8N H;  5B2I B;  2HIO A;  3AFA C;  1P3P D;  3AFA A;  3AZN D;  1S32 B;  3AZM C;  5KDM A;  3W98 C;  2IO5 B;  4R8P D;  3UTB D;  3WTP B;  1P3F B;  3W99 D;  3H0M C;  1W2E A;  4NE6 A;  4ZUX B;  3X1U C;  5GT0 C;  4H9P B;  3X1U A;  5GT0 A;  4CAY A;  2CWE A;  4CSR B;  5GSU B;  1P3P C;  1P3P A;  3AZN C;  2BG1 A;  5CPJ D;  5B40 D;  2Y2H A;  1P3I D;  4Z2M G;  3AYW B;  2CV5 D;  3REK B;  4J8U D;  4YS3 B;  4J8X D;  3O62 B;  3H0L C;  4X23 D;  3WAA B;  4UUZ A;  5B2J A;  1Z2C B;  3REJ B;  4R8P C;  3UTB C;  3W99 C;  4R8P A;  3UTB A;  3W99 A;  5BNV A;  3MGP B;  1P3A B;  4NE5 A;  1P3O A;  3LZ0 D;  5G49 B;  5CPJ C;  5B40 C;  3C1C B;  1P3I C;  5CPJ A;  5B40 A;  5AV5 B;  2CV5 C;  1P3I A;  4J8U C;  3WA9 B;  2CV5 A;  3B0D C;  4J8U A;  4J8X C;  1N1J A;  4X23 C;  4J8X A;  3AZF D;  4G92 C;  3AZH D;  3VH6 W;  4X23 A;  3MVD D;  3A6N D;  3AFA B;  1KU5 A;  3FDD A;  4H9R A;  5KDM B;  3AZM B;  3MNN D;  1F1E A;  4LD9 D;  3W98 B;  3P5J B;  3LZ0 C;  5FUG A;  2PYO D;  5B0Y D;  2BYM A;  3LZ1 D;  1M1A B;  5AVB C;  5DNN D;  3W97 A;  5AVB A;  5B1L D;  1P3L D;  2UWX A;  3NQU A;  5AY8 D;  1JFI A;  3AZF C;  3AZH C;  3AZF A;  3MVD C;  5GT0 B;  3AZH A;  3A6N C;  1BH9 B;  3MVD A;  3AV2 D;  3A6N A;  4Z2M H;  1P3P B;  2Y2O A;  3AZN B;  3AZE D;  3MNN C;  3MNN A;  3WKJ B;  3TU4 D;  2PYO C;  5B0Y C;  5B1M D;  2PYO A;  5B0Y A;  3X1S D;  3LZ1 C;  2NZD D;  2ARO D;  5AV6 D;  3LZ1 A;  4R8P B;  3UTB B;  5DNN C;  3W99 B;  2Y2K A;  5BNV B;  5DNN A;  5B1L C;  1P3K C;  1P3L C;  5B1L A;  5AY8 C;  1P3K A;  1P3L A;  5AY8 A;  2J8P A;  3B6G D;  3AV2 C;  4G91 C;  2NQB D;  3VH5 T;  4YM6 D;  3AZE C;  2ZY5 A;  5DNM C;  3AZE A;  5CPJ B;  5B40 B;  5DNM A;  1P3I B;  3KWQ D;  2CV5 B;  4J8U B;  4JJN B;  3TU4 C;  4J8X B;  1ZLA D;  2Y2L A;  4KUD B;  5BS7 C;  3TU4 A;  4X23 B;  5B1M C;  5B31 D;  5BS7 A;  4G92 B;  3X1S C;  2DQN C;  5B1M A;  5E5A D;  2ARO C;  3KXB D;  3X1S A;  2DF4 C;  5AV6 C;  3REI A;  2ARO A;  5CPI B;  5AV6 A;  4XUJ D;  1P3M D;  4KHA B;  2G5I C;  5GXQ B;  5FUG B;  3WTP E;  3B6G C;  3LZ0 B;  5B32 D;  2NQB C;  3UT9 B;  3AZJ D;  2NQB A;  4YM6 C;  3REL D;  3A1I A;  2Y2I A;  4WU8 A;  3KWQ C;  4HGA C;  3KWQ A;  1ZLA C;  1ZLA A;  3AZF B;  5B31 C;  3AZH B;  4E44 A;  1U35 D;  5B31 A;  5E5A C;  3MVD B;  2FFF B;  3KXB C;  3A6N B;  5E5A A;  3B0B A;  3KXB A;  4XUJ C;  1P3M C;  4XUJ A;  1P3M A;  3MNN B;  4LD9 B;  5B32 C;  5BO0 A;  2PYO B;  5B32 A;  5B0Y B;  3MGS D;  3AZJ C;  3LZ1 B;  5B2J D;  3EPJ A;  3REL C;  3AZJ A;  3VH5 A;  4DQY B;  1WWI A;  3REL A;  5DNN B;  2W8S A;  5CPK D;  3WKJ D;  4UPK A;  1P3L B;  5AY8 B;  4AWL B;  1U35 C;  5CP6 A;  1P3O D;  1U35 A;  3AV2 B;  4G91 B;  5CHL B;  3AZE B;  2ZY3 A;  2ZY2 A;  3LJA D;  3EPL A;  3MGQ D;  4QLC D;  3R45 A;  5B1M B;  3AN2 B;  5F99 D;  3B0C T;  3MGS C;  3X1S B;  3W96 D;  2Y2M A;  5B2J C;  3MGS A;  5AV6 B;  2NZD B;  5JA4 A;  4H9O B;  1ID3 D;  4Z5T B;  4J8V D;  5CPK C;  2F8N K;  2YFW B;  3WKJ C;  5CPK A;  3WKJ A;  2Y2G A;  2L5A A;  2Y2J A;  2Y2Q A;  1KX4 D;  1P3O C;  3B6G B;  2NQB B;  4YM6 B;  3LJA C;  3LJA A;  3MGQ C;  3W97 D;  4QLC C;  5AVB D;  3MGQ A;  4QLC A;  3IP4 C;  2RVQ D;  3W96 C;  5B31 B;  5F99 C;  3W96 A;  5F99 A;  3KXB B;  2HIO B;  1ID3 C;  4XUJ B;  1P3M B;  4J8V C;  3AZG D;  1F66 A;  1ID3 A;  2FJ7 D;  4J8V A;  3REH D;  2ZY4 A;  3X1T D;  2JE5 A;  5JRG D;  1KX4 C;  1KX4 A;  5AV8 D;  5B33 D;  3AZJ B;  1H3O A;  3AZK D;  3EPK A;  3W97 C;  1P3K D;  2RVQ C;  4WNN A;  3X1U B;  4CAY B;  2FJ7 C;  3AZG C;  1AOI D;  2FJ7 A;  4ZBJ C;  3VH6 A;  3REH C;  3AZG A;  5DNM D;  3REH A;  3X1T C;  3X1T A;  5JRG C;  5JRG A;  1ULY A;  5AV8 C;  5B33 C;  5AV8 A;  5B33 A;  3MGS B;  4DRA A;  3REI D;  4UUZ B;  5B2J B;  5JA4 B;  4Z66 D;  3AZK C;  5CPK B;  3AZK A; 
#chains in the Genus database with same CATH homology
 5B31 G;  1EQZ A;  1P34 D;  5B24 D;  1P3O B;  5AVC D;  2XD1 A;  3AL0 C;  4WJ3 C;  4M6B A;  1AOI C;  3LJA B;  1AOI A;  3MGQ B;  4WU8 D;  3A1K A;  5B32 G;  4QLC B;  3AYW D;  3B0D B;  1N1J B;  3W96 B;  5F99 B;  1B6W A;  3MGR D;  3REI C;  3O62 D;  4Z66 C;  4J8V B;  4Z66 A;  4H9R B;  1P34 C;  1KX4 B;  1A7W A;  1T3U A;  5B24 C;  1P34 A;  5AVC C;  4H9S C;  5B24 A;  2RIQ A;  5AVC A;  4XZQ D;  4H9S A;  2F8N D;  5AV9 D;  2BYM B;  4H9P A;  1H3O B;  4H9N A;  5GSU A;  4WU8 C;  3W97 B;  5AVB B;  3AYW C;  3NQU B;  3AYW A;  1JFI B;  5CP6 D;  4WNN B;  3MGR C;  3O62 C;  1B67 A;  3MGR A;  4J8W D;  3O62 A;  3UTA D;  2Y2P A;  2FJ7 B;  3AZG B;  3KUY D;  4ZBJ B;  3REH B;  1TZY D;  5JRG B;  3H0R C;  1P3G D;  3AV1 D;  3MGP C;  2Y2N A;  3MGP A;  5AV8 B;  2LY8 A;  4XZQ C;  4XZQ A;  5AV9 C;  2F8N A;  5B0Z D;  5AV9 A;  3LEL D;  3AZK B;  3X1V D;  5G49 A;  4NE3 A;  5B1L B;  1P3K B;  5CP6 C;  4J8W C;  2BYK A;  3UTA C;  4J8W A;  3UTA A;  3KUY C;  1AOI B;  1TAF A;  3KUY A;  5DNM B;  1TZY C;  1P3G C;  3AV1 C;  1TZY A;  2JCH A;  5GT3 D;  2JSS A;  3AV1 A;  1P3G A;  3AZM A;  3TU4 B;  3W98 A;  5B0Z C;  3REI B;  5B0Z A;  3LEL C;  3EG5 B;  2ARO B;  4Z66 B;  3LEL A;  3VH6 T;  4WU9 D;  3X1V C;  1F66 D;  1M1A C;  3X1V A;  1M1A A;  1P34 B;  5B24 B;  5AVC B;  3KSY A;  1KX3 D;  3NQJ A;  1M18 D;  4H9N B;  1BH9 A;  4WU8 B;  3AZL D;  3AZN A;  3KWQ B;  5GT3 C;  4HGA B;  5BT1 D;  4WZS B;  5GT3 A;  1ZLA B;  4KGC D;  4JJN D;  2YFV A;  3MGR B;  4KUD D;  5E5A B;  4H9Q A;  2ZM5 A;  4WU9 C;  1F66 C;  4WU9 A;  5CPI D;  5GXQ D;  3V9R A;  2VQR A;  4XZQ B;  5BO0 B;  2F8N B;  1M19 D;  5B32 B;  1KX3 C;  5AV9 B;  1HQ3 D;  3F6T A;  4DRB A;  1KX3 A;  1M18 C;  2F2A C;  3UT9 D;  1P3B D;  3REL B;  1M18 A;  3C1B D;  3AZL C;  3AZL A;  5BT1 C;  1EQZ D;  4KGC C;  3B6F D;  5CP6 B;  4JJN C;  1KX5 D;  1BH8 A;  4KGC A;  1U35 B;  2BYK B;  3B0C W;  4JJN A;  4KUD C;  3AZI D;  4J8W B;  4KUD A;  3UTA B;  1TAF B;  4EO5 C;  3KUY B;  5CPI C;  5B2I D;  5CPI A;  1TZY B;  1P3G B;  3AV1 B;  4KHA A;  5GXQ C;  1S32 D;  5GXQ A;  3R45 B;  1M19 C;  1HQ3 C;  1M19 A;  5B0Z B;  5BNX A;  1HQ3 A;  5C3I C;  3LZ0 A;  3LEL B;  3UT9 C;  1P3B C;  3UT9 A;  3C1B C;  3X1V B;  1P3B A;  3C1B A;  2HUE C;  1EQZ C;  1WWS A;  3WTP D;  1P3F D;  3B6F C;  1KX5 C;  3B6F A;  1KX5 A;  3AZI C;  3NQJ B;  3AZI A;  4ZUX D;  4WV4 B;  5B2I C;  5B2I A;  5GSU D;  2F8N G;  5GT3 B;  1S32 C;  1S32 A;  2YFV B;  4LD9 C;  4YS3 D;  3REK D;  4LD9 A;  4H9Q B;  3AN2 D;  4WU9 B;  1PZR A;  1F66 B;  3WAA D;  1ID3 B;  2IO5 C;  4Z5T D;  3REJ D;  3WTP C;  1P3F C;  3V9R B;  3WTP A;  1P3F A;  4AWL C;  3MGP D;  1P3A D;  1KX3 B;  4ZUX C;  1M18 B;  1R4V A;  4ZUX A;  3AV2 A;  5GSU C;  4CSR A;  3AZL B;  4NFT A;  3C1C D;  1BH8 B;  5AV5 D;  4YS3 C;  3REK C;  3WA9 D;  4KGC B;  3REK A;  4YS3 A;  4E45 A;  3AN2 C;  3AN2 A;  3WAA C;  2NZD C;  4EO5 B;  2HIO D;  3WAA A;  2NZD A;  3KFU G;  3AFA D;  4Z5T C;  3REJ C;  4H9O A;  3X1T B;  4Z5T A;  3REJ A;  2YFW A;  1Q9C A;  3AZM D;  1M19 B;  1P3A C;  5BNX B;  1HQ3 B;  5B33 B;  1P3A A;  3W98 D;  3B6G A;  3VH5 W;  5C3I B;  3EPH A;  1P3B B;  3C1B B;  2XD5 A;  4YM6 A;  1M1A D;  1BFM A;  3C1C C;  2HUE B;  1EQZ B;  5AV5 C;  3C1C A;  3B6F B;  1KX5 B;  3WA9 C;  1HTA A;  5AV5 A;  3WA9 A;  3AZI B;  3X1U D;  2G5H C;  2HIO C;  5GT0 D;  2F8N H;  5B2I B;  2HIO A;  3AFA C;  1P3P D;  3AFA A;  3AZN D;  1S32 B;  3AZM C;  5KDM A;  3W98 C;  2IO5 B;  4R8P D;  3UTB D;  3WTP B;  1P3F B;  3W99 D;  3H0M C;  1W2E A;  4NE6 A;  4ZUX B;  3X1U C;  5GT0 C;  4H9P B;  3X1U A;  5GT0 A;  4CAY A;  2CWE A;  4CSR B;  5GSU B;  1P3P C;  1P3P A;  3AZN C;  2BG1 A;  5CPJ D;  5B40 D;  2Y2H A;  1P3I D;  4Z2M G;  3AYW B;  2CV5 D;  3REK B;  4J8U D;  4YS3 B;  4J8X D;  3O62 B;  3H0L C;  4X23 D;  3WAA B;  4UUZ A;  5B2J A;  1Z2C B;  3REJ B;  4R8P C;  3UTB C;  3W99 C;  4R8P A;  3UTB A;  3W99 A;  5BNV A;  3MGP B;  1P3A B;  4NE5 A;  1P3O A;  3LZ0 D;  5G49 B;  5CPJ C;  5B40 C;  3C1C B;  1P3I C;  5CPJ A;  5B40 A;  5AV5 B;  2CV5 C;  1P3I A;  4J8U C;  3WA9 B;  2CV5 A;  3B0D C;  4J8U A;  4J8X C;  1N1J A;  4X23 C;  4J8X A;  3AZF D;  4G92 C;  3AZH D;  3VH6 W;  4X23 A;  3MVD D;  3A6N D;  3AFA B;  1KU5 A;  3FDD A;  4H9R A;  5KDM B;  3AZM B;  3MNN D;  1F1E A;  4LD9 D;  3W98 B;  3P5J B;  3LZ0 C;  5FUG A;  2PYO D;  5B0Y D;  2BYM A;  3LZ1 D;  1M1A B;  5AVB C;  5DNN D;  3W97 A;  5AVB A;  5B1L D;  1P3L D;  2UWX A;  3NQU A;  5AY8 D;  1JFI A;  3AZF C;  3AZH C;  3AZF A;  3MVD C;  5GT0 B;  3AZH A;  3A6N C;  1BH9 B;  3MVD A;  3AV2 D;  3A6N A;  4Z2M H;  1P3P B;  2Y2O A;  3AZN B;  3AZE D;  3MNN C;  3MNN A;  3WKJ B;  3TU4 D;  2PYO C;  5B0Y C;  5B1M D;  2PYO A;  5B0Y A;  3X1S D;  3LZ1 C;  2NZD D;  2ARO D;  5AV6 D;  3LZ1 A;  4R8P B;  3UTB B;  5DNN C;  3W99 B;  2Y2K A;  5BNV B;  5DNN A;  5B1L C;  1P3K C;  1P3L C;  5B1L A;  5AY8 C;  1P3K A;  1P3L A;  5AY8 A;  2J8P A;  3B6G D;  3AV2 C;  4G91 C;  2NQB D;  3VH5 T;  4YM6 D;  3AZE C;  2ZY5 A;  5DNM C;  3AZE A;  5CPJ B;  5B40 B;  5DNM A;  1P3I B;  3KWQ D;  2CV5 B;  4J8U B;  4JJN B;  3TU4 C;  4J8X B;  1ZLA D;  2Y2L A;  4KUD B;  5BS7 C;  3TU4 A;  4X23 B;  5B1M C;  5B31 D;  5BS7 A;  4G92 B;  3X1S C;  2DQN C;  5B1M A;  5E5A D;  2ARO C;  3KXB D;  3X1S A;  2DF4 C;  5AV6 C;  3REI A;  2ARO A;  5CPI B;  5AV6 A;  4XUJ D;  1P3M D;  4KHA B;  2G5I C;  5GXQ B;  5FUG B;  3WTP E;  3B6G C;  3LZ0 B;  5B32 D;  2NQB C;  3UT9 B;  3AZJ D;  2NQB A;  4YM6 C;  3REL D;  3A1I A;  2Y2I A;  4WU8 A;  3KWQ C;  4HGA C;  3KWQ A;  1ZLA C;  1ZLA A;  3AZF B;  5B31 C;  3AZH B;  4E44 A;  1U35 D;  5B31 A;  5E5A C;  3MVD B;  2FFF B;  3KXB C;  3A6N B;  5E5A A;  3B0B A;  3KXB A;  4XUJ C;  1P3M C;  4XUJ A;  1P3M A;  3MNN B;  4LD9 B;  5B32 C;  5BO0 A;  2PYO B;  5B32 A;  5B0Y B;  3MGS D;  3AZJ C;  3LZ1 B;  5B2J D;  3EPJ A;  3REL C;  3AZJ A;  3VH5 A;  4DQY B;  1WWI A;  3REL A;  5DNN B;  2W8S A;  5CPK D;  3WKJ D;  4UPK A;  1P3L B;  5AY8 B;  4AWL B;  1U35 C;  5CP6 A;  1P3O D;  1U35 A;  3AV2 B;  4G91 B;  5CHL B;  3AZE B;  2ZY3 A;  2ZY2 A;  3LJA D;  3EPL A;  3MGQ D;  4QLC D;  3R45 A;  5B1M B;  3AN2 B;  5F99 D;  3B0C T;  3MGS C;  3X1S B;  3W96 D;  2Y2M A;  5B2J C;  3MGS A;  5AV6 B;  2NZD B;  5JA4 A;  4H9O B;  1ID3 D;  4Z5T B;  4J8V D;  5CPK C;  2F8N K;  2YFW B;  3WKJ C;  5CPK A;  3WKJ A;  2Y2G A;  2L5A A;  2Y2J A;  2Y2Q A;  1KX4 D;  1P3O C;  3B6G B;  2NQB B;  4YM6 B;  3LJA C;  3LJA A;  3MGQ C;  3W97 D;  4QLC C;  5AVB D;  3MGQ A;  4QLC A;  3IP4 C;  2RVQ D;  3W96 C;  5B31 B;  5F99 C;  3W96 A;  5F99 A;  3KXB B;  2HIO B;  1ID3 C;  4XUJ B;  1P3M B;  4J8V C;  3AZG D;  1F66 A;  1ID3 A;  2FJ7 D;  4J8V A;  3REH D;  2ZY4 A;  3X1T D;  2JE5 A;  5JRG D;  1KX4 C;  1KX4 A;  5AV8 D;  5B33 D;  3AZJ B;  1H3O A;  3AZK D;  3EPK A;  3W97 C;  1P3K D;  2RVQ C;  4WNN A;  3X1U B;  4CAY B;  2FJ7 C;  3AZG C;  1AOI D;  2FJ7 A;  4ZBJ C;  3VH6 A;  3REH C;  3AZG A;  5DNM D;  3REH A;  3X1T C;  3X1T A;  5JRG C;  5JRG A;  1ULY A;  5AV8 C;  5B33 C;  5AV8 A;  5B33 A;  3MGS B;  4DRA A;  3REI D;  4UUZ B;  5B2J B;  5JA4 B;  4Z66 D;  3AZK C;  5CPK B;  3AZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...