4KUDA

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudA00
5GXQB 1F66C 3MVDC 3B6GB 2IO5C 3LZ1D 5JRGD 3X1SA 5B24A 1AOID 4X23C 4Z2MH 5F99C 4XUJA 3REJA 3AZKD 4R8PC 4H9PB 1P3PC 5B1LC 2HIOC 5CPJD 3UTBD 3AZLD 3W98C 5AV5C 1P3AC 2PYOC 1U35B 3W99B 3KUYB 1HQ3B 5FUGA 5GXQD 1P3KC 4DRAA 3UT9A 4Z5TB 3B6GD 5B31A 4J8VB 5GT0C 4AWLC 3REHA 5B2JD 3X1VB 4HGAC 3AYWC 5B32A 5B33C 3AZNB 5BNXA 5AY8A 5CP6B 3W99D 3KUYD 1HQ3D 5AV6B 2NQBC 4Z5TD 4CAYA 4J8VD 3NQJB 3AV1C 5GSUC 2FJ7C 3X1VD 3LZ1C 3AV2B 5JRGC 3AZND 2CV5A 4LD9B 3C1BB 1ZLAA 5CP6D 4WZSB 4J8UC 5CPJC 3AZLC 1M19B 5AV6D 3AN2A 3KXBB 5GT3B 1M1AD 5GXQC 3UTAA 5BNVB 2AROB 1KX4B 3B6GC 2F8NH 3AV2D 1P3GD 1KX5B 3WA9B 4KGCB 4LD9D 5BT1D 3C1BD 3MGRB 5B1MD 1B6WA 1P34B 1M19D 3KXBD 2YFVB 5GT3D 3W99C 3KWQB 3KUYC 1U35C 3MGQA 2AROD 1KX4D 4Z5TC 2RVQD 3X1UC 4J8VC 3MGPB 3AZGA 1N1JA 4H9OA 4H9NA 1KX5D 3WA9D 4KGCD 5DNMD 3R45A 2HUEB 3X1VC 3MNND 3B6FB 3LELA 3AZNC 1P34D 4KHAB 4JJND 1ULYA 3WAAB 5B0YB 2NZDB 3MGSD 1M18B 1P3MB 5AV6C 5B40B 5JA4A 3MGPD 3A6NB 1P3IA 3NQUA 1BH8A 2IO5B 3B6FD 5CPKA 4G92B 2F8NG 3REKA 5AVCB 4LD9C 5AV9A 4X23B 5BT1C 1TZYA 5B0YD 3C1BC 2NZDD 3WTPB 1S32A 1M18D 2HIOB 2YFWB 3REIB 1P3MD 1M19C 5AVBA 5B40D 3KXBC 2PYOB 5B2IA 1TAFB 5GT3C 5B24C 3W96B 2AROC 1KX4C 2RVQC 4J8XA 3AZIB 1EQZB 1AOIA 4QLCB 5AVCD 1KX5C 4X23D 4KGCC 3AZKA 5B0ZA 3WTPD 4R8PD 4HGAB 1P3PD 5B1LD 3MGRC 2HIOD 3UTBA 1P34C 5AV5D 1JFIA 2PYOD 3WKJB 3KWQC 3W96D 3TU4B 3V9RB 1P3KD 3AZMB 4J8WB 5GT0D 4YM6A 5C3IB 5AV8A 1EQZD 5B2JA 2FJ7B 3AFAB 3B6FC 3AZFA 3AYWD 3AZEB 5B32G 3AZHA 3WAAC 3C1CA 5B0YC 3LJAA 3W97B 4WNNA 1P3MC 5E5AB 4H9QA 4WU9B 5B40C 3AZMD 4J8WD 3A6NC 4ZUXA 4UUZB 5GSUD 3AZJA 1ZLAC 2FJ7D 3AFAD 2JSSA 4G92C 5AVCC 4Z66A 4H9SA 3WTPC 4J8UD 3UTAC 3REIC 4ZBJB 5E5AD 4WU9D 2BYMB 1M1AA 3W96C 3VH5W 4CSRB 1P3OC 3X1UB 5DNNB 1P3GA 3AZIC 1EQZC 4QLCC 5BS7A 1P3LA 5B1MA 5BO0A 3X1TB 4E45A 1U35D 3WKJC 3TU4C 4YS3B 3AZMC 3X1UD 4J8WC 1ID3B 2F8NB 5DNND 5C3IC 5DNMA 5KDMA 3LZ0B 3MNNA 3RELA 3AFAC 3O62B 3AZEC 5CPIA 4JJNA 1BH9B 3MGSA 1KX3A 3W97C 5E5AC 4WU9C 4KUDA 4YS3D 1ID3D 3X1SB 5B24B 3REJB 4XUJB 4EO5B 1H3OA 3O62D 5FUGB 4WU8A 1P3BA 3UT9B 5B31B 4ZBJC 4XZQA 3X1SD 3REHB 5B24D 1F66A 3VH6W 4XUJD 3MVDA 5B32B 4H9RA 5DNNC 1P3FA 1R4VA 5BNXB 5AY8B 5F99A 4R8PA 1P3PA 5B1LA 1BFMA 4NE6A 3MGRD 3X1TC 5G49A 3W98A 3UT9D 5AV5A 5B31D 4CAYB 1P3AA 5CHLB 3KWQD 1P3KA 3AZFC 5GT0A 4YS3C 1ID3C 2CV5B 3C1CC 1ZLAB 5AY8D 3LZ0C 3AYWA 3O62C 5B33A 3AN2B 3WAAD 2BYKB 3UTAB 2NQBA 2CV5D 3A6ND 3X1SC 3AV1A 5GSUA 1ZLAD 3REJC 4XUJC 4EO5C 1P3OB 3LZ1A 5JRGA 4J8UA 3MGQB 3UTAD 5CPJA 3AZLA 3REID 3UT9C 5B31C 3VH5A 3AZGB 1N1JB 4H9OB 4H9NB 3REHC 5GXQA 3R45B 5BS7C 1P3LC 1P3OD 3B6GA 3LELB 5B32C 3AZID 5AY8C 4QLCD 4H9PA 2F8NK 3MGQD 5JA4B 1P3IB 3AZGD 3NQUB 3WTPE 1Q9CA 3KUYA 1U35A 3W99A 1HQ3A 3WKJD 1BH8B 3TU4D 4Z5TA 5CPKB 3B0DB 3LELD 3KSYA 4J8VA 3REKB 2CV5C 1A7WA 5AV9B 1TZYB 1S32B 3X1VA 1KX3C 1HTAA 3AZED 5AVBB 3AZNA 3AN2C 5B2IB 5CP6A 1P3ID 3W97D 5AV6A 4J8XB 3NQJA 3REKD 1AOIB 5AV9D 3AZKB 1TZYD 4NE3A 5B0ZB 1P3BC 3UTBB 3AV2A 1JFIB 4LD9A 5B2ID 3C1BA 3MGQC 3B0BA 1M19A 3VH6A 3KXBA 4YM6B 4J8XD 5AV8B 3AZGC 5GT3A 1P3FC 5B2JB 5B0ZD 5BNVA 2AROA 3AZFB 1KX4A 3LELC 3AZHB 3C1CB 1KX5A 3WA9A 4KGCA 3LJAB 4WNNB 3MGRA 3B0CW 3X1TD 4H9QB 1P34A 4YM6D 2YFVA 5AV8D 1P3IC 4ZUXB 3VH6T 3KWQA 3AZJB 1F1EA 3AZFD 5CPKC 3B0DC 3MGPA 2F8ND 3AZHD 3REKC 5AV9C 3C1CD 1TZYC 4NE5A 4Z66B 1S32C 3LJAD 3LZ0D 3B6FA 2L5AA 5AVBC 4KHAA 3WAAA 5B2IC 1M1AB 5B0YA 2NZDA 4ZUXD 3AZJD 1M18A 1P3MA 5B40A 4J8XC 1P3GB 3A6NA 1AOIC 3REJD 3AZKC 1P3LB 5B0ZC 5B1MB 4Z2MG 5BO0B 4Z66D 3UTBC 5AVCA 4X23A 2BYKA 3WTPA 2HIOA 2YFWA 3REIA 2PYOA 4YM6C 1TAFA 5AV8C 3REHD 5DNMB 5B2JC 3W96A 5KDMB 3MNNB 3RELB 1P3LD 1P3OA 5CPIB 5B32D 4JJNB 3AZIA 3AZHC 1EQZA 4QLCA 3MGSB 1WWIA 1HQ3C 3LJAC 1KX3B 4KUDB 2CWEA 4WV4B 1B67A 4ZUXC 3AZJC 3WKJA 3TU4A 1H3OB 3V9RA 3RELD 4E44A 3AZMA 4J8WA 5CPID 5CP6C 1P3BB 4WU8B 4Z66C 4H9SC 3AFAA 2FJ7A 1KX3D 3AZEA 3AN2D 4KUDD 4XZQB 4G91B 1M1AC 1F66B 2LY8A 3W97A 3MVDB 5E5AA 4WU9A 4H9RB 3AV2C 1P3GC 1P3FB 5F99B 4UUZA 4R8PB 1P3BD 5B1LB 5B1MC 4WU8D 1P3PB 5G49B 3W98B 4M6BA 5AV5B 1P3AB 4XZQD 4DRBA 1F66D 1P3KB 3MVDD 5GT0B 2BYMA 4AWLB 1P3FD 3WA9C 5F99D 3VH5T 5DNMC 4CSRA 3MNNC 3RELC 3AYWB 3X1UA 5B33B 5CPIC 3W98D 5DNNA 4JJNC 1P3AD 3MGSC 3X1TA 4NFTA 2NQBB 5B31G 1KU5A 1WWSA 4KUDC 3MGPC 3AV1B 5GSUB 2HUEC 3LZ1B 4YS3A 5CPKD 1ID3A 5JRGB 5B33D 2F8NA 2NZDC 4J8UB 1S32D 3LZ0A 3B0CT 4WU8C 5CPJB 3AZLB 1M18C 3O62A 2NQBD 5AVBD 1BH9A 4XZQC 4G91C 3AV1D
chains in the Genus database with same CATH superfamily
5GXQB 1F66C 3MVDC 3B6GB 2IO5C 3LZ1D 5JRGD 3X1SA 5B24A 1AOID 4X23C 4Z2MH 3F6TA 4XUJA 1T3UA 5F99C 3REJA 4R8PC 3AZKD 1PZRA 4H9PB 5B1LC 1P3PC 2HIOC 5CPJD 3UTBD 3AZLD 2Y2OA 3W98C 5AV5C 1P3AC 2PYOC 1U35B 3W99B 3KUYB 1HQ3B 2DF4C 5FUGA 5GXQD 1P3KC 4DRAA 3UT9A 4Z5TB 3B6GD 5B31A 4J8VB 5GT0C 4AWLC 3REHA 5B2JD 3X1VB 3A1KA 4HGAC 3AYWC 5B32A 5B33C 3AZNB 5BNXA 5AY8A 5CP6B 3W99D 3KUYD 1HQ3D 5AV6B 2NQBC 4Z5TD 4CAYA 4J8VD 3NQJB 3AV1C 5GSUC 2FJ7C 3X1VD 3LZ1C 2XD5A 3AV2B 5JRGC 3AZND 2CV5A 4LD9B 3C1BB 1ZLAA 5CP6D 4WZSB 4J8UC 5CPJC 3AZLC 1M19B 5AV6D 3AN2A 3KXBB 3A1IA 5GT3B 1M1AD 5GXQC 3UTAA 5BNVB 2AROB 1KX4B 3B6GC 2F8NH 3AV2D 1P3GD 1KX5B 3WA9B 4KGCB 4LD9D 5BT1D 3C1BD 2Y2QA 3MGRB 5B1MD 1B6WA 1P34B 1M19D 3KXBD 2YFVB 5GT3D 3W99C 3KWQB 2G5IC 3KUYC 1U35C 2RIQA 3MGQA 2AROD 1KX4D 4Z5TC 2RVQD 3X1UC 4J8VC 3MGPB 3AZGA 1N1JA 4H9OA 4H9NA 1KX5D 3WA9D 4KGCD 5DNMD 3R45A 2HUEB 3X1VC 3MNND 3B6FB 3LELA 3AZNC 1P34D 4KHAB 4JJND 1ULYA 3WAAB 5B0YB 2NZDB 3MGSD 1M18B 1P3MB 5AV6C 5B40B 3EG5B 5JA4A 3MGPD 3A6NB 1P3IA 3NQUA 1BH8A 2IO5B 3B6FD 5CPKA 4G92B 2F8NG 3REKA 5AVCB 4LD9C 5AV9A 4X23B 5BT1C 1TZYA 5B0YD 3C1BC 2NZDD 3WTPB 1S32A 1M18D 2HIOB 2YFWB 3REIB 1P3MD 1M19C 5AVBA 5B40D 3KXBC 2PYOB 5B2IA 1TAFB 5GT3C 5B24C 3W96B 2AROC 1KX4C 2RVQC 4J8XA 3AZIB 1EQZB 1AOIA 4QLCB 5AVCD 1KX5C 4X23D 4KGCC 3AZKA 5B0ZA 3WTPD 4R8PD 4HGAB 1P3PD 5B1LD 3MGRC 2HIOD 3UTBA 1P34C 5AV5D 1JFIA 2PYOD 3WKJB 3KWQC 3W96D 3TU4B 3V9RB 1P3KD 3AZMB 4J8WB 5GT0D 2Y2PA 4YM6A 5C3IB 5AV8A 1EQZD 5B2JA 2FJ7B 3AFAB 3B6FC 3AZFA 3AYWD 3AZEB 5B32G 3AZHA 3WAAC 3C1CA 5B0YC 3H0LC 2Y2GA 3LJAA 3W97B 4WNNA 1P3MC 5E5AB 4H9QA 4WU9B 5B40C 3AZMD 4J8WD 3A6NC 4ZUXA 4UUZB 5GSUD 3AZJA 1ZLAC 2FJ7D 3AFAD 2BG1A 2JSSA 4G92C 5AVCC 2Y2NA 4Z66A 4H9SA 3WTPC 4J8UD 3UTAC 3REIC 2JCHA 4ZBJB 5E5AD 4WU9D 2BYMB 1M1AA 2JE5A 4WJ3C 3FDDA 3W96C 3VH5W 4CSRB 4DQYB 1P3OC 3X1UB 5DNNB 1P3GA 3AZIC 3H0MC 2VQRA 1EQZC 4QLCC 5BS7A 1P3LA 5B1MA 5BO0A 3X1TB 2J8PA 4E45A 1U35D 3WKJC 3TU4C 2Y2LA 4YS3B 3AZMC 3X1UD 4J8WC 1ID3B 2F8NB 5DNND 5C3IC 5DNMA 5KDMA 3LZ0B 3MNNA 3RELA 3AFAC 3O62B 3AZEC 5CPIA 4JJNA 1BH9B 3MGSA 1KX3A 2Y2IA 3W97C 5E5AC 4WU9C 4KUDA 4YS3D 1ID3D 3X1SB 5B24B 3REJB 4XUJB 4EO5B 1H3OA 3O62D 2Y2JA 5FUGB 4WU8A 1P3BA 3UT9B 5B31B 4ZBJC 4XZQA 3X1SD 3REHB 5B24D 1F66A 3VH6W 4XUJD 3MVDA 5B32B 4H9RA 5DNNC 1P3FA 1R4VA 2ZY3A 5BNXB 2F2AC 5AY8B 5F99A 2ZY2A 4R8PA 1P3PA 5B1LA 1BFMA 4NE6A 3MGRD 3X1TC 5G49A 3W98A 3UT9D 5AV5A 1W2EA 4CAYB 5B31D 1P3AA 5CHLB 2ZY4A 3KWQD 1P3KA 3AZFC 5GT0A 4YS3C 1ID3C 2CV5B 2UWXA 3C1CC 1ZLAB 5AY8D 3LZ0C 3AYWA 3O62C 5B33A 3AN2B 3WAAD 2BYKB 3UTAB 2NQBA 2CV5D 3A6ND 3X1SC 3AV1A 5GSUA 1ZLAD 3REJC 4XUJC 4EO5C 1P3OB 3LZ1A 5JRGA 4J8UA 3MGQB 3UTAD 5CPJA 3AZLA 3REID 3UT9C 2FFFB 5B31C 3VH5A 3AZGB 1N1JB 4H9OB 4H9NB 3REHC 3KFUG 5GXQA 3R45B 5BS7C 1P3LC 1P3OD 3B6GA 3LELB 5B32C 3AZID 5AY8C 4QLCD 4H9PA 2F8NK 3MGQD 5JA4B 1P3IB 3AZGD 3NQUB 3WTPE 1Q9CA 3KUYA 1U35A 3W99A 1HQ3A 3WKJD 1BH8B 3TU4D 4Z5TA 5CPKB 3B0DB 3LELD 3KSYA 4J8VA 2DQNC 3REKB 2CV5C 1A7WA 5AV9B 1TZYB 1S32B 3X1VA 1KX3C 1HTAA 3AZED 5AVBB 3AZNA 3AN2C 5B2IB 5CP6A 1P3ID 3W97D 5AV6A 4J8XB 3NQJA 3REKD 1AOIB 5AV9D 3AZKB 1TZYD 4NE3A 5B0ZB 1P3BC 3UTBB 3AV2A 1JFIB 4LD9A 5B2ID 3C1BA 3MGQC 2ZY5A 3B0BA 1M19A 3VH6A 3EPJA 3KXBA 3P5JB 4YM6B 4J8XD 5AV8B 3AZGC 5GT3A 1P3FC 5B2JB 5B0ZD 5BNVA 2AROA 3AZFB 1KX4A 3LELC 3AZHB 3C1CB 1KX5A 3WA9A 3EPLA 4KGCA 3LJAB 4WNNB 2Y2KA 3MGRA 3B0CW 3X1TD 4H9QB 1P34A 2YFVA 4YM6D 5AV8D 1P3IC 4ZUXB 3VH6T 3KWQA 3AZJB 1F1EA 2XD1A 3AZFD 5CPKC 3B0DC 3MGPA 2F8ND 3AZHD 2Y2MA 3REKC 5AV9C 3C1CD 1TZYC 4NE5A 4Z66B 1S32C 1Z2CB 3LJAD 3LZ0D 3B6FA 2L5AA 5AVBC 4KHAA 3WAAA 5B2IC 1M1AB 5B0YA 2G5HC 2NZDA 4ZUXD 3AZJD 1M18A 1P3MA 5B40A 4J8XC 1P3GB 3A6NA 1AOIC 3REJD 3AZKC 1P3LB 5B0ZC 5B1MB 4Z2MG 5BO0B 4Z66D 3UTBC 5AVCA 4X23A 2BYKA 3WTPA 2HIOA 2YFWA 3REIA 2PYOA 4YM6C 1TAFA 5AV8C 3REHD 5DNMB 5B2JC 3W96A 5KDMB 3MNNB 3RELB 1P3LD 1P3OA 5CPIB 5B32D 4JJNB 3AZIA 3AZHC 1EQZA 4QLCA 3MGSB 1WWIA 1HQ3C 3LJAC 1KX3B 4KUDB 2CWEA 4WV4B 1B67A 4ZUXC 3AZJC 3WKJA 3TU4A 1H3OB 3V9RA 3RELD 4E44A 3AZMA 3EPHA 4J8WA 5CPID 5CP6C 1P3BB 4WU8B 4Z66C 4H9SC 3AFAA 2FJ7A 1KX3D 3AZEA 3AN2D 4KUDD 4XZQB 4G91B 2W8SA 1M1AC 1F66B 2LY8A 3W97A 3MVDB 5E5AA 4WU9A 3IP4C 4H9RB 3AV2C 1P3GC 1P3FB 5F99B 4UUZA 4R8PB 2Y2HA 1P3BD 5B1LB 5B1MC 2ZM5A 4WU8D 1P3PB 5G49B 3W98B 4M6BA 5AV5B 1P3AB 3EPKA 4XZQD 4DRBA 1F66D 1P3KB 3MVDD 5GT0B 2BYMA 4AWLB 1P3FD 3AL0C 3WA9C 5F99D 3VH5T 5DNMC 4CSRA 4UPKA 3MNNC 3RELC 3AYWB 3X1UA 5B33B 5CPIC 3W98D 5DNNA 4JJNC 1P3AD 3MGSC 3X1TA 4NFTA 2NQBB 5B31G 1KU5A 1WWSA 4KUDC 3MGPC 3AV1B 5GSUB 2HUEC 3LZ1B 4YS3A 5CPKD 1ID3A 5JRGB 5B33D 2F8NA 3H0RC 2NZDC 4J8UB 1S32D 3LZ0A 3B0CT 4WU8C 5CPJB 3AZLB 1M18C 3O62A 2NQBD 5AVBD 1BH9A 4XZQC 4G91C 3AV1D
chains in the Genus database with same CATH topology
5GXQB 1F66C 3MVDC 3B6GB 2IO5C 3LZ1D 5JRGD 3X1SA 5B24A 1AOID 4X23C 4Z2MH 3F6TA 4XUJA 1T3UA 5F99C 3REJA 4R8PC 3AZKD 1PZRA 4H9PB 5B1LC 1P3PC 2HIOC 5CPJD 3UTBD 3AZLD 2Y2OA 3W98C 5AV5C 1P3AC 2PYOC 1U35B 3W99B 3KUYB 1HQ3B 2DF4C 5FUGA 5GXQD 1P3KC 4DRAA 3UT9A 4Z5TB 3B6GD 5B31A 4J8VB 5GT0C 4AWLC 3REHA 5B2JD 3X1VB 3A1KA 4HGAC 3AYWC 5B32A 5B33C 3AZNB 5BNXA 5AY8A 5CP6B 3W99D 3KUYD 1HQ3D 5AV6B 2NQBC 4Z5TD 4CAYA 4J8VD 3NQJB 3AV1C 5GSUC 2FJ7C 3X1VD 3LZ1C 2XD5A 3AV2B 5JRGC 3AZND 2CV5A 4LD9B 3C1BB 1ZLAA 5CP6D 4WZSB 4J8UC 5CPJC 3AZLC 1M19B 5AV6D 3AN2A 3KXBB 3A1IA 5GT3B 1M1AD 5GXQC 3UTAA 5BNVB 2AROB 1KX4B 3B6GC 2F8NH 3AV2D 1P3GD 1KX5B 3WA9B 4KGCB 4LD9D 5BT1D 3C1BD 2Y2QA 3MGRB 5B1MD 1B6WA 1P34B 1M19D 3KXBD 2YFVB 5GT3D 3W99C 3KWQB 2G5IC 3KUYC 1U35C 2RIQA 3MGQA 2AROD 1KX4D 4Z5TC 2RVQD 3X1UC 4J8VC 3MGPB 3AZGA 1N1JA 4H9OA 4H9NA 1KX5D 3WA9D 4KGCD 5DNMD 3R45A 2HUEB 3X1VC 3MNND 3B6FB 3LELA 3AZNC 1P34D 4KHAB 4JJND 1ULYA 3WAAB 5B0YB 2NZDB 3MGSD 1M18B 1P3MB 5AV6C 5B40B 3EG5B 5JA4A 3MGPD 3A6NB 1P3IA 3NQUA 1BH8A 2IO5B 3B6FD 5CPKA 4G92B 2F8NG 3REKA 5AVCB 4LD9C 5AV9A 4X23B 5BT1C 1TZYA 5B0YD 3C1BC 2NZDD 3WTPB 1S32A 1M18D 2HIOB 2YFWB 3REIB 1P3MD 1M19C 5AVBA 5B40D 3KXBC 2PYOB 5B2IA 1TAFB 5GT3C 5B24C 3W96B 2AROC 1KX4C 2RVQC 4J8XA 3AZIB 1EQZB 1AOIA 4QLCB 5AVCD 1KX5C 4X23D 4KGCC 3AZKA 5B0ZA 3WTPD 4R8PD 4HGAB 1P3PD 5B1LD 3MGRC 2HIOD 3UTBA 1P34C 5AV5D 1JFIA 2PYOD 3WKJB 3KWQC 3W96D 3TU4B 3V9RB 1P3KD 3AZMB 4J8WB 5GT0D 2Y2PA 4YM6A 5C3IB 5AV8A 1EQZD 5B2JA 2FJ7B 3AFAB 3B6FC 3AZFA 3AYWD 3AZEB 5B32G 3AZHA 3WAAC 3C1CA 5B0YC 3H0LC 2Y2GA 3LJAA 3W97B 4WNNA 1P3MC 5E5AB 4H9QA 4WU9B 5B40C 3AZMD 4J8WD 3A6NC 4ZUXA 4UUZB 5GSUD 3AZJA 1ZLAC 2FJ7D 3AFAD 2BG1A 2JSSA 4G92C 5AVCC 2Y2NA 4Z66A 4H9SA 3WTPC 4J8UD 3UTAC 3REIC 2JCHA 4ZBJB 5E5AD 4WU9D 2BYMB 1M1AA 2JE5A 4WJ3C 3FDDA 3W96C 3VH5W 4CSRB 4DQYB 1P3OC 3X1UB 5DNNB 1P3GA 3AZIC 3H0MC 2VQRA 1EQZC 4QLCC 5BS7A 1P3LA 5B1MA 5BO0A 3X1TB 2J8PA 4E45A 1U35D 3WKJC 3TU4C 2Y2LA 4YS3B 3AZMC 3X1UD 4J8WC 1ID3B 2F8NB 5DNND 5C3IC 5DNMA 5KDMA 3LZ0B 3MNNA 3RELA 3AFAC 3O62B 3AZEC 5CPIA 4JJNA 1BH9B 3MGSA 1KX3A 2Y2IA 3W97C 5E5AC 4WU9C 4KUDA 4YS3D 1ID3D 3X1SB 5B24B 3REJB 4XUJB 4EO5B 1H3OA 3O62D 2Y2JA 5FUGB 4WU8A 1P3BA 3UT9B 5B31B 4ZBJC 4XZQA 3X1SD 3REHB 5B24D 1F66A 3VH6W 4XUJD 3MVDA 5B32B 4H9RA 5DNNC 1P3FA 1R4VA 2ZY3A 5BNXB 2F2AC 5AY8B 5F99A 2ZY2A 4R8PA 1P3PA 5B1LA 1BFMA 4NE6A 3MGRD 3X1TC 5G49A 3W98A 3UT9D 5AV5A 1W2EA 4CAYB 5B31D 1P3AA 5CHLB 2ZY4A 3KWQD 1P3KA 3AZFC 5GT0A 4YS3C 1ID3C 2CV5B 2UWXA 3C1CC 1ZLAB 5AY8D 3LZ0C 3AYWA 3O62C 5B33A 3AN2B 3WAAD 2BYKB 3UTAB 2NQBA 2CV5D 3A6ND 3X1SC 3AV1A 5GSUA 1ZLAD 3REJC 4XUJC 4EO5C 1P3OB 3LZ1A 5JRGA 4J8UA 3MGQB 3UTAD 5CPJA 3AZLA 3REID 3UT9C 2FFFB 5B31C 3VH5A 3AZGB 1N1JB 4H9OB 4H9NB 3REHC 3KFUG 5GXQA 3R45B 5BS7C 1P3LC 1P3OD 3B6GA 3LELB 5B32C 3AZID 5AY8C 4QLCD 4H9PA 2F8NK 3MGQD 5JA4B 1P3IB 3AZGD 3NQUB 3WTPE 1Q9CA 3KUYA 1U35A 3W99A 1HQ3A 3WKJD 1BH8B 3TU4D 4Z5TA 5CPKB 3B0DB 3LELD 3KSYA 4J8VA 2DQNC 3REKB 2CV5C 1A7WA 5AV9B 1TZYB 1S32B 3X1VA 1KX3C 1HTAA 3AZED 5AVBB 3AZNA 3AN2C 5B2IB 5CP6A 1P3ID 3W97D 5AV6A 4J8XB 3NQJA 3REKD 1AOIB 5AV9D 3AZKB 1TZYD 4NE3A 5B0ZB 1P3BC 3UTBB 3AV2A 1JFIB 4LD9A 5B2ID 3C1BA 3MGQC 2ZY5A 3B0BA 1M19A 3VH6A 3EPJA 3KXBA 3P5JB 4YM6B 4J8XD 5AV8B 3AZGC 5GT3A 1P3FC 5B2JB 5B0ZD 5BNVA 2AROA 3AZFB 1KX4A 3LELC 3AZHB 3C1CB 1KX5A 3WA9A 3EPLA 4KGCA 3LJAB 4WNNB 2Y2KA 3MGRA 3B0CW 3X1TD 4H9QB 1P34A 2YFVA 4YM6D 5AV8D 1P3IC 4ZUXB 3VH6T 3KWQA 3AZJB 1F1EA 2XD1A 3AZFD 5CPKC 3B0DC 3MGPA 2F8ND 3AZHD 2Y2MA 3REKC 5AV9C 3C1CD 1TZYC 4NE5A 4Z66B 1S32C 1Z2CB 3LJAD 3LZ0D 3B6FA 2L5AA 5AVBC 4KHAA 3WAAA 5B2IC 1M1AB 5B0YA 2G5HC 2NZDA 4ZUXD 3AZJD 1M18A 1P3MA 5B40A 4J8XC 1P3GB 3A6NA 1AOIC 3REJD 3AZKC 1P3LB 5B0ZC 5B1MB 4Z2MG 5BO0B 4Z66D 3UTBC 5AVCA 4X23A 2BYKA 3WTPA 2HIOA 2YFWA 3REIA 2PYOA 4YM6C 1TAFA 5AV8C 3REHD 5DNMB 5B2JC 3W96A 5KDMB 3MNNB 3RELB 1P3LD 1P3OA 5CPIB 5B32D 4JJNB 3AZIA 3AZHC 1EQZA 4QLCA 3MGSB 1WWIA 1HQ3C 3LJAC 1KX3B 4KUDB 2CWEA 4WV4B 1B67A 4ZUXC 3AZJC 3WKJA 3TU4A 1H3OB 3V9RA 3RELD 4E44A 3AZMA 3EPHA 4J8WA 5CPID 5CP6C 1P3BB 4WU8B 4Z66C 4H9SC 3AFAA 2FJ7A 1KX3D 3AZEA 3AN2D 4KUDD 4XZQB 4G91B 2W8SA 1M1AC 1F66B 2LY8A 3W97A 3MVDB 5E5AA 4WU9A 3IP4C 4H9RB 3AV2C 1P3GC 1P3FB 5F99B 4UUZA 4R8PB 2Y2HA 1P3BD 5B1LB 5B1MC 2ZM5A 4WU8D 1P3PB 5G49B 3W98B 4M6BA 5AV5B 1P3AB 3EPKA 4XZQD 4DRBA 1F66D 1P3KB 3MVDD 5GT0B 2BYMA 4AWLB 1P3FD 3AL0C 3WA9C 5F99D 3VH5T 5DNMC 4CSRA 4UPKA 3MNNC 3RELC 3AYWB 3X1UA 5B33B 5CPIC 3W98D 5DNNA 4JJNC 1P3AD 3MGSC 3X1TA 4NFTA 2NQBB 5B31G 1KU5A 1WWSA 4KUDC 3MGPC 3AV1B 5GSUB 2HUEC 3LZ1B 4YS3A 5CPKD 1ID3A 5JRGB 5B33D 2F8NA 3H0RC 2NZDC 4J8UB 1S32D 3LZ0A 3B0CT 4WU8C 5CPJB 3AZLB 1M18C 3O62A 2NQBD 5AVBD 1BH9A 4XZQC 4G91C 3AV1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ B;  1F66 C;  3MVD C;  3B6G B;  2IO5 C;  3LZ1 D;  5JRG D;  3X1S A;  5B24 A;  1AOI D;  4X23 C;  4Z2M H;  5F99 C;  4XUJ A;  3REJ A;  3AZK D;  4R8P C;  4H9P B;  1P3P C;  5B1L C;  2HIO C;  5CPJ D;  3UTB D;  3AZL D;  3W98 C;  5AV5 C;  1P3A C;  2PYO C;  1U35 B;  3W99 B;  3KUY B;  1HQ3 B;  5FUG A;  5GXQ D;  1P3K C;  4DRA A;  3UT9 A;  4Z5T B;  3B6G D;  5B31 A;  4J8V B;  5GT0 C;  4AWL C;  3REH A;  5B2J D;  3X1V B;  4HGA C;  3AYW C;  5B32 A;  5B33 C;  3AZN B;  5BNX A;  5AY8 A;  5CP6 B;  3W99 D;  3KUY D;  1HQ3 D;  5AV6 B;  2NQB C;  4Z5T D;  4CAY A;  4J8V D;  3NQJ B;  3AV1 C;  5GSU C;  2FJ7 C;  3X1V D;  3LZ1 C;  3AV2 B;  5JRG C;  3AZN D;  2CV5 A;  4LD9 B;  3C1B B;  1ZLA A;  5CP6 D;  4WZS B;  4J8U C;  5CPJ C;  3AZL C;  1M19 B;  5AV6 D;  3AN2 A;  3KXB B;  5GT3 B;  1M1A D;  5GXQ C;  3UTA A;  5BNV B;  2ARO B;  1KX4 B;  3B6G C;  2F8N H;  3AV2 D;  1P3G D;  1KX5 B;  3WA9 B;  4KGC B;  4LD9 D;  5BT1 D;  3C1B D;  3MGR B;  5B1M D;  1B6W A;  1P34 B;  1M19 D;  3KXB D;  2YFV B;  5GT3 D;  3W99 C;  3KWQ B;  3KUY C;  1U35 C;  3MGQ A;  2ARO D;  1KX4 D;  4Z5T C;  2RVQ D;  3X1U C;  4J8V C;  3MGP B;  3AZG A;  1N1J A;  4H9O A;  4H9N A;  1KX5 D;  3WA9 D;  4KGC D;  5DNM D;  3R45 A;  2HUE B;  3X1V C;  3MNN D;  3B6F B;  3LEL A;  3AZN C;  1P34 D;  4KHA B;  4JJN D;  1ULY A;  3WAA B;  5B0Y B;  2NZD B;  3MGS D;  1M18 B;  1P3M B;  5AV6 C;  5B40 B;  5JA4 A;  3MGP D;  3A6N B;  1P3I A;  3NQU A;  1BH8 A;  2IO5 B;  3B6F D;  5CPK A;  4G92 B;  2F8N G;  3REK A;  5AVC B;  4LD9 C;  5AV9 A;  4X23 B;  5BT1 C;  1TZY A;  5B0Y D;  3C1B C;  2NZD D;  3WTP B;  1S32 A;  1M18 D;  2HIO B;  2YFW B;  3REI B;  1P3M D;  1M19 C;  5AVB A;  5B40 D;  3KXB C;  2PYO B;  5B2I A;  1TAF B;  5GT3 C;  5B24 C;  3W96 B;  2ARO C;  1KX4 C;  2RVQ C;  4J8X A;  3AZI B;  1EQZ B;  1AOI A;  4QLC B;  5AVC D;  1KX5 C;  4X23 D;  4KGC C;  3AZK A;  5B0Z A;  3WTP D;  4R8P D;  4HGA B;  1P3P D;  5B1L D;  3MGR C;  2HIO D;  3UTB A;  1P34 C;  5AV5 D;  1JFI A;  2PYO D;  3WKJ B;  3KWQ C;  3W96 D;  3TU4 B;  3V9R B;  1P3K D;  3AZM B;  4J8W B;  5GT0 D;  4YM6 A;  5C3I B;  5AV8 A;  1EQZ D;  5B2J A;  2FJ7 B;  3AFA B;  3B6F C;  3AZF A;  3AYW D;  3AZE B;  5B32 G;  3AZH A;  3WAA C;  3C1C A;  5B0Y C;  3LJA A;  3W97 B;  4WNN A;  1P3M C;  5E5A B;  4H9Q A;  4WU9 B;  5B40 C;  3AZM D;  4J8W D;  3A6N C;  4ZUX A;  4UUZ B;  5GSU D;  3AZJ A;  1ZLA C;  2FJ7 D;  3AFA D;  2JSS A;  4G92 C;  5AVC C;  4Z66 A;  4H9S A;  3WTP C;  4J8U D;  3UTA C;  3REI C;  4ZBJ B;  5E5A D;  4WU9 D;  2BYM B;  1M1A A;  3W96 C;  3VH5 W;  4CSR B;  1P3O C;  3X1U B;  5DNN B;  1P3G A;  3AZI C;  1EQZ C;  4QLC C;  5BS7 A;  1P3L A;  5B1M A;  5BO0 A;  3X1T B;  4E45 A;  1U35 D;  3WKJ C;  3TU4 C;  4YS3 B;  3AZM C;  3X1U D;  4J8W C;  1ID3 B;  2F8N B;  5DNN D;  5C3I C;  5DNM A;  5KDM A;  3LZ0 B;  3MNN A;  3REL A;  3AFA C;  3O62 B;  3AZE C;  5CPI A;  4JJN A;  1BH9 B;  3MGS A;  1KX3 A;  3W97 C;  5E5A C;  4WU9 C;  4KUD A;  4YS3 D;  1ID3 D;  3X1S B;  5B24 B;  3REJ B;  4XUJ B;  4EO5 B;  1H3O A;  3O62 D;  5FUG B;  4WU8 A;  1P3B A;  3UT9 B;  5B31 B;  4ZBJ C;  4XZQ A;  3X1S D;  3REH B;  5B24 D;  1F66 A;  3VH6 W;  4XUJ D;  3MVD A;  5B32 B;  4H9R A;  5DNN C;  1P3F A;  1R4V A;  5BNX B;  5AY8 B;  5F99 A;  4R8P A;  1P3P A;  5B1L A;  1BFM A;  4NE6 A;  3MGR D;  3X1T C;  5G49 A;  3W98 A;  3UT9 D;  5AV5 A;  5B31 D;  4CAY B;  1P3A A;  5CHL B;  3KWQ D;  1P3K A;  3AZF C;  5GT0 A;  4YS3 C;  1ID3 C;  2CV5 B;  3C1C C;  1ZLA B;  5AY8 D;  3LZ0 C;  3AYW A;  3O62 C;  5B33 A;  3AN2 B;  3WAA D;  2BYK B;  3UTA B;  2NQB A;  2CV5 D;  3A6N D;  3X1S C;  3AV1 A;  5GSU A;  1ZLA D;  3REJ C;  4XUJ C;  4EO5 C;  1P3O B;  3LZ1 A;  5JRG A;  4J8U A;  3MGQ B;  3UTA D;  5CPJ A;  3AZL A;  3REI D;  3UT9 C;  5B31 C;  3VH5 A;  3AZG B;  1N1J B;  4H9O B;  4H9N B;  3REH C;  5GXQ A;  3R45 B;  5BS7 C;  1P3L C;  1P3O D;  3B6G A;  3LEL B;  5B32 C;  3AZI D;  5AY8 C;  4QLC D;  4H9P A;  2F8N K;  3MGQ D;  5JA4 B;  1P3I B;  3AZG D;  3NQU B;  3WTP E;  1Q9C A;  3KUY A;  1U35 A;  3W99 A;  1HQ3 A;  3WKJ D;  1BH8 B;  3TU4 D;  4Z5T A;  5CPK B;  3B0D B;  3LEL D;  3KSY A;  4J8V A;  3REK B;  2CV5 C;  1A7W A;  5AV9 B;  1TZY B;  1S32 B;  3X1V A;  1KX3 C;  1HTA A;  3AZE D;  5AVB B;  3AZN A;  3AN2 C;  5B2I B;  5CP6 A;  1P3I D;  3W97 D;  5AV6 A;  4J8X B;  3NQJ A;  3REK D;  1AOI B;  5AV9 D;  3AZK B;  1TZY D;  4NE3 A;  5B0Z B;  1P3B C;  3UTB B;  3AV2 A;  1JFI B;  4LD9 A;  5B2I D;  3C1B A;  3MGQ C;  3B0B A;  1M19 A;  3VH6 A;  3KXB A;  4YM6 B;  4J8X D;  5AV8 B;  3AZG C;  5GT3 A;  1P3F C;  5B2J B;  5B0Z D;  5BNV A;  2ARO A;  3AZF B;  1KX4 A;  3LEL C;  3AZH B;  3C1C B;  1KX5 A;  3WA9 A;  4KGC A;  3LJA B;  4WNN B;  3MGR A;  3B0C W;  3X1T D;  4H9Q B;  1P34 A;  4YM6 D;  2YFV A;  5AV8 D;  1P3I C;  4ZUX B;  3VH6 T;  3KWQ A;  3AZJ B;  1F1E A;  3AZF D;  5CPK C;  3B0D C;  3MGP A;  2F8N D;  3AZH D;  3REK C;  5AV9 C;  3C1C D;  1TZY C;  4NE5 A;  4Z66 B;  1S32 C;  3LJA D;  3LZ0 D;  3B6F A;  2L5A A;  5AVB C;  4KHA A;  3WAA A;  5B2I C;  1M1A B;  5B0Y A;  2NZD A;  4ZUX D;  3AZJ D;  1M18 A;  1P3M A;  5B40 A;  4J8X C;  1P3G B;  3A6N A;  1AOI C;  3REJ D;  3AZK C;  1P3L B;  5B0Z C;  5B1M B;  4Z2M G;  5BO0 B;  4Z66 D;  3UTB C;  5AVC A;  4X23 A;  2BYK A;  3WTP A;  2HIO A;  2YFW A;  3REI A;  2PYO A;  4YM6 C;  1TAF A;  5AV8 C;  3REH D;  5DNM B;  5B2J C;  3W96 A;  5KDM B;  3MNN B;  3REL B;  1P3L D;  1P3O A;  5CPI B;  5B32 D;  4JJN B;  3AZI A;  3AZH C;  1EQZ A;  4QLC A;  3MGS B;  1WWI A;  1HQ3 C;  3LJA C;  1KX3 B;  4KUD B;  2CWE A;  4WV4 B;  1B67 A;  4ZUX C;  3AZJ C;  3WKJ A;  3TU4 A;  1H3O B;  3V9R A;  3REL D;  4E44 A;  3AZM A;  4J8W A;  5CPI D;  5CP6 C;  1P3B B;  4WU8 B;  4Z66 C;  4H9S C;  3AFA A;  2FJ7 A;  1KX3 D;  3AZE A;  3AN2 D;  4KUD D;  4XZQ B;  4G91 B;  1M1A C;  1F66 B;  2LY8 A;  3W97 A;  3MVD B;  5E5A A;  4WU9 A;  4H9R B;  3AV2 C;  1P3G C;  1P3F B;  5F99 B;  4UUZ A;  4R8P B;  1P3B D;  5B1L B;  5B1M C;  4WU8 D;  1P3P B;  5G49 B;  3W98 B;  4M6B A;  5AV5 B;  1P3A B;  4XZQ D;  4DRB A;  1F66 D;  1P3K B;  3MVD D;  5GT0 B;  2BYM A;  4AWL B;  1P3F D;  3WA9 C;  5F99 D;  3VH5 T;  5DNM C;  4CSR A;  3MNN C;  3REL C;  3AYW B;  3X1U A;  5B33 B;  5CPI C;  3W98 D;  5DNN A;  4JJN C;  1P3A D;  3MGS C;  3X1T A;  4NFT A;  2NQB B;  5B31 G;  1KU5 A;  1WWS A;  4KUD C;  3MGP C;  3AV1 B;  5GSU B;  2HUE C;  3LZ1 B;  4YS3 A;  5CPK D;  1ID3 A;  5JRG B;  5B33 D;  2F8N A;  2NZD C;  4J8U B;  1S32 D;  3LZ0 A;  3B0C T;  4WU8 C;  5CPJ B;  3AZL B;  1M18 C;  3O62 A;  2NQB D;  5AVB D;  1BH9 A;  4XZQ C;  4G91 C;  3AV1 D; 
#chains in the Genus database with same CATH topology
 5GXQ B;  1F66 C;  3MVD C;  3B6G B;  2IO5 C;  3LZ1 D;  5JRG D;  3X1S A;  5B24 A;  1AOI D;  4X23 C;  4Z2M H;  3F6T A;  4XUJ A;  1T3U A;  5F99 C;  3REJ A;  4R8P C;  3AZK D;  1PZR A;  4H9P B;  5B1L C;  1P3P C;  2HIO C;  5CPJ D;  3UTB D;  3AZL D;  2Y2O A;  3W98 C;  5AV5 C;  1P3A C;  2PYO C;  1U35 B;  3W99 B;  3KUY B;  1HQ3 B;  2DF4 C;  5FUG A;  5GXQ D;  1P3K C;  4DRA A;  3UT9 A;  4Z5T B;  3B6G D;  5B31 A;  4J8V B;  5GT0 C;  4AWL C;  3REH A;  5B2J D;  3X1V B;  3A1K A;  4HGA C;  3AYW C;  5B32 A;  5B33 C;  3AZN B;  5BNX A;  5AY8 A;  5CP6 B;  3W99 D;  3KUY D;  1HQ3 D;  5AV6 B;  2NQB C;  4Z5T D;  4CAY A;  4J8V D;  3NQJ B;  3AV1 C;  5GSU C;  2FJ7 C;  3X1V D;  3LZ1 C;  2XD5 A;  3AV2 B;  5JRG C;  3AZN D;  2CV5 A;  4LD9 B;  3C1B B;  1ZLA A;  5CP6 D;  4WZS B;  4J8U C;  5CPJ C;  3AZL C;  1M19 B;  5AV6 D;  3AN2 A;  3KXB B;  3A1I A;  5GT3 B;  1M1A D;  5GXQ C;  3UTA A;  5BNV B;  2ARO B;  1KX4 B;  3B6G C;  2F8N H;  3AV2 D;  1P3G D;  1KX5 B;  3WA9 B;  4KGC B;  4LD9 D;  5BT1 D;  3C1B D;  2Y2Q A;  3MGR B;  5B1M D;  1B6W A;  1P34 B;  1M19 D;  3KXB D;  2YFV B;  5GT3 D;  3W99 C;  3KWQ B;  2G5I C;  3KUY C;  1U35 C;  2RIQ A;  3MGQ A;  2ARO D;  1KX4 D;  4Z5T C;  2RVQ D;  3X1U C;  4J8V C;  3MGP B;  3AZG A;  1N1J A;  4H9O A;  4H9N A;  1KX5 D;  3WA9 D;  4KGC D;  5DNM D;  3R45 A;  2HUE B;  3X1V C;  3MNN D;  3B6F B;  3LEL A;  3AZN C;  1P34 D;  4KHA B;  4JJN D;  1ULY A;  3WAA B;  5B0Y B;  2NZD B;  3MGS D;  1M18 B;  1P3M B;  5AV6 C;  5B40 B;  3EG5 B;  5JA4 A;  3MGP D;  3A6N B;  1P3I A;  3NQU A;  1BH8 A;  2IO5 B;  3B6F D;  5CPK A;  4G92 B;  2F8N G;  3REK A;  5AVC B;  4LD9 C;  5AV9 A;  4X23 B;  5BT1 C;  1TZY A;  5B0Y D;  3C1B C;  2NZD D;  3WTP B;  1S32 A;  1M18 D;  2HIO B;  2YFW B;  3REI B;  1P3M D;  1M19 C;  5AVB A;  5B40 D;  3KXB C;  2PYO B;  5B2I A;  1TAF B;  5GT3 C;  5B24 C;  3W96 B;  2ARO C;  1KX4 C;  2RVQ C;  4J8X A;  3AZI B;  1EQZ B;  1AOI A;  4QLC B;  5AVC D;  1KX5 C;  4X23 D;  4KGC C;  3AZK A;  5B0Z A;  3WTP D;  4R8P D;  4HGA B;  1P3P D;  5B1L D;  3MGR C;  2HIO D;  3UTB A;  1P34 C;  5AV5 D;  1JFI A;  2PYO D;  3WKJ B;  3KWQ C;  3W96 D;  3TU4 B;  3V9R B;  1P3K D;  3AZM B;  4J8W B;  5GT0 D;  2Y2P A;  4YM6 A;  5C3I B;  5AV8 A;  1EQZ D;  5B2J A;  2FJ7 B;  3AFA B;  3B6F C;  3AZF A;  3AYW D;  3AZE B;  5B32 G;  3AZH A;  3WAA C;  3C1C A;  5B0Y C;  3H0L C;  2Y2G A;  3LJA A;  3W97 B;  4WNN A;  1P3M C;  5E5A B;  4H9Q A;  4WU9 B;  5B40 C;  3AZM D;  4J8W D;  3A6N C;  4ZUX A;  4UUZ B;  5GSU D;  3AZJ A;  1ZLA C;  2FJ7 D;  3AFA D;  2BG1 A;  2JSS A;  4G92 C;  5AVC C;  2Y2N A;  4Z66 A;  4H9S A;  3WTP C;  4J8U D;  3UTA C;  3REI C;  2JCH A;  4ZBJ B;  5E5A D;  4WU9 D;  2BYM B;  1M1A A;  2JE5 A;  4WJ3 C;  3FDD A;  3W96 C;  3VH5 W;  4CSR B;  4DQY B;  1P3O C;  3X1U B;  5DNN B;  1P3G A;  3AZI C;  3H0M C;  2VQR A;  1EQZ C;  4QLC C;  5BS7 A;  1P3L A;  5B1M A;  5BO0 A;  3X1T B;  2J8P A;  4E45 A;  1U35 D;  3WKJ C;  3TU4 C;  2Y2L A;  4YS3 B;  3AZM C;  3X1U D;  4J8W C;  1ID3 B;  2F8N B;  5DNN D;  5C3I C;  5DNM A;  5KDM A;  3LZ0 B;  3MNN A;  3REL A;  3AFA C;  3O62 B;  3AZE C;  5CPI A;  4JJN A;  1BH9 B;  3MGS A;  1KX3 A;  2Y2I A;  3W97 C;  5E5A C;  4WU9 C;  4KUD A;  4YS3 D;  1ID3 D;  3X1S B;  5B24 B;  3REJ B;  4XUJ B;  4EO5 B;  1H3O A;  3O62 D;  2Y2J A;  5FUG B;  4WU8 A;  1P3B A;  3UT9 B;  5B31 B;  4ZBJ C;  4XZQ A;  3X1S D;  3REH B;  5B24 D;  1F66 A;  3VH6 W;  4XUJ D;  3MVD A;  5B32 B;  4H9R A;  5DNN C;  1P3F A;  1R4V A;  2ZY3 A;  5BNX B;  2F2A C;  5AY8 B;  5F99 A;  2ZY2 A;  4R8P A;  1P3P A;  5B1L A;  1BFM A;  4NE6 A;  3MGR D;  3X1T C;  5G49 A;  3W98 A;  3UT9 D;  5AV5 A;  1W2E A;  4CAY B;  5B31 D;  1P3A A;  5CHL B;  2ZY4 A;  3KWQ D;  1P3K A;  3AZF C;  5GT0 A;  4YS3 C;  1ID3 C;  2CV5 B;  2UWX A;  3C1C C;  1ZLA B;  5AY8 D;  3LZ0 C;  3AYW A;  3O62 C;  5B33 A;  3AN2 B;  3WAA D;  2BYK B;  3UTA B;  2NQB A;  2CV5 D;  3A6N D;  3X1S C;  3AV1 A;  5GSU A;  1ZLA D;  3REJ C;  4XUJ C;  4EO5 C;  1P3O B;  3LZ1 A;  5JRG A;  4J8U A;  3MGQ B;  3UTA D;  5CPJ A;  3AZL A;  3REI D;  3UT9 C;  2FFF B;  5B31 C;  3VH5 A;  3AZG B;  1N1J B;  4H9O B;  4H9N B;  3REH C;  3KFU G;  5GXQ A;  3R45 B;  5BS7 C;  1P3L C;  1P3O D;  3B6G A;  3LEL B;  5B32 C;  3AZI D;  5AY8 C;  4QLC D;  4H9P A;  2F8N K;  3MGQ D;  5JA4 B;  1P3I B;  3AZG D;  3NQU B;  3WTP E;  1Q9C A;  3KUY A;  1U35 A;  3W99 A;  1HQ3 A;  3WKJ D;  1BH8 B;  3TU4 D;  4Z5T A;  5CPK B;  3B0D B;  3LEL D;  3KSY A;  4J8V A;  2DQN C;  3REK B;  2CV5 C;  1A7W A;  5AV9 B;  1TZY B;  1S32 B;  3X1V A;  1KX3 C;  1HTA A;  3AZE D;  5AVB B;  3AZN A;  3AN2 C;  5B2I B;  5CP6 A;  1P3I D;  3W97 D;  5AV6 A;  4J8X B;  3NQJ A;  3REK D;  1AOI B;  5AV9 D;  3AZK B;  1TZY D;  4NE3 A;  5B0Z B;  1P3B C;  3UTB B;  3AV2 A;  1JFI B;  4LD9 A;  5B2I D;  3C1B A;  3MGQ C;  2ZY5 A;  3B0B A;  1M19 A;  3VH6 A;  3EPJ A;  3KXB A;  3P5J B;  4YM6 B;  4J8X D;  5AV8 B;  3AZG C;  5GT3 A;  1P3F C;  5B2J B;  5B0Z D;  5BNV A;  2ARO A;  3AZF B;  1KX4 A;  3LEL C;  3AZH B;  3C1C B;  1KX5 A;  3WA9 A;  3EPL A;  4KGC A;  3LJA B;  4WNN B;  2Y2K A;  3MGR A;  3B0C W;  3X1T D;  4H9Q B;  1P34 A;  2YFV A;  4YM6 D;  5AV8 D;  1P3I C;  4ZUX B;  3VH6 T;  3KWQ A;  3AZJ B;  1F1E A;  2XD1 A;  3AZF D;  5CPK C;  3B0D C;  3MGP A;  2F8N D;  3AZH D;  2Y2M A;  3REK C;  5AV9 C;  3C1C D;  1TZY C;  4NE5 A;  4Z66 B;  1S32 C;  1Z2C B;  3LJA D;  3LZ0 D;  3B6F A;  2L5A A;  5AVB C;  4KHA A;  3WAA A;  5B2I C;  1M1A B;  5B0Y A;  2G5H C;  2NZD A;  4ZUX D;  3AZJ D;  1M18 A;  1P3M A;  5B40 A;  4J8X C;  1P3G B;  3A6N A;  1AOI C;  3REJ D;  3AZK C;  1P3L B;  5B0Z C;  5B1M B;  4Z2M G;  5BO0 B;  4Z66 D;  3UTB C;  5AVC A;  4X23 A;  2BYK A;  3WTP A;  2HIO A;  2YFW A;  3REI A;  2PYO A;  4YM6 C;  1TAF A;  5AV8 C;  3REH D;  5DNM B;  5B2J C;  3W96 A;  5KDM B;  3MNN B;  3REL B;  1P3L D;  1P3O A;  5CPI B;  5B32 D;  4JJN B;  3AZI A;  3AZH C;  1EQZ A;  4QLC A;  3MGS B;  1WWI A;  1HQ3 C;  3LJA C;  1KX3 B;  4KUD B;  2CWE A;  4WV4 B;  1B67 A;  4ZUX C;  3AZJ C;  3WKJ A;  3TU4 A;  1H3O B;  3V9R A;  3REL D;  4E44 A;  3AZM A;  3EPH A;  4J8W A;  5CPI D;  5CP6 C;  1P3B B;  4WU8 B;  4Z66 C;  4H9S C;  3AFA A;  2FJ7 A;  1KX3 D;  3AZE A;  3AN2 D;  4KUD D;  4XZQ B;  4G91 B;  2W8S A;  1M1A C;  1F66 B;  2LY8 A;  3W97 A;  3MVD B;  5E5A A;  4WU9 A;  3IP4 C;  4H9R B;  3AV2 C;  1P3G C;  1P3F B;  5F99 B;  4UUZ A;  4R8P B;  2Y2H A;  1P3B D;  5B1L B;  5B1M C;  2ZM5 A;  4WU8 D;  1P3P B;  5G49 B;  3W98 B;  4M6B A;  5AV5 B;  1P3A B;  3EPK A;  4XZQ D;  4DRB A;  1F66 D;  1P3K B;  3MVD D;  5GT0 B;  2BYM A;  4AWL B;  1P3F D;  3AL0 C;  3WA9 C;  5F99 D;  3VH5 T;  5DNM C;  4CSR A;  4UPK A;  3MNN C;  3REL C;  3AYW B;  3X1U A;  5B33 B;  5CPI C;  3W98 D;  5DNN A;  4JJN C;  1P3A D;  3MGS C;  3X1T A;  4NFT A;  2NQB B;  5B31 G;  1KU5 A;  1WWS A;  4KUD C;  3MGP C;  3AV1 B;  5GSU B;  2HUE C;  3LZ1 B;  4YS3 A;  5CPK D;  1ID3 A;  5JRG B;  5B33 D;  2F8N A;  3H0R C;  2NZD C;  4J8U B;  1S32 D;  3LZ0 A;  3B0C T;  4WU8 C;  5CPJ B;  3AZL B;  1M18 C;  3O62 A;  2NQB D;  5AVB D;  1BH9 A;  4XZQ C;  4G91 C;  3AV1 D; 
#chains in the Genus database with same CATH homology
 5GXQ B;  1F66 C;  3MVD C;  3B6G B;  2IO5 C;  3LZ1 D;  5JRG D;  3X1S A;  5B24 A;  1AOI D;  4X23 C;  4Z2M H;  3F6T A;  4XUJ A;  1T3U A;  5F99 C;  3REJ A;  4R8P C;  3AZK D;  1PZR A;  4H9P B;  5B1L C;  1P3P C;  2HIO C;  5CPJ D;  3UTB D;  3AZL D;  2Y2O A;  3W98 C;  5AV5 C;  1P3A C;  2PYO C;  1U35 B;  3W99 B;  3KUY B;  1HQ3 B;  2DF4 C;  5FUG A;  5GXQ D;  1P3K C;  4DRA A;  3UT9 A;  4Z5T B;  3B6G D;  5B31 A;  4J8V B;  5GT0 C;  4AWL C;  3REH A;  5B2J D;  3X1V B;  3A1K A;  4HGA C;  3AYW C;  5B32 A;  5B33 C;  3AZN B;  5BNX A;  5AY8 A;  5CP6 B;  3W99 D;  3KUY D;  1HQ3 D;  5AV6 B;  2NQB C;  4Z5T D;  4CAY A;  4J8V D;  3NQJ B;  3AV1 C;  5GSU C;  2FJ7 C;  3X1V D;  3LZ1 C;  2XD5 A;  3AV2 B;  5JRG C;  3AZN D;  2CV5 A;  4LD9 B;  3C1B B;  1ZLA A;  5CP6 D;  4WZS B;  4J8U C;  5CPJ C;  3AZL C;  1M19 B;  5AV6 D;  3AN2 A;  3KXB B;  3A1I A;  5GT3 B;  1M1A D;  5GXQ C;  3UTA A;  5BNV B;  2ARO B;  1KX4 B;  3B6G C;  2F8N H;  3AV2 D;  1P3G D;  1KX5 B;  3WA9 B;  4KGC B;  4LD9 D;  5BT1 D;  3C1B D;  2Y2Q A;  3MGR B;  5B1M D;  1B6W A;  1P34 B;  1M19 D;  3KXB D;  2YFV B;  5GT3 D;  3W99 C;  3KWQ B;  2G5I C;  3KUY C;  1U35 C;  2RIQ A;  3MGQ A;  2ARO D;  1KX4 D;  4Z5T C;  2RVQ D;  3X1U C;  4J8V C;  3MGP B;  3AZG A;  1N1J A;  4H9O A;  4H9N A;  1KX5 D;  3WA9 D;  4KGC D;  5DNM D;  3R45 A;  2HUE B;  3X1V C;  3MNN D;  3B6F B;  3LEL A;  3AZN C;  1P34 D;  4KHA B;  4JJN D;  1ULY A;  3WAA B;  5B0Y B;  2NZD B;  3MGS D;  1M18 B;  1P3M B;  5AV6 C;  5B40 B;  3EG5 B;  5JA4 A;  3MGP D;  3A6N B;  1P3I A;  3NQU A;  1BH8 A;  2IO5 B;  3B6F D;  5CPK A;  4G92 B;  2F8N G;  3REK A;  5AVC B;  4LD9 C;  5AV9 A;  4X23 B;  5BT1 C;  1TZY A;  5B0Y D;  3C1B C;  2NZD D;  3WTP B;  1S32 A;  1M18 D;  2HIO B;  2YFW B;  3REI B;  1P3M D;  1M19 C;  5AVB A;  5B40 D;  3KXB C;  2PYO B;  5B2I A;  1TAF B;  5GT3 C;  5B24 C;  3W96 B;  2ARO C;  1KX4 C;  2RVQ C;  4J8X A;  3AZI B;  1EQZ B;  1AOI A;  4QLC B;  5AVC D;  1KX5 C;  4X23 D;  4KGC C;  3AZK A;  5B0Z A;  3WTP D;  4R8P D;  4HGA B;  1P3P D;  5B1L D;  3MGR C;  2HIO D;  3UTB A;  1P34 C;  5AV5 D;  1JFI A;  2PYO D;  3WKJ B;  3KWQ C;  3W96 D;  3TU4 B;  3V9R B;  1P3K D;  3AZM B;  4J8W B;  5GT0 D;  2Y2P A;  4YM6 A;  5C3I B;  5AV8 A;  1EQZ D;  5B2J A;  2FJ7 B;  3AFA B;  3B6F C;  3AZF A;  3AYW D;  3AZE B;  5B32 G;  3AZH A;  3WAA C;  3C1C A;  5B0Y C;  3H0L C;  2Y2G A;  3LJA A;  3W97 B;  4WNN A;  1P3M C;  5E5A B;  4H9Q A;  4WU9 B;  5B40 C;  3AZM D;  4J8W D;  3A6N C;  4ZUX A;  4UUZ B;  5GSU D;  3AZJ A;  1ZLA C;  2FJ7 D;  3AFA D;  2BG1 A;  2JSS A;  4G92 C;  5AVC C;  2Y2N A;  4Z66 A;  4H9S A;  3WTP C;  4J8U D;  3UTA C;  3REI C;  2JCH A;  4ZBJ B;  5E5A D;  4WU9 D;  2BYM B;  1M1A A;  2JE5 A;  4WJ3 C;  3FDD A;  3W96 C;  3VH5 W;  4CSR B;  4DQY B;  1P3O C;  3X1U B;  5DNN B;  1P3G A;  3AZI C;  3H0M C;  2VQR A;  1EQZ C;  4QLC C;  5BS7 A;  1P3L A;  5B1M A;  5BO0 A;  3X1T B;  2J8P A;  4E45 A;  1U35 D;  3WKJ C;  3TU4 C;  2Y2L A;  4YS3 B;  3AZM C;  3X1U D;  4J8W C;  1ID3 B;  2F8N B;  5DNN D;  5C3I C;  5DNM A;  5KDM A;  3LZ0 B;  3MNN A;  3REL A;  3AFA C;  3O62 B;  3AZE C;  5CPI A;  4JJN A;  1BH9 B;  3MGS A;  1KX3 A;  2Y2I A;  3W97 C;  5E5A C;  4WU9 C;  4KUD A;  4YS3 D;  1ID3 D;  3X1S B;  5B24 B;  3REJ B;  4XUJ B;  4EO5 B;  1H3O A;  3O62 D;  2Y2J A;  5FUG B;  4WU8 A;  1P3B A;  3UT9 B;  5B31 B;  4ZBJ C;  4XZQ A;  3X1S D;  3REH B;  5B24 D;  1F66 A;  3VH6 W;  4XUJ D;  3MVD A;  5B32 B;  4H9R A;  5DNN C;  1P3F A;  1R4V A;  2ZY3 A;  5BNX B;  2F2A C;  5AY8 B;  5F99 A;  2ZY2 A;  4R8P A;  1P3P A;  5B1L A;  1BFM A;  4NE6 A;  3MGR D;  3X1T C;  5G49 A;  3W98 A;  3UT9 D;  5AV5 A;  1W2E A;  4CAY B;  5B31 D;  1P3A A;  5CHL B;  2ZY4 A;  3KWQ D;  1P3K A;  3AZF C;  5GT0 A;  4YS3 C;  1ID3 C;  2CV5 B;  2UWX A;  3C1C C;  1ZLA B;  5AY8 D;  3LZ0 C;  3AYW A;  3O62 C;  5B33 A;  3AN2 B;  3WAA D;  2BYK B;  3UTA B;  2NQB A;  2CV5 D;  3A6N D;  3X1S C;  3AV1 A;  5GSU A;  1ZLA D;  3REJ C;  4XUJ C;  4EO5 C;  1P3O B;  3LZ1 A;  5JRG A;  4J8U A;  3MGQ B;  3UTA D;  5CPJ A;  3AZL A;  3REI D;  3UT9 C;  2FFF B;  5B31 C;  3VH5 A;  3AZG B;  1N1J B;  4H9O B;  4H9N B;  3REH C;  3KFU G;  5GXQ A;  3R45 B;  5BS7 C;  1P3L C;  1P3O D;  3B6G A;  3LEL B;  5B32 C;  3AZI D;  5AY8 C;  4QLC D;  4H9P A;  2F8N K;  3MGQ D;  5JA4 B;  1P3I B;  3AZG D;  3NQU B;  3WTP E;  1Q9C A;  3KUY A;  1U35 A;  3W99 A;  1HQ3 A;  3WKJ D;  1BH8 B;  3TU4 D;  4Z5T A;  5CPK B;  3B0D B;  3LEL D;  3KSY A;  4J8V A;  2DQN C;  3REK B;  2CV5 C;  1A7W A;  5AV9 B;  1TZY B;  1S32 B;  3X1V A;  1KX3 C;  1HTA A;  3AZE D;  5AVB B;  3AZN A;  3AN2 C;  5B2I B;  5CP6 A;  1P3I D;  3W97 D;  5AV6 A;  4J8X B;  3NQJ A;  3REK D;  1AOI B;  5AV9 D;  3AZK B;  1TZY D;  4NE3 A;  5B0Z B;  1P3B C;  3UTB B;  3AV2 A;  1JFI B;  4LD9 A;  5B2I D;  3C1B A;  3MGQ C;  2ZY5 A;  3B0B A;  1M19 A;  3VH6 A;  3EPJ A;  3KXB A;  3P5J B;  4YM6 B;  4J8X D;  5AV8 B;  3AZG C;  5GT3 A;  1P3F C;  5B2J B;  5B0Z D;  5BNV A;  2ARO A;  3AZF B;  1KX4 A;  3LEL C;  3AZH B;  3C1C B;  1KX5 A;  3WA9 A;  3EPL A;  4KGC A;  3LJA B;  4WNN B;  2Y2K A;  3MGR A;  3B0C W;  3X1T D;  4H9Q B;  1P34 A;  2YFV A;  4YM6 D;  5AV8 D;  1P3I C;  4ZUX B;  3VH6 T;  3KWQ A;  3AZJ B;  1F1E A;  2XD1 A;  3AZF D;  5CPK C;  3B0D C;  3MGP A;  2F8N D;  3AZH D;  2Y2M A;  3REK C;  5AV9 C;  3C1C D;  1TZY C;  4NE5 A;  4Z66 B;  1S32 C;  1Z2C B;  3LJA D;  3LZ0 D;  3B6F A;  2L5A A;  5AVB C;  4KHA A;  3WAA A;  5B2I C;  1M1A B;  5B0Y A;  2G5H C;  2NZD A;  4ZUX D;  3AZJ D;  1M18 A;  1P3M A;  5B40 A;  4J8X C;  1P3G B;  3A6N A;  1AOI C;  3REJ D;  3AZK C;  1P3L B;  5B0Z C;  5B1M B;  4Z2M G;  5BO0 B;  4Z66 D;  3UTB C;  5AVC A;  4X23 A;  2BYK A;  3WTP A;  2HIO A;  2YFW A;  3REI A;  2PYO A;  4YM6 C;  1TAF A;  5AV8 C;  3REH D;  5DNM B;  5B2J C;  3W96 A;  5KDM B;  3MNN B;  3REL B;  1P3L D;  1P3O A;  5CPI B;  5B32 D;  4JJN B;  3AZI A;  3AZH C;  1EQZ A;  4QLC A;  3MGS B;  1WWI A;  1HQ3 C;  3LJA C;  1KX3 B;  4KUD B;  2CWE A;  4WV4 B;  1B67 A;  4ZUX C;  3AZJ C;  3WKJ A;  3TU4 A;  1H3O B;  3V9R A;  3REL D;  4E44 A;  3AZM A;  3EPH A;  4J8W A;  5CPI D;  5CP6 C;  1P3B B;  4WU8 B;  4Z66 C;  4H9S C;  3AFA A;  2FJ7 A;  1KX3 D;  3AZE A;  3AN2 D;  4KUD D;  4XZQ B;  4G91 B;  2W8S A;  1M1A C;  1F66 B;  2LY8 A;  3W97 A;  3MVD B;  5E5A A;  4WU9 A;  3IP4 C;  4H9R B;  3AV2 C;  1P3G C;  1P3F B;  5F99 B;  4UUZ A;  4R8P B;  2Y2H A;  1P3B D;  5B1L B;  5B1M C;  2ZM5 A;  4WU8 D;  1P3P B;  5G49 B;  3W98 B;  4M6B A;  5AV5 B;  1P3A B;  3EPK A;  4XZQ D;  4DRB A;  1F66 D;  1P3K B;  3MVD D;  5GT0 B;  2BYM A;  4AWL B;  1P3F D;  3AL0 C;  3WA9 C;  5F99 D;  3VH5 T;  5DNM C;  4CSR A;  4UPK A;  3MNN C;  3REL C;  3AYW B;  3X1U A;  5B33 B;  5CPI C;  3W98 D;  5DNN A;  4JJN C;  1P3A D;  3MGS C;  3X1T A;  4NFT A;  2NQB B;  5B31 G;  1KU5 A;  1WWS A;  4KUD C;  3MGP C;  3AV1 B;  5GSU B;  2HUE C;  3LZ1 B;  4YS3 A;  5CPK D;  1ID3 A;  5JRG B;  5B33 D;  2F8N A;  3H0R C;  2NZD C;  4J8U B;  1S32 D;  3LZ0 A;  3B0C T;  4WU8 C;  5CPJ B;  3AZL B;  1M18 C;  3O62 A;  2NQB D;  5AVB D;  1BH9 A;  4XZQ C;  4G91 C;  3AV1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...