4KUDC

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudC00
3AZLB 3C1CD 3AFAB 1F66D 3B6FA 4R8PC 2NQBA 5B0YC 3REJC 1H3OA 1JFIA 3MGPC 4ZBJC 4LD9C 4WZSB 2F8ND 1P34D 3LJAB 3X1VB 3W96A 5AY8A 2IO5B 3B0DB 5GT0D 3MGSD 3TU4B 4WV4B 1EQZC 2HUEC 1KX3B 1P3PC 5BT1C 5B33B 4J8UA 3AZHD 3WA9A 3W97B 1U35C 5GXQC 5B2JD 5CP6B 4ZUXA 3O62B 3AZND 1WWSA 3AZGD 3AN2C 5B32A 2RVQC 3W98A 3AZLC 1M1AD 3X1UC 5B31A 5B2IB 3C1BB 3MVDD 3B6FD 3MNNB 2PYOB 3AFAA 5B0ZD 1Q9CA 3A6NB 1KX4B 5AY8D 5B33C 5B1MB 2CV5B 1TZYB 4X23B 3W97C 5DNND 1P3LA 5B24B 4J8UD 3LJAA 5CPJA 3WA9D 2NZDB 3TU4A 1KX3A 1P3AD 3AZFC 5GSUC 3AZJC 4YM6A 2AROB 4DRBA 5CP6A 3UTBB 3O62A 3C1BC 5B40B 1M19C 3AZIC 3KSYA 5AVCB 1BH8A 3AFAD 3REIC 3C1CB 5B1MC 4HGAB 1F66B 1TZYC 3MNNA 2PYOA 2NZDC 5AV8A 1P3LD 3A6NA 5CPJD 2L5AA 4WU8A 1KX4A 4XUJA 4KGCC 5BNVB 2F8NB 2CV5A 4X23A 1KX3D 2AROC 5GT0B 4H9PB 3MGSB 4J8WA 5B24A 4YM6D 1P3GC 5B40C 3AZHB 3WKJD 2HIOC 4H9SC 4XZQC 5B2JB 4NFTA 4Z5TA 4G91B 5JA4B 3AZNB 3UTBA 5CPIC 3AZGB 5AV5B 1M1AB 3AV1A 2BYKA 4HGAC 3MGQA 3NQJB 5AVCA 4UUZB 1ZLAD 3MVDB 3B6FB 3C1CA 2JSSA 1P34C 5AV8D 4NE5A 1H3OB 1JFIB 1F66A 5B0ZB 3A6ND 4WU8D 4XUJD 3VH6A 4J8VC 3AV2C 5AY8B 3NQUA 4J8WD 3AZHC 5B24D 5AVBA 5BNVA 5B2JC 5DNNB 5GT3D 1M18A 3AZMD 3WA9B 3MGRD 3UT9C 3AZNC 5GT0A 4H9PA 2FJ7B 4Z5TD 1S32D 1P3AB 1P3BC 5E5AC 1M1AC 5DNMA 5AV6D 4DRAA 3AV1D 4G92B 3MGQD 1P3KD 4JJNA 3B6FC 3AZGA 5AV5A 3W99D 2NQBC 3NQJA 5B1LA 4UUZA 3MVDA 3AZKC 4E45A 3W96C 4NE6A 1KX5C 4J8UC 5B0ZA 1ID3A 1AOIA 3WA9C 5AVBD 1HQ3A 1P3LB 1M18D 5CPJB 4ZUXC 3AYWB 3B0CW 1P3ID 5B32C 5DNNA 4YM6B 3W98C 1F1EA 5DNMD 5B31C 4G92C 2FJ7A 3WKJB 1P3AA 5AV9A 4EO5B 4WU9C 4JJND 5FUGA 3B6GC 5AV5D 3LZ1B 3WTPA 1BH8B 3AFAC 1KU5A 5B1LD 5BNXB 1ULYA 1ZLAB 4Z2MH 1P3OD 4H9OB 1P3LC 3WAAD 3LJAC 1AOID 3REJA 3X1VC 3VH5T 1ID3D 1WWIA 2IO5C 3B0DC 5AV8B 3LELA 3TU4C 1HQ3D 1KX3C 3REKD 4WU8B 4XUJB 3RELB 1EQZA 5KDMA 4J8WB 5CP6C 3O62C 4H9QB 5GT3B 3AYWA 4KUDD 3AZMB 2FJ7D 4QLCA 3MGRB 3AZED 5AV9D 4E44A 4Z5TB 1S32B 3KWQB 1A7WA 5C3IB 5B2IC 3WKJA 5JRGD 5AV6B 3LZ0D 3WTPD 1R4VA 3AV1B 2BYKB 3MGQB 1P3KB 3LZ1A 3MNNC 2F8NK 4YS3B 2PYOC 2LY8A 3W99B 3KXBB 5AV8C 5BNXA 3VH6W 3A6NC 1KX4C 4WU8C 4XUJC 3REJD 3LELD 3MGPD 1ZLAA 2CV5C 4X23C 4H9OA 4J8WC 5B24C 1TAFB 1EQZD 4H9NB 3NQUB 5CPKB 5BT1D 5AVBB 4Z2MG 4Z5TC 3RELA 3AYWD 1M18B 1U35D 5GXQD 4QLCD 5C3IC 3UTBC 1P3IB 4CSRB 2YFVB 4H9QA 3X1SB 5GT3A 3AZMA 5DNMB 3AV1C 3AN2D 3MGRA 2RVQD 3B0BA 3MGQC 3UTAB 3X1UD 1S32A 3KWQA 5AVCC 4JJNB 5AV6A 3LZ1D 3C1CC 1P3KA 1F66C 5B1LB 3X1TA 1N1JA 4YS3A 3W99A 3KXBA 5F99B 5AVBC 1P3OB 3WAAB 1AOIB 1ID3B 5GT0C 3MGSC 1HQ3B 3RELD 3REKB 1TAFA 4H9NA 1P3FA 5CPKA 3AZFD 3AZJD 4G91C 4KUDB 4JJNC 3AZGC 3AZEB 4CSRA 2YFVA 5AV5C 5AV9B 3KWQD 1P3IA 3X1SA 5G49B 5FUGB 2BYMA 3UTAA 5JRGB 5B1LC 3LZ0B 5CPIA 1M19D 3WTPB 4J8XB 3MVDC 3X1TD 4YS3D 3REID 3KXBD 3WTPE 5BS7A 5B0ZC 1ID3C 4CAYB 3KUYA 1HQ3C 1P3MA 3REJB 4AWLB 5AY8C 3LELB 3MGPB 4ZBJB 5F99A 4KGCD 1P3OA 5DNNC 3WAAA 1P3FD 5CPKD 1EQZB 5KDMB 2HUEB 2FJ7C 3REKA 3V9RB 4Z66A 4H9RA 5AV9C 1P3AC 2HIOD 5GXQB 1U35B 4QLCB 4XZQD 3X1SD 3WTPC 4KUDA 3UTAD 5CPID 3AN2B 3AZEA 3X1UB 5G49A 3VH5A 5JRGA 3LZ0A 4J8XA 3REHA 4AWLC 3LELC 3KUYD 5B32G 1B6WA 1P3MD 3AZKA 5B31G 2YFWB 5F99D 4R8PA 4CAYA 5B0YA 4J8VD 3AV2D 5CPJC 1KX5A 3MGPA 3AYWC 4LD9A 4QLCC 4Z66D 4YM6C 3UT9D 3WKJC 1P3PA 3AZFB 5GSUB 3V9RA 3AZJB 5E5AD 1P3BD 4EO5C 4KHAB 1U35A 5GXQA 4NE3A 3LZ1C 4WU9A 3B6GA 3AN2A 4J8XD 2NQBD 3REHD 3AZLA 1M19B 3X1UA 3AZIB 1ZLAC 1HTAA 3X1TB 1N1JB 3AZKD 3REIB 3W96D 4R8PD 5B0YD 1KX5D 3RELC 3X1VA 2YFWA 4LD9D 4ZUXD 4KGCB 5B33A 5GT3C 3W97A 3AZMC 1P3FB 1P3PD 5B32D 3MGRC 2CWEA 1P3GB 3W98D 3R45B 2F8NH 1S32C 5B31D 3KWQC 2HIOB 5AV6C 3AZFA 5GSUA 4XZQB 4WU9D 3AZJA 4KHAA 3B6GD 5B2IA 1P3KC 2BYMB 3AZLD 5CPIB 3X1TC 3C1BA 3W99C 4YS3C 5CHLB 3KXBC 1BH9B 1M19A 3AZIA 3B0CT 4WNNB 3KUYB 3LJAD 3REIA 3X1VD 1P3MB 5B1MA 1P34B 3TU4D 1TZYA 1P3FC 5CPKC 5B33D 4J8VB 3AV2B 1M18C 2NZDA 3W97D 5CP6D 3O62D 4KGCA 1P3IC 4H9RB 4Z66B 3X1SC 5DNMC 3UT9B 5GSUD 2AROA 1P3GA 3UTAC 3R45A 3VH5W 1P3BB 5E5AB 1B67A 5B40A 5B2ID 5BO0B 2HIOA 4H9SA 4XZQA 3C1BD 2F8NG 5BS7C 3AZID 3MNND 2PYOD 3REHB 3KUYC 2NQBB 1P3MC 1BH9A 1BFMA 1KX4D 5F99C 1P3OC 5B1MD 3AZKB 3WAAC 1TZYD 4X23D 2CV5D 1AOIC 3W96B 4WNNA 4R8PB 5B0YB 3REKC 2NZDD 4Z66C 1KX5B 1P34A 2F8NA 4J8UB 4LD9B 3MGSA 4ZUXB 4J8VA 3AV2A 2AROD 3AZHA 4KUDC 1P3GD 3UTBD 1P3PB 5B32B 3AZEC 5B2JA 3W98B 3VH6T 5B40D 5JA4A 5B31B 3UT9A 3AZNA 5JRGC 3LZ0C 1P3BA 4WU9B 5E5AA 5AVCD 4J8XC 4M6BA 3REHC 1M1AA 5BO0A 3B6GB
chains in the Genus database with same CATH superfamily
3AZLB 3C1CD 2VQRA 3AFAB 1F66D 3B6FA 4R8PC 2NQBA 5B0YC 3REJC 1H3OA 1JFIA 3MGPC 4ZBJC 4LD9C 4WZSB 2F8ND 1P34D 3LJAB 3X1VB 3W96A 5AY8A 2IO5B 3B0DB 5GT0D 3FDDA 3MGSD 4WV4B 3TU4B 2HUEC 1KX3B 1EQZC 1P3PC 5BT1C 5B33B 2Y2PA 4J8UA 2FFFB 3AZHD 3WA9A 3W97B 1U35C 5GXQC 5B2JD 5CP6B 4ZUXA 3O62B 3AZND 1WWSA 3AZGD 3AN2C 5B32A 2RVQC 3W98A 3AZLC 1M1AD 3X1UC 5B31A 5B2IB 3C1BB 3MVDD 2Y2OA 3B6FD 3MNNB 2PYOB 3AFAA 3A1KA 5B0ZD 1Q9CA 3A6NB 1KX4B 5AY8D 5B33C 5B1MB 2CV5B 1TZYB 4X23B 3W97C 3H0LC 5DNND 1P3LA 5B24B 4J8UD 3LJAA 5CPJA 3WA9D 2NZDB 3TU4A 1KX3A 1P3AD 3AZFC 5GSUC 3AZJC 4YM6A 3EPJA 2AROB 4DRBA 5CP6A 3UTBB 3O62A 3C1BC 5B40B 2ZY4A 2RIQA 1M19C 3AZIC 3KSYA 5AVCB 1BH8A 3AFAD 4DQYB 3C1CB 3REIC 5B1MC 4HGAB 1F66B 1TZYC 3MNNA 2PYOA 2NZDC 5AV8A 1P3LD 3A6NA 5CPJD 2L5AA 4WU8A 1KX4A 4XUJA 4KGCC 5BNVB 2F8NB 2CV5A 4X23A 1KX3D 2AROC 5GT0B 4H9PB 3MGSB 4J8WA 5B24A 4YM6D 1P3GC 5B40C 3AZHB 3WKJD 2HIOC 4H9SC 1PZRA 4XZQC 5B2JB 4NFTA 4Z5TA 4G91B 5JA4B 2Y2KA 3AZNB 3UTBA 5CPIC 3AZGB 2XD1A 5AV5B 3H0MC 1M1AB 3AV1A 2BYKA 4HGAC 3MGQA 3NQJB 5AVCA 4UUZB 1ZLAD 3MVDB 3B6FB 3C1CA 2JSSA 1P34C 5AV8D 4NE5A 1H3OB 1JFIB 1F66A 5B0ZB 3A6ND 4WU8D 4XUJD 3VH6A 4J8VC 3AV2C 3IP4C 5AY8B 3NQUA 4J8WD 3AZHC 5B24D 5AVBA 5BNVA 5B2JC 5DNNB 5GT3D 1M18A 3AZMD 3WA9B 3MGRD 3UT9C 2G5HC 3AZNC 5GT0A 4H9PA 2FJ7B 4Z5TD 1S32D 1P3AB 1P3BC 5E5AC 1M1AC 5DNMA 5AV6D 4DRAA 3AV1D 4G92B 3MGQD 1P3KD 4JJNA 3B6FC 2Y2GA 3AZGA 5AV5A 3W99D 2NQBC 3NQJA 5B1LA 4UUZA 3MVDA 3AZKC 4E45A 3W96C 2JE5A 4WJ3C 4NE6A 1KX5C 4J8UC 5B0ZA 1ID3A 1AOIA 3WA9C 5AVBD 1HQ3A 1P3LB 1M18D 3H0RC 4ZUXC 5CPJB 1T3UA 3AYWB 3B0CW 1P3ID 5B32C 5DNNA 4YM6B 3W98C 1F1EA 5DNMD 5B31C 4G92C 2FJ7A 3WKJB 1P3AA 5AV9A 4EO5B 4WU9C 4JJND 5FUGA 3B6GC 5AV5D 3LZ1B 3WTPA 1BH8B 3AFAC 1KU5A 5B1LD 5BNXB 3KFUG 1ULYA 1ZLAB 1Z2CB 4Z2MH 1P3OD 4H9OB 2Y2LA 1P3LC 3WAAD 3LJAC 1AOID 3REJA 3X1VC 3VH5T 1ID3D 1WWIA 2IO5C 3B0DC 5AV8B 3LELA 3TU4C 1HQ3D 1KX3C 3REKD 4WU8B 4XUJB 2Y2NA 3RELB 1EQZA 5KDMA 4J8WB 5CP6C 3O62C 4H9QB 2UWXA 5GT3B 3AYWA 4KUDD 3AZMB 2FJ7D 3EPHA 4QLCA 3MGRB 3AZED 5AV9D 4E44A 4Z5TB 1S32B 3KWQB 1A7WA 5C3IB 5B2IC 3WKJA 5JRGD 5AV6B 3LZ0D 3WTPD 1R4VA 3AV1B 3AL0C 2BYKB 3MGQB 1P3KB 3LZ1A 3MNNC 2F8NK 4YS3B 2PYOC 2LY8A 3W99B 3KXBB 2Y2MA 5AV8C 5BNXA 3VH6W 3A6NC 1KX4C 4WU8C 4XUJC 3REJD 3LELD 3MGPD 1ZLAA 2CV5C 4X23C 2Y2JA 4H9OA 4J8WC 2F2AC 5B24C 1TAFB 1EQZD 4H9NB 3NQUB 5CPKB 5BT1D 5AVBB 4Z2MG 4Z5TC 3RELA 3AYWD 1M18B 1U35D 5GXQD 4QLCD 5C3IC 2ZM5A 3UTBC 4CSRB 2YFVB 4H9QA 1P3IB 3X1SB 5GT3A 3AZMA 5DNMB 3AV1C 3AN2D 3MGRA 2RVQD 3B0BA 3MGQC 3UTAB 3X1UD 1S32A 3KWQA 5AVCC 4JJNB 5AV6A 3LZ1D 4UPKA 3C1CC 2Y2QA 1P3KA 1F66C 5B1LB 3X1TA 1N1JA 4YS3A 3W99A 3KXBA 5F99B 5AVBC 1P3OB 3WAAB 1AOIB 1ID3B 5GT0C 3MGSC 1HQ3B 3RELD 3REKB 3F6TA 1TAFA 4H9NA 1P3FA 5CPKA 2G5IC 3AZFD 3AZJD 2ZY3A 4G91C 2ZY5A 4KUDB 4JJNC 3AZGC 3AZEB 4CSRA 2YFVA 5AV9B 5AV5C 3KWQD 1P3IA 3X1SA 5G49B 5FUGB 2DF4C 2BYMA 3UTAA 5JRGB 5B1LC 3LZ0B 5CPIA 1M19D 3WTPB 4J8XB 3MVDC 3X1TD 4YS3D 3REID 3KXBD 3WTPE 5BS7A 5B0ZC 1ID3C 4CAYB 3KUYA 1HQ3C 1P3MA 3REJB 4AWLB 5AY8C 3LELB 3MGPB 4ZBJB 5F99A 3P5JB 4KGCD 1P3OA 5DNNC 3WAAA 1P3FD 5CPKD 1EQZB 5KDMB 2HUEB 2FJ7C 3REKA 3V9RB 4H9RA 4Z66A 5AV9C 1P3AC 2HIOD 5GXQB 1U35B 4QLCB 4XZQD 3X1SD 3WTPC 4KUDA 3UTAD 5CPID 3AN2B 3AZEA 3X1UB 5G49A 3VH5A 2DQNC 5JRGA 3LZ0A 4J8XA 3REHA 2Y2IA 4AWLC 3LELC 3KUYD 5B32G 1B6WA 1P3MD 3AZKA 5B31G 2YFWB 5F99D 2J8PA 4R8PA 4CAYA 2JCHA 5B0YA 4J8VD 3AV2D 5CPJC 1KX5A 3MGPA 3AYWC 4LD9A 4QLCC 4Z66D 4YM6C 3UT9D 3WKJC 1P3PA 3AZFB 5GSUB 3V9RA 3AZJB 5E5AD 1P3BD 4EO5C 4KHAB 1U35A 5GXQA 4NE3A 3LZ1C 4WU9A 3B6GA 3AN2A 4J8XD 2NQBD 3REHD 3AZLA 1M19B 3X1UA 3AZIB 2W8SA 1ZLAC 1HTAA 3X1TB 1N1JB 3EPLA 3REIB 3AZKD 3W96D 4R8PD 5B0YD 1KX5D 3RELC 3X1VA 2YFWA 4LD9D 4ZUXD 4KGCB 5B33A 2Y2HA 1W2EA 5GT3C 3W97A 3AZMC 1P3FB 1P3PD 5B32D 3MGRC 2CWEA 1P3GB 3W98D 3R45B 2XD5A 2F8NH 1S32C 5B31D 3KWQC 2HIOB 5AV6C 3AZFA 5GSUA 4XZQB 4WU9D 3AZJA 4KHAA 3B6GD 5B2IA 1P3KC 2BYMB 3AZLD 5CPIB 3X1TC 3C1BA 3W99C 4YS3C 2ZY2A 5CHLB 3KXBC 1BH9B 2BG1A 1M19A 3AZIA 3B0CT 4WNNB 3KUYB 3LJAD 3REIA 3X1VD 1P3MB 5B1MA 1P34B 3TU4D 1TZYA 1P3FC 5CPKC 5B33D 4J8VB 3AV2B 1M18C 2NZDA 3W97D 5CP6D 3O62D 4KGCA 1P3IC 4H9RB 4Z66B 3X1SC 5DNMC 3UT9B 5GSUD 2AROA 3EG5B 1P3GA 3UTAC 3R45A 3VH5W 1P3BB 5E5AB 1B67A 5B40A 5B2ID 5BO0B 2HIOA 4H9SA 4XZQA 3C1BD 2F8NG 5BS7C 3AZID 3MNND 2PYOD 3REHB 3KUYC 2NQBB 1P3MC 1BH9A 1BFMA 1KX4D 5F99C 1P3OC 5B1MD 3AZKB 3WAAC 1TZYD 4X23D 2CV5D 1AOIC 3W96B 4WNNA 4R8PB 3A1IA 5B0YB 3REKC 2NZDD 4Z66C 1KX5B 1P34A 2F8NA 4J8UB 4LD9B 3MGSA 4ZUXB 4J8VA 3AV2A 2AROD 3AZHA 4KUDC 1P3GD 3UTBD 1P3PB 5B32B 3AZEC 5B2JA 3W98B 3VH6T 5B40D 5JA4A 5B31B 3UT9A 3AZNA 5JRGC 3LZ0C 1P3BA 4WU9B 5E5AA 5AVCD 3EPKA 4M6BA 4J8XC 3REHC 1M1AA 5BO0A 3B6GB
chains in the Genus database with same CATH topology
3AZLB 3C1CD 2VQRA 3AFAB 1F66D 3B6FA 4R8PC 2NQBA 5B0YC 3REJC 1H3OA 1JFIA 3MGPC 4ZBJC 4LD9C 4WZSB 2F8ND 1P34D 3LJAB 3X1VB 3W96A 5AY8A 2IO5B 3B0DB 5GT0D 3FDDA 3MGSD 4WV4B 3TU4B 2HUEC 1KX3B 1EQZC 1P3PC 5BT1C 5B33B 2Y2PA 4J8UA 2FFFB 3AZHD 3WA9A 3W97B 1U35C 5GXQC 5B2JD 5CP6B 4ZUXA 3O62B 3AZND 1WWSA 3AZGD 3AN2C 5B32A 2RVQC 3W98A 3AZLC 1M1AD 3X1UC 5B31A 5B2IB 3C1BB 3MVDD 2Y2OA 3B6FD 3MNNB 2PYOB 3AFAA 3A1KA 5B0ZD 1Q9CA 3A6NB 1KX4B 5AY8D 5B33C 5B1MB 2CV5B 1TZYB 4X23B 3W97C 3H0LC 5DNND 1P3LA 5B24B 4J8UD 3LJAA 5CPJA 3WA9D 2NZDB 3TU4A 1KX3A 1P3AD 3AZFC 5GSUC 3AZJC 4YM6A 3EPJA 2AROB 4DRBA 5CP6A 3UTBB 3O62A 3C1BC 5B40B 2ZY4A 2RIQA 1M19C 3AZIC 3KSYA 5AVCB 1BH8A 3AFAD 4DQYB 3C1CB 3REIC 5B1MC 4HGAB 1F66B 1TZYC 3MNNA 2PYOA 2NZDC 5AV8A 1P3LD 3A6NA 5CPJD 2L5AA 4WU8A 1KX4A 4XUJA 4KGCC 5BNVB 2F8NB 2CV5A 4X23A 1KX3D 2AROC 5GT0B 4H9PB 3MGSB 4J8WA 5B24A 4YM6D 1P3GC 5B40C 3AZHB 3WKJD 2HIOC 4H9SC 1PZRA 4XZQC 5B2JB 4NFTA 4Z5TA 4G91B 5JA4B 2Y2KA 3AZNB 3UTBA 5CPIC 3AZGB 2XD1A 5AV5B 3H0MC 1M1AB 3AV1A 2BYKA 4HGAC 3MGQA 3NQJB 5AVCA 4UUZB 1ZLAD 3MVDB 3B6FB 3C1CA 2JSSA 1P34C 5AV8D 4NE5A 1H3OB 1JFIB 1F66A 5B0ZB 3A6ND 4WU8D 4XUJD 3VH6A 4J8VC 3AV2C 3IP4C 5AY8B 3NQUA 4J8WD 3AZHC 5B24D 5AVBA 5BNVA 5B2JC 5DNNB 5GT3D 1M18A 3AZMD 3WA9B 3MGRD 3UT9C 2G5HC 3AZNC 5GT0A 4H9PA 2FJ7B 4Z5TD 1S32D 1P3AB 1P3BC 5E5AC 1M1AC 5DNMA 5AV6D 4DRAA 3AV1D 4G92B 3MGQD 1P3KD 4JJNA 3B6FC 2Y2GA 3AZGA 5AV5A 3W99D 2NQBC 3NQJA 5B1LA 4UUZA 3MVDA 3AZKC 4E45A 3W96C 2JE5A 4WJ3C 4NE6A 1KX5C 4J8UC 5B0ZA 1ID3A 1AOIA 3WA9C 5AVBD 1HQ3A 1P3LB 1M18D 3H0RC 4ZUXC 5CPJB 1T3UA 3AYWB 3B0CW 1P3ID 5B32C 5DNNA 4YM6B 3W98C 1F1EA 5DNMD 5B31C 4G92C 2FJ7A 3WKJB 1P3AA 5AV9A 4EO5B 4WU9C 4JJND 5FUGA 3B6GC 5AV5D 3LZ1B 3WTPA 1BH8B 3AFAC 1KU5A 5B1LD 5BNXB 3KFUG 1ULYA 1ZLAB 1Z2CB 4Z2MH 1P3OD 4H9OB 2Y2LA 1P3LC 3WAAD 3LJAC 1AOID 3REJA 3X1VC 3VH5T 1ID3D 1WWIA 2IO5C 3B0DC 5AV8B 3LELA 3TU4C 1HQ3D 1KX3C 3REKD 4WU8B 4XUJB 2Y2NA 3RELB 1EQZA 5KDMA 4J8WB 5CP6C 3O62C 4H9QB 2UWXA 5GT3B 3AYWA 4KUDD 3AZMB 2FJ7D 3EPHA 4QLCA 3MGRB 3AZED 5AV9D 4E44A 4Z5TB 1S32B 3KWQB 1A7WA 5C3IB 5B2IC 3WKJA 5JRGD 5AV6B 3LZ0D 3WTPD 1R4VA 3AV1B 3AL0C 2BYKB 3MGQB 1P3KB 3LZ1A 3MNNC 2F8NK 4YS3B 2PYOC 2LY8A 3W99B 3KXBB 2Y2MA 5AV8C 5BNXA 3VH6W 3A6NC 1KX4C 4WU8C 4XUJC 3REJD 3LELD 3MGPD 1ZLAA 2CV5C 4X23C 2Y2JA 4H9OA 4J8WC 2F2AC 5B24C 1TAFB 1EQZD 4H9NB 3NQUB 5CPKB 5BT1D 5AVBB 4Z2MG 4Z5TC 3RELA 3AYWD 1M18B 1U35D 5GXQD 4QLCD 5C3IC 2ZM5A 3UTBC 4CSRB 2YFVB 4H9QA 1P3IB 3X1SB 5GT3A 3AZMA 5DNMB 3AV1C 3AN2D 3MGRA 2RVQD 3B0BA 3MGQC 3UTAB 3X1UD 1S32A 3KWQA 5AVCC 4JJNB 5AV6A 3LZ1D 4UPKA 3C1CC 2Y2QA 1P3KA 1F66C 5B1LB 3X1TA 1N1JA 4YS3A 3W99A 3KXBA 5F99B 5AVBC 1P3OB 3WAAB 1AOIB 1ID3B 5GT0C 3MGSC 1HQ3B 3RELD 3REKB 3F6TA 1TAFA 4H9NA 1P3FA 5CPKA 2G5IC 3AZFD 3AZJD 2ZY3A 4G91C 2ZY5A 4KUDB 4JJNC 3AZGC 3AZEB 4CSRA 2YFVA 5AV9B 5AV5C 3KWQD 1P3IA 3X1SA 5G49B 5FUGB 2DF4C 2BYMA 3UTAA 5JRGB 5B1LC 3LZ0B 5CPIA 1M19D 3WTPB 4J8XB 3MVDC 3X1TD 4YS3D 3REID 3KXBD 3WTPE 5BS7A 5B0ZC 1ID3C 4CAYB 3KUYA 1HQ3C 1P3MA 3REJB 4AWLB 5AY8C 3LELB 3MGPB 4ZBJB 5F99A 3P5JB 4KGCD 1P3OA 5DNNC 3WAAA 1P3FD 5CPKD 1EQZB 5KDMB 2HUEB 2FJ7C 3REKA 3V9RB 4H9RA 4Z66A 5AV9C 1P3AC 2HIOD 5GXQB 1U35B 4QLCB 4XZQD 3X1SD 3WTPC 4KUDA 3UTAD 5CPID 3AN2B 3AZEA 3X1UB 5G49A 3VH5A 2DQNC 5JRGA 3LZ0A 4J8XA 3REHA 2Y2IA 4AWLC 3LELC 3KUYD 5B32G 1B6WA 1P3MD 3AZKA 5B31G 2YFWB 5F99D 2J8PA 4R8PA 4CAYA 2JCHA 5B0YA 4J8VD 3AV2D 5CPJC 1KX5A 3MGPA 3AYWC 4LD9A 4QLCC 4Z66D 4YM6C 3UT9D 3WKJC 1P3PA 3AZFB 5GSUB 3V9RA 3AZJB 5E5AD 1P3BD 4EO5C 4KHAB 1U35A 5GXQA 4NE3A 3LZ1C 4WU9A 3B6GA 3AN2A 4J8XD 2NQBD 3REHD 3AZLA 1M19B 3X1UA 3AZIB 2W8SA 1ZLAC 1HTAA 3X1TB 1N1JB 3EPLA 3REIB 3AZKD 3W96D 4R8PD 5B0YD 1KX5D 3RELC 3X1VA 2YFWA 4LD9D 4ZUXD 4KGCB 5B33A 2Y2HA 1W2EA 5GT3C 3W97A 3AZMC 1P3FB 1P3PD 5B32D 3MGRC 2CWEA 1P3GB 3W98D 3R45B 2XD5A 2F8NH 1S32C 5B31D 3KWQC 2HIOB 5AV6C 3AZFA 5GSUA 4XZQB 4WU9D 3AZJA 4KHAA 3B6GD 5B2IA 1P3KC 2BYMB 3AZLD 5CPIB 3X1TC 3C1BA 3W99C 4YS3C 2ZY2A 5CHLB 3KXBC 1BH9B 2BG1A 1M19A 3AZIA 3B0CT 4WNNB 3KUYB 3LJAD 3REIA 3X1VD 1P3MB 5B1MA 1P34B 3TU4D 1TZYA 1P3FC 5CPKC 5B33D 4J8VB 3AV2B 1M18C 2NZDA 3W97D 5CP6D 3O62D 4KGCA 1P3IC 4H9RB 4Z66B 3X1SC 5DNMC 3UT9B 5GSUD 2AROA 3EG5B 1P3GA 3UTAC 3R45A 3VH5W 1P3BB 5E5AB 1B67A 5B40A 5B2ID 5BO0B 2HIOA 4H9SA 4XZQA 3C1BD 2F8NG 5BS7C 3AZID 3MNND 2PYOD 3REHB 3KUYC 2NQBB 1P3MC 1BH9A 1BFMA 1KX4D 5F99C 1P3OC 5B1MD 3AZKB 3WAAC 1TZYD 4X23D 2CV5D 1AOIC 3W96B 4WNNA 4R8PB 3A1IA 5B0YB 3REKC 2NZDD 4Z66C 1KX5B 1P34A 2F8NA 4J8UB 4LD9B 3MGSA 4ZUXB 4J8VA 3AV2A 2AROD 3AZHA 4KUDC 1P3GD 3UTBD 1P3PB 5B32B 3AZEC 5B2JA 3W98B 3VH6T 5B40D 5JA4A 5B31B 3UT9A 3AZNA 5JRGC 3LZ0C 1P3BA 4WU9B 5E5AA 5AVCD 3EPKA 4M6BA 4J8XC 3REHC 1M1AA 5BO0A 3B6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  3C1C D;  3AFA B;  1F66 D;  3B6F A;  4R8P C;  2NQB A;  5B0Y C;  3REJ C;  1H3O A;  1JFI A;  3MGP C;  4ZBJ C;  4LD9 C;  4WZS B;  2F8N D;  1P34 D;  3LJA B;  3X1V B;  3W96 A;  5AY8 A;  2IO5 B;  3B0D B;  5GT0 D;  3MGS D;  3TU4 B;  4WV4 B;  1EQZ C;  2HUE C;  1KX3 B;  1P3P C;  5BT1 C;  5B33 B;  4J8U A;  3AZH D;  3WA9 A;  3W97 B;  1U35 C;  5GXQ C;  5B2J D;  5CP6 B;  4ZUX A;  3O62 B;  3AZN D;  1WWS A;  3AZG D;  3AN2 C;  5B32 A;  2RVQ C;  3W98 A;  3AZL C;  1M1A D;  3X1U C;  5B31 A;  5B2I B;  3C1B B;  3MVD D;  3B6F D;  3MNN B;  2PYO B;  3AFA A;  5B0Z D;  1Q9C A;  3A6N B;  1KX4 B;  5AY8 D;  5B33 C;  5B1M B;  2CV5 B;  1TZY B;  4X23 B;  3W97 C;  5DNN D;  1P3L A;  5B24 B;  4J8U D;  3LJA A;  5CPJ A;  3WA9 D;  2NZD B;  3TU4 A;  1KX3 A;  1P3A D;  3AZF C;  5GSU C;  3AZJ C;  4YM6 A;  2ARO B;  4DRB A;  5CP6 A;  3UTB B;  3O62 A;  3C1B C;  5B40 B;  1M19 C;  3AZI C;  3KSY A;  5AVC B;  1BH8 A;  3AFA D;  3REI C;  3C1C B;  5B1M C;  4HGA B;  1F66 B;  1TZY C;  3MNN A;  2PYO A;  2NZD C;  5AV8 A;  1P3L D;  3A6N A;  5CPJ D;  2L5A A;  4WU8 A;  1KX4 A;  4XUJ A;  4KGC C;  5BNV B;  2F8N B;  2CV5 A;  4X23 A;  1KX3 D;  2ARO C;  5GT0 B;  4H9P B;  3MGS B;  4J8W A;  5B24 A;  4YM6 D;  1P3G C;  5B40 C;  3AZH B;  3WKJ D;  2HIO C;  4H9S C;  4XZQ C;  5B2J B;  4NFT A;  4Z5T A;  4G91 B;  5JA4 B;  3AZN B;  3UTB A;  5CPI C;  3AZG B;  5AV5 B;  1M1A B;  3AV1 A;  2BYK A;  4HGA C;  3MGQ A;  3NQJ B;  5AVC A;  4UUZ B;  1ZLA D;  3MVD B;  3B6F B;  3C1C A;  2JSS A;  1P34 C;  5AV8 D;  4NE5 A;  1H3O B;  1JFI B;  1F66 A;  5B0Z B;  3A6N D;  4WU8 D;  4XUJ D;  3VH6 A;  4J8V C;  3AV2 C;  5AY8 B;  3NQU A;  4J8W D;  3AZH C;  5B24 D;  5AVB A;  5BNV A;  5B2J C;  5DNN B;  5GT3 D;  1M18 A;  3AZM D;  3WA9 B;  3MGR D;  3UT9 C;  3AZN C;  5GT0 A;  4H9P A;  2FJ7 B;  4Z5T D;  1S32 D;  1P3A B;  1P3B C;  5E5A C;  1M1A C;  5DNM A;  5AV6 D;  4DRA A;  3AV1 D;  4G92 B;  3MGQ D;  1P3K D;  4JJN A;  3B6F C;  3AZG A;  5AV5 A;  3W99 D;  2NQB C;  3NQJ A;  5B1L A;  4UUZ A;  3MVD A;  3AZK C;  4E45 A;  3W96 C;  4NE6 A;  1KX5 C;  4J8U C;  5B0Z A;  1ID3 A;  1AOI A;  3WA9 C;  5AVB D;  1HQ3 A;  1P3L B;  1M18 D;  5CPJ B;  4ZUX C;  3AYW B;  3B0C W;  1P3I D;  5B32 C;  5DNN A;  4YM6 B;  3W98 C;  1F1E A;  5DNM D;  5B31 C;  4G92 C;  2FJ7 A;  3WKJ B;  1P3A A;  5AV9 A;  4EO5 B;  4WU9 C;  4JJN D;  5FUG A;  3B6G C;  5AV5 D;  3LZ1 B;  3WTP A;  1BH8 B;  3AFA C;  1KU5 A;  5B1L D;  5BNX B;  1ULY A;  1ZLA B;  4Z2M H;  1P3O D;  4H9O B;  1P3L C;  3WAA D;  3LJA C;  1AOI D;  3REJ A;  3X1V C;  3VH5 T;  1ID3 D;  1WWI A;  2IO5 C;  3B0D C;  5AV8 B;  3LEL A;  3TU4 C;  1HQ3 D;  1KX3 C;  3REK D;  4WU8 B;  4XUJ B;  3REL B;  1EQZ A;  5KDM A;  4J8W B;  5CP6 C;  3O62 C;  4H9Q B;  5GT3 B;  3AYW A;  4KUD D;  3AZM B;  2FJ7 D;  4QLC A;  3MGR B;  3AZE D;  5AV9 D;  4E44 A;  4Z5T B;  1S32 B;  3KWQ B;  1A7W A;  5C3I B;  5B2I C;  3WKJ A;  5JRG D;  5AV6 B;  3LZ0 D;  3WTP D;  1R4V A;  3AV1 B;  2BYK B;  3MGQ B;  1P3K B;  3LZ1 A;  3MNN C;  2F8N K;  4YS3 B;  2PYO C;  2LY8 A;  3W99 B;  3KXB B;  5AV8 C;  5BNX A;  3VH6 W;  3A6N C;  1KX4 C;  4WU8 C;  4XUJ C;  3REJ D;  3LEL D;  3MGP D;  1ZLA A;  2CV5 C;  4X23 C;  4H9O A;  4J8W C;  5B24 C;  1TAF B;  1EQZ D;  4H9N B;  3NQU B;  5CPK B;  5BT1 D;  5AVB B;  4Z2M G;  4Z5T C;  3REL A;  3AYW D;  1M18 B;  1U35 D;  5GXQ D;  4QLC D;  5C3I C;  3UTB C;  1P3I B;  4CSR B;  2YFV B;  4H9Q A;  3X1S B;  5GT3 A;  3AZM A;  5DNM B;  3AV1 C;  3AN2 D;  3MGR A;  2RVQ D;  3B0B A;  3MGQ C;  3UTA B;  3X1U D;  1S32 A;  3KWQ A;  5AVC C;  4JJN B;  5AV6 A;  3LZ1 D;  3C1C C;  1P3K A;  1F66 C;  5B1L B;  3X1T A;  1N1J A;  4YS3 A;  3W99 A;  3KXB A;  5F99 B;  5AVB C;  1P3O B;  3WAA B;  1AOI B;  1ID3 B;  5GT0 C;  3MGS C;  1HQ3 B;  3REL D;  3REK B;  1TAF A;  4H9N A;  1P3F A;  5CPK A;  3AZF D;  3AZJ D;  4G91 C;  4KUD B;  4JJN C;  3AZG C;  3AZE B;  4CSR A;  2YFV A;  5AV5 C;  5AV9 B;  3KWQ D;  1P3I A;  3X1S A;  5G49 B;  5FUG B;  2BYM A;  3UTA A;  5JRG B;  5B1L C;  3LZ0 B;  5CPI A;  1M19 D;  3WTP B;  4J8X B;  3MVD C;  3X1T D;  4YS3 D;  3REI D;  3KXB D;  3WTP E;  5BS7 A;  5B0Z C;  1ID3 C;  4CAY B;  3KUY A;  1HQ3 C;  1P3M A;  3REJ B;  4AWL B;  5AY8 C;  3LEL B;  3MGP B;  4ZBJ B;  5F99 A;  4KGC D;  1P3O A;  5DNN C;  3WAA A;  1P3F D;  5CPK D;  1EQZ B;  5KDM B;  2HUE B;  2FJ7 C;  3REK A;  3V9R B;  4Z66 A;  4H9R A;  5AV9 C;  1P3A C;  2HIO D;  5GXQ B;  1U35 B;  4QLC B;  4XZQ D;  3X1S D;  3WTP C;  4KUD A;  3UTA D;  5CPI D;  3AN2 B;  3AZE A;  3X1U B;  5G49 A;  3VH5 A;  5JRG A;  3LZ0 A;  4J8X A;  3REH A;  4AWL C;  3LEL C;  3KUY D;  5B32 G;  1B6W A;  1P3M D;  3AZK A;  5B31 G;  2YFW B;  5F99 D;  4R8P A;  4CAY A;  5B0Y A;  4J8V D;  3AV2 D;  5CPJ C;  1KX5 A;  3MGP A;  3AYW C;  4LD9 A;  4QLC C;  4Z66 D;  4YM6 C;  3UT9 D;  3WKJ C;  1P3P A;  3AZF B;  5GSU B;  3V9R A;  3AZJ B;  5E5A D;  1P3B D;  4EO5 C;  4KHA B;  1U35 A;  5GXQ A;  4NE3 A;  3LZ1 C;  4WU9 A;  3B6G A;  3AN2 A;  4J8X D;  2NQB D;  3REH D;  3AZL A;  1M19 B;  3X1U A;  3AZI B;  1ZLA C;  1HTA A;  3X1T B;  1N1J B;  3AZK D;  3REI B;  3W96 D;  4R8P D;  5B0Y D;  1KX5 D;  3REL C;  3X1V A;  2YFW A;  4LD9 D;  4ZUX D;  4KGC B;  5B33 A;  5GT3 C;  3W97 A;  3AZM C;  1P3F B;  1P3P D;  5B32 D;  3MGR C;  2CWE A;  1P3G B;  3W98 D;  3R45 B;  2F8N H;  1S32 C;  5B31 D;  3KWQ C;  2HIO B;  5AV6 C;  3AZF A;  5GSU A;  4XZQ B;  4WU9 D;  3AZJ A;  4KHA A;  3B6G D;  5B2I A;  1P3K C;  2BYM B;  3AZL D;  5CPI B;  3X1T C;  3C1B A;  3W99 C;  4YS3 C;  5CHL B;  3KXB C;  1BH9 B;  1M19 A;  3AZI A;  3B0C T;  4WNN B;  3KUY B;  3LJA D;  3REI A;  3X1V D;  1P3M B;  5B1M A;  1P34 B;  3TU4 D;  1TZY A;  1P3F C;  5CPK C;  5B33 D;  4J8V B;  3AV2 B;  1M18 C;  2NZD A;  3W97 D;  5CP6 D;  3O62 D;  4KGC A;  1P3I C;  4H9R B;  4Z66 B;  3X1S C;  5DNM C;  3UT9 B;  5GSU D;  2ARO A;  1P3G A;  3UTA C;  3R45 A;  3VH5 W;  1P3B B;  5E5A B;  1B67 A;  5B40 A;  5B2I D;  5BO0 B;  2HIO A;  4H9S A;  4XZQ A;  3C1B D;  2F8N G;  5BS7 C;  3AZI D;  3MNN D;  2PYO D;  3REH B;  3KUY C;  2NQB B;  1P3M C;  1BH9 A;  1BFM A;  1KX4 D;  5F99 C;  1P3O C;  5B1M D;  3AZK B;  3WAA C;  1TZY D;  4X23 D;  2CV5 D;  1AOI C;  3W96 B;  4WNN A;  4R8P B;  5B0Y B;  3REK C;  2NZD D;  4Z66 C;  1KX5 B;  1P34 A;  2F8N A;  4J8U B;  4LD9 B;  3MGS A;  4ZUX B;  4J8V A;  3AV2 A;  2ARO D;  3AZH A;  4KUD C;  1P3G D;  3UTB D;  1P3P B;  5B32 B;  3AZE C;  5B2J A;  3W98 B;  3VH6 T;  5B40 D;  5JA4 A;  5B31 B;  3UT9 A;  3AZN A;  5JRG C;  3LZ0 C;  1P3B A;  4WU9 B;  5E5A A;  5AVC D;  4J8X C;  4M6B A;  3REH C;  1M1A A;  5BO0 A;  3B6G B; 
#chains in the Genus database with same CATH topology
 3AZL B;  3C1C D;  2VQR A;  3AFA B;  1F66 D;  3B6F A;  4R8P C;  2NQB A;  5B0Y C;  3REJ C;  1H3O A;  1JFI A;  3MGP C;  4ZBJ C;  4LD9 C;  4WZS B;  2F8N D;  1P34 D;  3LJA B;  3X1V B;  3W96 A;  5AY8 A;  2IO5 B;  3B0D B;  5GT0 D;  3FDD A;  3MGS D;  4WV4 B;  3TU4 B;  2HUE C;  1KX3 B;  1EQZ C;  1P3P C;  5BT1 C;  5B33 B;  2Y2P A;  4J8U A;  2FFF B;  3AZH D;  3WA9 A;  3W97 B;  1U35 C;  5GXQ C;  5B2J D;  5CP6 B;  4ZUX A;  3O62 B;  3AZN D;  1WWS A;  3AZG D;  3AN2 C;  5B32 A;  2RVQ C;  3W98 A;  3AZL C;  1M1A D;  3X1U C;  5B31 A;  5B2I B;  3C1B B;  3MVD D;  2Y2O A;  3B6F D;  3MNN B;  2PYO B;  3AFA A;  3A1K A;  5B0Z D;  1Q9C A;  3A6N B;  1KX4 B;  5AY8 D;  5B33 C;  5B1M B;  2CV5 B;  1TZY B;  4X23 B;  3W97 C;  3H0L C;  5DNN D;  1P3L A;  5B24 B;  4J8U D;  3LJA A;  5CPJ A;  3WA9 D;  2NZD B;  3TU4 A;  1KX3 A;  1P3A D;  3AZF C;  5GSU C;  3AZJ C;  4YM6 A;  3EPJ A;  2ARO B;  4DRB A;  5CP6 A;  3UTB B;  3O62 A;  3C1B C;  5B40 B;  2ZY4 A;  2RIQ A;  1M19 C;  3AZI C;  3KSY A;  5AVC B;  1BH8 A;  3AFA D;  4DQY B;  3C1C B;  3REI C;  5B1M C;  4HGA B;  1F66 B;  1TZY C;  3MNN A;  2PYO A;  2NZD C;  5AV8 A;  1P3L D;  3A6N A;  5CPJ D;  2L5A A;  4WU8 A;  1KX4 A;  4XUJ A;  4KGC C;  5BNV B;  2F8N B;  2CV5 A;  4X23 A;  1KX3 D;  2ARO C;  5GT0 B;  4H9P B;  3MGS B;  4J8W A;  5B24 A;  4YM6 D;  1P3G C;  5B40 C;  3AZH B;  3WKJ D;  2HIO C;  4H9S C;  1PZR A;  4XZQ C;  5B2J B;  4NFT A;  4Z5T A;  4G91 B;  5JA4 B;  2Y2K A;  3AZN B;  3UTB A;  5CPI C;  3AZG B;  2XD1 A;  5AV5 B;  3H0M C;  1M1A B;  3AV1 A;  2BYK A;  4HGA C;  3MGQ A;  3NQJ B;  5AVC A;  4UUZ B;  1ZLA D;  3MVD B;  3B6F B;  3C1C A;  2JSS A;  1P34 C;  5AV8 D;  4NE5 A;  1H3O B;  1JFI B;  1F66 A;  5B0Z B;  3A6N D;  4WU8 D;  4XUJ D;  3VH6 A;  4J8V C;  3AV2 C;  3IP4 C;  5AY8 B;  3NQU A;  4J8W D;  3AZH C;  5B24 D;  5AVB A;  5BNV A;  5B2J C;  5DNN B;  5GT3 D;  1M18 A;  3AZM D;  3WA9 B;  3MGR D;  3UT9 C;  2G5H C;  3AZN C;  5GT0 A;  4H9P A;  2FJ7 B;  4Z5T D;  1S32 D;  1P3A B;  1P3B C;  5E5A C;  1M1A C;  5DNM A;  5AV6 D;  4DRA A;  3AV1 D;  4G92 B;  3MGQ D;  1P3K D;  4JJN A;  3B6F C;  2Y2G A;  3AZG A;  5AV5 A;  3W99 D;  2NQB C;  3NQJ A;  5B1L A;  4UUZ A;  3MVD A;  3AZK C;  4E45 A;  3W96 C;  2JE5 A;  4WJ3 C;  4NE6 A;  1KX5 C;  4J8U C;  5B0Z A;  1ID3 A;  1AOI A;  3WA9 C;  5AVB D;  1HQ3 A;  1P3L B;  1M18 D;  3H0R C;  4ZUX C;  5CPJ B;  1T3U A;  3AYW B;  3B0C W;  1P3I D;  5B32 C;  5DNN A;  4YM6 B;  3W98 C;  1F1E A;  5DNM D;  5B31 C;  4G92 C;  2FJ7 A;  3WKJ B;  1P3A A;  5AV9 A;  4EO5 B;  4WU9 C;  4JJN D;  5FUG A;  3B6G C;  5AV5 D;  3LZ1 B;  3WTP A;  1BH8 B;  3AFA C;  1KU5 A;  5B1L D;  5BNX B;  3KFU G;  1ULY A;  1ZLA B;  1Z2C B;  4Z2M H;  1P3O D;  4H9O B;  2Y2L A;  1P3L C;  3WAA D;  3LJA C;  1AOI D;  3REJ A;  3X1V C;  3VH5 T;  1ID3 D;  1WWI A;  2IO5 C;  3B0D C;  5AV8 B;  3LEL A;  3TU4 C;  1HQ3 D;  1KX3 C;  3REK D;  4WU8 B;  4XUJ B;  2Y2N A;  3REL B;  1EQZ A;  5KDM A;  4J8W B;  5CP6 C;  3O62 C;  4H9Q B;  2UWX A;  5GT3 B;  3AYW A;  4KUD D;  3AZM B;  2FJ7 D;  3EPH A;  4QLC A;  3MGR B;  3AZE D;  5AV9 D;  4E44 A;  4Z5T B;  1S32 B;  3KWQ B;  1A7W A;  5C3I B;  5B2I C;  3WKJ A;  5JRG D;  5AV6 B;  3LZ0 D;  3WTP D;  1R4V A;  3AV1 B;  3AL0 C;  2BYK B;  3MGQ B;  1P3K B;  3LZ1 A;  3MNN C;  2F8N K;  4YS3 B;  2PYO C;  2LY8 A;  3W99 B;  3KXB B;  2Y2M A;  5AV8 C;  5BNX A;  3VH6 W;  3A6N C;  1KX4 C;  4WU8 C;  4XUJ C;  3REJ D;  3LEL D;  3MGP D;  1ZLA A;  2CV5 C;  4X23 C;  2Y2J A;  4H9O A;  4J8W C;  2F2A C;  5B24 C;  1TAF B;  1EQZ D;  4H9N B;  3NQU B;  5CPK B;  5BT1 D;  5AVB B;  4Z2M G;  4Z5T C;  3REL A;  3AYW D;  1M18 B;  1U35 D;  5GXQ D;  4QLC D;  5C3I C;  2ZM5 A;  3UTB C;  4CSR B;  2YFV B;  4H9Q A;  1P3I B;  3X1S B;  5GT3 A;  3AZM A;  5DNM B;  3AV1 C;  3AN2 D;  3MGR A;  2RVQ D;  3B0B A;  3MGQ C;  3UTA B;  3X1U D;  1S32 A;  3KWQ A;  5AVC C;  4JJN B;  5AV6 A;  3LZ1 D;  4UPK A;  3C1C C;  2Y2Q A;  1P3K A;  1F66 C;  5B1L B;  3X1T A;  1N1J A;  4YS3 A;  3W99 A;  3KXB A;  5F99 B;  5AVB C;  1P3O B;  3WAA B;  1AOI B;  1ID3 B;  5GT0 C;  3MGS C;  1HQ3 B;  3REL D;  3REK B;  3F6T A;  1TAF A;  4H9N A;  1P3F A;  5CPK A;  2G5I C;  3AZF D;  3AZJ D;  2ZY3 A;  4G91 C;  2ZY5 A;  4KUD B;  4JJN C;  3AZG C;  3AZE B;  4CSR A;  2YFV A;  5AV9 B;  5AV5 C;  3KWQ D;  1P3I A;  3X1S A;  5G49 B;  5FUG B;  2DF4 C;  2BYM A;  3UTA A;  5JRG B;  5B1L C;  3LZ0 B;  5CPI A;  1M19 D;  3WTP B;  4J8X B;  3MVD C;  3X1T D;  4YS3 D;  3REI D;  3KXB D;  3WTP E;  5BS7 A;  5B0Z C;  1ID3 C;  4CAY B;  3KUY A;  1HQ3 C;  1P3M A;  3REJ B;  4AWL B;  5AY8 C;  3LEL B;  3MGP B;  4ZBJ B;  5F99 A;  3P5J B;  4KGC D;  1P3O A;  5DNN C;  3WAA A;  1P3F D;  5CPK D;  1EQZ B;  5KDM B;  2HUE B;  2FJ7 C;  3REK A;  3V9R B;  4H9R A;  4Z66 A;  5AV9 C;  1P3A C;  2HIO D;  5GXQ B;  1U35 B;  4QLC B;  4XZQ D;  3X1S D;  3WTP C;  4KUD A;  3UTA D;  5CPI D;  3AN2 B;  3AZE A;  3X1U B;  5G49 A;  3VH5 A;  2DQN C;  5JRG A;  3LZ0 A;  4J8X A;  3REH A;  2Y2I A;  4AWL C;  3LEL C;  3KUY D;  5B32 G;  1B6W A;  1P3M D;  3AZK A;  5B31 G;  2YFW B;  5F99 D;  2J8P A;  4R8P A;  4CAY A;  2JCH A;  5B0Y A;  4J8V D;  3AV2 D;  5CPJ C;  1KX5 A;  3MGP A;  3AYW C;  4LD9 A;  4QLC C;  4Z66 D;  4YM6 C;  3UT9 D;  3WKJ C;  1P3P A;  3AZF B;  5GSU B;  3V9R A;  3AZJ B;  5E5A D;  1P3B D;  4EO5 C;  4KHA B;  1U35 A;  5GXQ A;  4NE3 A;  3LZ1 C;  4WU9 A;  3B6G A;  3AN2 A;  4J8X D;  2NQB D;  3REH D;  3AZL A;  1M19 B;  3X1U A;  3AZI B;  2W8S A;  1ZLA C;  1HTA A;  3X1T B;  1N1J B;  3EPL A;  3REI B;  3AZK D;  3W96 D;  4R8P D;  5B0Y D;  1KX5 D;  3REL C;  3X1V A;  2YFW A;  4LD9 D;  4ZUX D;  4KGC B;  5B33 A;  2Y2H A;  1W2E A;  5GT3 C;  3W97 A;  3AZM C;  1P3F B;  1P3P D;  5B32 D;  3MGR C;  2CWE A;  1P3G B;  3W98 D;  3R45 B;  2XD5 A;  2F8N H;  1S32 C;  5B31 D;  3KWQ C;  2HIO B;  5AV6 C;  3AZF A;  5GSU A;  4XZQ B;  4WU9 D;  3AZJ A;  4KHA A;  3B6G D;  5B2I A;  1P3K C;  2BYM B;  3AZL D;  5CPI B;  3X1T C;  3C1B A;  3W99 C;  4YS3 C;  2ZY2 A;  5CHL B;  3KXB C;  1BH9 B;  2BG1 A;  1M19 A;  3AZI A;  3B0C T;  4WNN B;  3KUY B;  3LJA D;  3REI A;  3X1V D;  1P3M B;  5B1M A;  1P34 B;  3TU4 D;  1TZY A;  1P3F C;  5CPK C;  5B33 D;  4J8V B;  3AV2 B;  1M18 C;  2NZD A;  3W97 D;  5CP6 D;  3O62 D;  4KGC A;  1P3I C;  4H9R B;  4Z66 B;  3X1S C;  5DNM C;  3UT9 B;  5GSU D;  2ARO A;  3EG5 B;  1P3G A;  3UTA C;  3R45 A;  3VH5 W;  1P3B B;  5E5A B;  1B67 A;  5B40 A;  5B2I D;  5BO0 B;  2HIO A;  4H9S A;  4XZQ A;  3C1B D;  2F8N G;  5BS7 C;  3AZI D;  3MNN D;  2PYO D;  3REH B;  3KUY C;  2NQB B;  1P3M C;  1BH9 A;  1BFM A;  1KX4 D;  5F99 C;  1P3O C;  5B1M D;  3AZK B;  3WAA C;  1TZY D;  4X23 D;  2CV5 D;  1AOI C;  3W96 B;  4WNN A;  4R8P B;  3A1I A;  5B0Y B;  3REK C;  2NZD D;  4Z66 C;  1KX5 B;  1P34 A;  2F8N A;  4J8U B;  4LD9 B;  3MGS A;  4ZUX B;  4J8V A;  3AV2 A;  2ARO D;  3AZH A;  4KUD C;  1P3G D;  3UTB D;  1P3P B;  5B32 B;  3AZE C;  5B2J A;  3W98 B;  3VH6 T;  5B40 D;  5JA4 A;  5B31 B;  3UT9 A;  3AZN A;  5JRG C;  3LZ0 C;  1P3B A;  4WU9 B;  5E5A A;  5AVC D;  3EPK A;  4M6B A;  4J8X C;  3REH C;  1M1A A;  5BO0 A;  3B6G B; 
#chains in the Genus database with same CATH homology
 3AZL B;  3C1C D;  2VQR A;  3AFA B;  1F66 D;  3B6F A;  4R8P C;  2NQB A;  5B0Y C;  3REJ C;  1H3O A;  1JFI A;  3MGP C;  4ZBJ C;  4LD9 C;  4WZS B;  2F8N D;  1P34 D;  3LJA B;  3X1V B;  3W96 A;  5AY8 A;  2IO5 B;  3B0D B;  5GT0 D;  3FDD A;  3MGS D;  4WV4 B;  3TU4 B;  2HUE C;  1KX3 B;  1EQZ C;  1P3P C;  5BT1 C;  5B33 B;  2Y2P A;  4J8U A;  2FFF B;  3AZH D;  3WA9 A;  3W97 B;  1U35 C;  5GXQ C;  5B2J D;  5CP6 B;  4ZUX A;  3O62 B;  3AZN D;  1WWS A;  3AZG D;  3AN2 C;  5B32 A;  2RVQ C;  3W98 A;  3AZL C;  1M1A D;  3X1U C;  5B31 A;  5B2I B;  3C1B B;  3MVD D;  2Y2O A;  3B6F D;  3MNN B;  2PYO B;  3AFA A;  3A1K A;  5B0Z D;  1Q9C A;  3A6N B;  1KX4 B;  5AY8 D;  5B33 C;  5B1M B;  2CV5 B;  1TZY B;  4X23 B;  3W97 C;  3H0L C;  5DNN D;  1P3L A;  5B24 B;  4J8U D;  3LJA A;  5CPJ A;  3WA9 D;  2NZD B;  3TU4 A;  1KX3 A;  1P3A D;  3AZF C;  5GSU C;  3AZJ C;  4YM6 A;  3EPJ A;  2ARO B;  4DRB A;  5CP6 A;  3UTB B;  3O62 A;  3C1B C;  5B40 B;  2ZY4 A;  2RIQ A;  1M19 C;  3AZI C;  3KSY A;  5AVC B;  1BH8 A;  3AFA D;  4DQY B;  3C1C B;  3REI C;  5B1M C;  4HGA B;  1F66 B;  1TZY C;  3MNN A;  2PYO A;  2NZD C;  5AV8 A;  1P3L D;  3A6N A;  5CPJ D;  2L5A A;  4WU8 A;  1KX4 A;  4XUJ A;  4KGC C;  5BNV B;  2F8N B;  2CV5 A;  4X23 A;  1KX3 D;  2ARO C;  5GT0 B;  4H9P B;  3MGS B;  4J8W A;  5B24 A;  4YM6 D;  1P3G C;  5B40 C;  3AZH B;  3WKJ D;  2HIO C;  4H9S C;  1PZR A;  4XZQ C;  5B2J B;  4NFT A;  4Z5T A;  4G91 B;  5JA4 B;  2Y2K A;  3AZN B;  3UTB A;  5CPI C;  3AZG B;  2XD1 A;  5AV5 B;  3H0M C;  1M1A B;  3AV1 A;  2BYK A;  4HGA C;  3MGQ A;  3NQJ B;  5AVC A;  4UUZ B;  1ZLA D;  3MVD B;  3B6F B;  3C1C A;  2JSS A;  1P34 C;  5AV8 D;  4NE5 A;  1H3O B;  1JFI B;  1F66 A;  5B0Z B;  3A6N D;  4WU8 D;  4XUJ D;  3VH6 A;  4J8V C;  3AV2 C;  3IP4 C;  5AY8 B;  3NQU A;  4J8W D;  3AZH C;  5B24 D;  5AVB A;  5BNV A;  5B2J C;  5DNN B;  5GT3 D;  1M18 A;  3AZM D;  3WA9 B;  3MGR D;  3UT9 C;  2G5H C;  3AZN C;  5GT0 A;  4H9P A;  2FJ7 B;  4Z5T D;  1S32 D;  1P3A B;  1P3B C;  5E5A C;  1M1A C;  5DNM A;  5AV6 D;  4DRA A;  3AV1 D;  4G92 B;  3MGQ D;  1P3K D;  4JJN A;  3B6F C;  2Y2G A;  3AZG A;  5AV5 A;  3W99 D;  2NQB C;  3NQJ A;  5B1L A;  4UUZ A;  3MVD A;  3AZK C;  4E45 A;  3W96 C;  2JE5 A;  4WJ3 C;  4NE6 A;  1KX5 C;  4J8U C;  5B0Z A;  1ID3 A;  1AOI A;  3WA9 C;  5AVB D;  1HQ3 A;  1P3L B;  1M18 D;  3H0R C;  4ZUX C;  5CPJ B;  1T3U A;  3AYW B;  3B0C W;  1P3I D;  5B32 C;  5DNN A;  4YM6 B;  3W98 C;  1F1E A;  5DNM D;  5B31 C;  4G92 C;  2FJ7 A;  3WKJ B;  1P3A A;  5AV9 A;  4EO5 B;  4WU9 C;  4JJN D;  5FUG A;  3B6G C;  5AV5 D;  3LZ1 B;  3WTP A;  1BH8 B;  3AFA C;  1KU5 A;  5B1L D;  5BNX B;  3KFU G;  1ULY A;  1ZLA B;  1Z2C B;  4Z2M H;  1P3O D;  4H9O B;  2Y2L A;  1P3L C;  3WAA D;  3LJA C;  1AOI D;  3REJ A;  3X1V C;  3VH5 T;  1ID3 D;  1WWI A;  2IO5 C;  3B0D C;  5AV8 B;  3LEL A;  3TU4 C;  1HQ3 D;  1KX3 C;  3REK D;  4WU8 B;  4XUJ B;  2Y2N A;  3REL B;  1EQZ A;  5KDM A;  4J8W B;  5CP6 C;  3O62 C;  4H9Q B;  2UWX A;  5GT3 B;  3AYW A;  4KUD D;  3AZM B;  2FJ7 D;  3EPH A;  4QLC A;  3MGR B;  3AZE D;  5AV9 D;  4E44 A;  4Z5T B;  1S32 B;  3KWQ B;  1A7W A;  5C3I B;  5B2I C;  3WKJ A;  5JRG D;  5AV6 B;  3LZ0 D;  3WTP D;  1R4V A;  3AV1 B;  3AL0 C;  2BYK B;  3MGQ B;  1P3K B;  3LZ1 A;  3MNN C;  2F8N K;  4YS3 B;  2PYO C;  2LY8 A;  3W99 B;  3KXB B;  2Y2M A;  5AV8 C;  5BNX A;  3VH6 W;  3A6N C;  1KX4 C;  4WU8 C;  4XUJ C;  3REJ D;  3LEL D;  3MGP D;  1ZLA A;  2CV5 C;  4X23 C;  2Y2J A;  4H9O A;  4J8W C;  2F2A C;  5B24 C;  1TAF B;  1EQZ D;  4H9N B;  3NQU B;  5CPK B;  5BT1 D;  5AVB B;  4Z2M G;  4Z5T C;  3REL A;  3AYW D;  1M18 B;  1U35 D;  5GXQ D;  4QLC D;  5C3I C;  2ZM5 A;  3UTB C;  4CSR B;  2YFV B;  4H9Q A;  1P3I B;  3X1S B;  5GT3 A;  3AZM A;  5DNM B;  3AV1 C;  3AN2 D;  3MGR A;  2RVQ D;  3B0B A;  3MGQ C;  3UTA B;  3X1U D;  1S32 A;  3KWQ A;  5AVC C;  4JJN B;  5AV6 A;  3LZ1 D;  4UPK A;  3C1C C;  2Y2Q A;  1P3K A;  1F66 C;  5B1L B;  3X1T A;  1N1J A;  4YS3 A;  3W99 A;  3KXB A;  5F99 B;  5AVB C;  1P3O B;  3WAA B;  1AOI B;  1ID3 B;  5GT0 C;  3MGS C;  1HQ3 B;  3REL D;  3REK B;  3F6T A;  1TAF A;  4H9N A;  1P3F A;  5CPK A;  2G5I C;  3AZF D;  3AZJ D;  2ZY3 A;  4G91 C;  2ZY5 A;  4KUD B;  4JJN C;  3AZG C;  3AZE B;  4CSR A;  2YFV A;  5AV9 B;  5AV5 C;  3KWQ D;  1P3I A;  3X1S A;  5G49 B;  5FUG B;  2DF4 C;  2BYM A;  3UTA A;  5JRG B;  5B1L C;  3LZ0 B;  5CPI A;  1M19 D;  3WTP B;  4J8X B;  3MVD C;  3X1T D;  4YS3 D;  3REI D;  3KXB D;  3WTP E;  5BS7 A;  5B0Z C;  1ID3 C;  4CAY B;  3KUY A;  1HQ3 C;  1P3M A;  3REJ B;  4AWL B;  5AY8 C;  3LEL B;  3MGP B;  4ZBJ B;  5F99 A;  3P5J B;  4KGC D;  1P3O A;  5DNN C;  3WAA A;  1P3F D;  5CPK D;  1EQZ B;  5KDM B;  2HUE B;  2FJ7 C;  3REK A;  3V9R B;  4H9R A;  4Z66 A;  5AV9 C;  1P3A C;  2HIO D;  5GXQ B;  1U35 B;  4QLC B;  4XZQ D;  3X1S D;  3WTP C;  4KUD A;  3UTA D;  5CPI D;  3AN2 B;  3AZE A;  3X1U B;  5G49 A;  3VH5 A;  2DQN C;  5JRG A;  3LZ0 A;  4J8X A;  3REH A;  2Y2I A;  4AWL C;  3LEL C;  3KUY D;  5B32 G;  1B6W A;  1P3M D;  3AZK A;  5B31 G;  2YFW B;  5F99 D;  2J8P A;  4R8P A;  4CAY A;  2JCH A;  5B0Y A;  4J8V D;  3AV2 D;  5CPJ C;  1KX5 A;  3MGP A;  3AYW C;  4LD9 A;  4QLC C;  4Z66 D;  4YM6 C;  3UT9 D;  3WKJ C;  1P3P A;  3AZF B;  5GSU B;  3V9R A;  3AZJ B;  5E5A D;  1P3B D;  4EO5 C;  4KHA B;  1U35 A;  5GXQ A;  4NE3 A;  3LZ1 C;  4WU9 A;  3B6G A;  3AN2 A;  4J8X D;  2NQB D;  3REH D;  3AZL A;  1M19 B;  3X1U A;  3AZI B;  2W8S A;  1ZLA C;  1HTA A;  3X1T B;  1N1J B;  3EPL A;  3REI B;  3AZK D;  3W96 D;  4R8P D;  5B0Y D;  1KX5 D;  3REL C;  3X1V A;  2YFW A;  4LD9 D;  4ZUX D;  4KGC B;  5B33 A;  2Y2H A;  1W2E A;  5GT3 C;  3W97 A;  3AZM C;  1P3F B;  1P3P D;  5B32 D;  3MGR C;  2CWE A;  1P3G B;  3W98 D;  3R45 B;  2XD5 A;  2F8N H;  1S32 C;  5B31 D;  3KWQ C;  2HIO B;  5AV6 C;  3AZF A;  5GSU A;  4XZQ B;  4WU9 D;  3AZJ A;  4KHA A;  3B6G D;  5B2I A;  1P3K C;  2BYM B;  3AZL D;  5CPI B;  3X1T C;  3C1B A;  3W99 C;  4YS3 C;  2ZY2 A;  5CHL B;  3KXB C;  1BH9 B;  2BG1 A;  1M19 A;  3AZI A;  3B0C T;  4WNN B;  3KUY B;  3LJA D;  3REI A;  3X1V D;  1P3M B;  5B1M A;  1P34 B;  3TU4 D;  1TZY A;  1P3F C;  5CPK C;  5B33 D;  4J8V B;  3AV2 B;  1M18 C;  2NZD A;  3W97 D;  5CP6 D;  3O62 D;  4KGC A;  1P3I C;  4H9R B;  4Z66 B;  3X1S C;  5DNM C;  3UT9 B;  5GSU D;  2ARO A;  3EG5 B;  1P3G A;  3UTA C;  3R45 A;  3VH5 W;  1P3B B;  5E5A B;  1B67 A;  5B40 A;  5B2I D;  5BO0 B;  2HIO A;  4H9S A;  4XZQ A;  3C1B D;  2F8N G;  5BS7 C;  3AZI D;  3MNN D;  2PYO D;  3REH B;  3KUY C;  2NQB B;  1P3M C;  1BH9 A;  1BFM A;  1KX4 D;  5F99 C;  1P3O C;  5B1M D;  3AZK B;  3WAA C;  1TZY D;  4X23 D;  2CV5 D;  1AOI C;  3W96 B;  4WNN A;  4R8P B;  3A1I A;  5B0Y B;  3REK C;  2NZD D;  4Z66 C;  1KX5 B;  1P34 A;  2F8N A;  4J8U B;  4LD9 B;  3MGS A;  4ZUX B;  4J8V A;  3AV2 A;  2ARO D;  3AZH A;  4KUD C;  1P3G D;  3UTB D;  1P3P B;  5B32 B;  3AZE C;  5B2J A;  3W98 B;  3VH6 T;  5B40 D;  5JA4 A;  5B31 B;  3UT9 A;  3AZN A;  5JRG C;  3LZ0 C;  1P3B A;  4WU9 B;  5E5A A;  5AVC D;  3EPK A;  4M6B A;  4J8X C;  3REH C;  1M1A A;  5BO0 A;  3B6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...