4KUDD

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
KETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudD00
5DNNA 3MNNA 1P3BD 5AV6B 3X1UC 2NZDB 4WU8B 4NE5A 3AZKC 3AZGA 2NQBC 4J8WB 3AN2B 4YM6A 5DNNB 3MNNB 4YM6C 3TU4D 3B6FD 5CPIC 1F1EA 1S32A 1S32C 5CPKD 3AZGB 3X1VA 3W96A 3W96C 1HQ3C 2BYKA 3B0CT 3W97A 5GT0A 3W97C 4XUJA 4XUJC 1S32B 3X1VB 3W96B 5GT3A 5GT3C 1P3OA 5B1MD 1P3OC 3AZLC 1P3BA 5G49A 5F99D 4NE6A 2BYKB 5GT0B 3W97B 4XUJB 5AV9D 1P3MC 4KUDD 3WA9D 1A7WA 5GT3B 1P3OB 1P3BB 5G49B 3TU4A 3B6FA 3TU4C 1M1AC 3UT9D 1P3KC 5CPKA 5CPKC 5B2JD 3A6ND 3NQUA 5BT1C 3O62D 4XZQC 3TU4B 3B6FB 3REKC 5CPKB 1EQZD 1B6WA 3MGSC 3KUYC 1KX4D 5B24D 5B1MA 3NQUB 5F99A 3WTPC 1ULYA 3AZED 5AV9A 4H9PA 5AV9C 4X23C 5AVBC 4G92B 4KUDA 3WA9A 3WA9C 5B1MB 5F99B 3W99D 1P3PD 3UT9A 5AV9B 3UT9C 4H9PB 2F8NH 5AV8D 1P3GC 3AV2D 4KUDB 3WA9B 5B2JA 5B2JC 3A6NA 3O62A 3A6NC 4H9SA 5B32D 5CP6D 3UT9B 2L5AA 3REIC 3REJC 3C1BD 5B2JB 1KX4A 5B24A 2AROA 3A6NB 2AROC 3O62B 1P3AD 4YS3D 2HUEC 1BFMA 3WAAD 5B33D 3AZEA 3AZEC 4ZBJB 4J8XD 1AOIC 1EQZB 2FJ7D 3UTAD 1KX4B 3B0DC 5B24B 1F66C 3X1UD 3W99A 3W99C 1P3PA 1KX5C 3AZEB 1P3PC 3AZKD 2NQBD 5AV8A 3AV2A 1WWIA 3NQJA 1N1JA 5AVCD 5CPID 3W99B 5B32A 1P3PB 5B32C 5CP6A 3AZND 5AV8B 3LZ0D 3AV2B 1HQ3D 3C1CC 3C1BA 4AWLC 5C3IC 3NQJB 3AZMD 1P3AA 4YS3A 4J8VC 1P3AC 1N1JB 4YS3C 3AZFC 3WAAA 5B33A 1H3OA 5B32B 5CP6B 4HGAC 4J8XA 3W98C 4JJND 3C1BB 3AZJC 3RELD 4AWLB 3UTAA 3AZLD 3UTAC 3X1UA 1P3AB 4YS3B 3LELC 4H9QA 5B33B 1H3OB 3AZKA 3WAAB 5BNVA 4M6BA 4Z2MG 2NQBA 1P3MD 4J8XB 4KHAA 2FJ7B 3UTAB 5CPIA 5AVCA 4DRBA 3X1UB 1M1AD 5AVCC 3LJAC 4H9QB 3AZIC 3AZKB 1P3KD 5BNVB 5KDMA 2NQBB 3VH5T 3AZNA 3LZ0A 3AZNC 1HQ3A 3LZ0C 4KHAB 5BT1D 4XZQD 3AZMA 2F8ND 4YM6B 3AZMC 5CPIB 5AVCB 2CWEA 3REKD 4H9NA 2PYOC 3MGSD 5AY8D 5KDMB 3AFAC 3KUYD 3AZNB 3LZ0B 1HQ3B 2RVQD 5E5AC 4JJNA 3RELA 4JJNC 3AZLA 3RELC 3MGPC 1M18C 3WTPD 3AZMB 3X1TD 4CSRA 3AZHD 4H9NB 5B31C 5AVBD 4X23D 1P3MA 3VH6A 4JJNB 3RELB 3AZLB 1M1AA 4CSRB 1P3KA 1BH8A 1P3GD 1P3MB 5B32G 4NE3A 4XZQA 2F8NA 3MGRA 1M1AB 3REKA 3MGRC 3REID 1P3KB 3REJD 3MGSA 5AY8A 3KUYA 1BH8B 5FUGA 5AY8C 1P3FD 2RVQC 3KWQD 2AROD 2YFVA 4XZQB 5BO0A 3WTPA 3X1TA 2F8NB 3X1TC 4WZSB 3REKB 3AZHA 2YFWA 3AZHC 4X23A 5AVBA 1AOID 3MGSB 5AY8B 3KUYB 5FUGB 1P3ID 3LZ1D 1F66D 2YFVB 3WTPB 5BO0B 5B40C 3X1TB 1KX5D 3AZHB 2YFWB 4X23B 5AVBB 4H9RA 1P3GA 4QLCD 2F8NK 4R8PC 5JA4A 5AV5D 3REIA 5B0ZC 3VH5A 3REJA 4H9RB 3V9RA 3UTBC 1P3GB 1P3FA 1U35D 3C1CD 1P3FC 4ZUXC 4J8UD 3B6GD 3KWQA 3KWQC 1TZYD 4J8VD 3AZFD 5JA4B 1P34C 3VH6W 3REIB 1KX3C 1AOIA 3REHC 3REJB 4WU9D 4Z66D 3V9RB 1P3FB 1ID3D 3W98D 1P3IA 5B31G 3AZJD 1P3IC 3MGQC 4KGCC 1HTAA 3LZ1A 5BS7C 2AROB 3LZ1C 3KWQB 1F66A 2HUEB 3LELD 3AV1D 1KX5A 3B0BA 5JRGC 1AOIB 4H9OA 4QLCA 2FJ7A 4QLCC 5GSUC 1P3IB 1P3LC 3B0DB 5CHLB 1F66B 4G91C 5AV5A 3LJAD 5AV5C 1KX5B 3AZID 5DNMD 2F8NG 3KSYA 4H9OB 1U35A 3C1CA 4QLCB 1U35C 5B1LC 4J8UA 3B6GA 4J8UC 2HIOC 3B6GC 1TZYA 4J8VA 3AZFA 4G91B 1TZYC 4LD9D 3AYWD 5AV5B 1KU5A 1M19D 2PYOD 3AFAD 1ID3A 4Z66A 4WU9A 3W98A 1ID3C 4Z66C 4WU9C 1U35B 3C1CB 5E5AD 3AZJA 4J8UB 3MGPD 5C3IB 3B6GB 2LY8A 1M18D 1TZYB 4J8VB 3LELA 3AZFB 3AV1A 3AV1C 3R45A 5B31D 4HGAB 1ID3B 4Z66B 4WU9B 3W98B 2FJ7C 3AZJB 5B0YD 3LJAA 3LELB 3AV1B 3AZIA 5DNMA 3R45B 5DNMC 5AV6C 3B0CW 4J8WC 4LD9A 3AYWA 1M19A 3LJAB 3MGRD 3AYWC 1M19C 5DNNC 3MNNC 5DNMB 3AZIB 4LD9C 2PYOA 3AFAA 3AZGC 5E5AA 3MGPA 1M18A 3X1SD 4LD9B 3AYWB 1M19B 5B31A 2PYOB 3WTPE 3AFAB 5E5AB 3X1VC 3MGPB 1M18B 5B40D 5B0YA 3WKJD 5B0YC 5B31B 5GT0C 1BH9A 4EO5C 4R8PD 5B0YB 1P3BC 5B0ZD 5GXQD 5CPJD 1BH9B 3UTBD 4EO5B 3KXBD 4ZUXD 1P34D 4CAYA 5B2ID 3X1SA 1ZLAD 4Z5TD 3X1SC 3MGRB 1KX3D 3B6FC 3REHD 2IO5C 3MGQD 1JFIA 4KGCD 5B40A 3WKJA 4CAYB 3WKJC 3X1SB 2CV5D 5JRGD 5GSUD 1P3LD 4G92C 2IO5B 1JFIB 4R8PA 5B40B 3WKJB 5B1MC 5F99C 1R4VA 5B0ZA 5GXQA 3UTBA 5CPJA 5GXQC 5CPJC 3KXBA 5B1LD 4ZUXA 3KXBC 4DRAA 4KUDC 2HIOD 4R8PB 4WV4B 1P34A 5B2IA 1ZLAA 4Z5TA 5B2IC 1ZLAC 4Z5TC 1KX3A 5B0ZB 4WNNA 3REHA 4E44A 5GXQB 3UTBB 5CPJB 2BYMA 3KXBB 3MVDD 4ZUXB 3MGQA 4KGCA 5BS7A 1P34B 5B2IB 2CV5A 1ZLAB 3O62C 4Z5TB 2CV5C 4H9SC 1KX3B 5JRGA 4WNNB 3REHB 1Q9CA 2BYMB 4ZBJC 5GSUA 1P3LA 1EQZA 1EQZC 3MGQB 4KGCB 3LZ1B 1KX4C 5B24C 2CV5B 5AV6D 2NZDD 4WU8D 5JRGB 2JSSA 4Z2MH 5B1LA 5GSUB 4J8WD 1P3LB 3AN2D 2HIOA 3VH6T 5DNND 3MNND 1WWSA 3AZGD 3MVDA 5B1LB 3MVDC 5AV8C 3AV2C 2HIOB 4UUZA 4YM6D 1S32D 5CP6C 3MVDB 3X1VD 5BNXA 3W96D 1TAFA 4E45A 4UUZB 3C1BC 3VH5W 5AV6A 2NZDA 4NFTA 5GT0D 4WU8A 3W97D 2NZDC 3WAAC 4XUJD 5B33C 4WU8C 4J8WA 4J8XC 1B67A 3AN2A 5BNXB 1TAFB 3AN2C 5GT3D 1P3OD
chains in the Genus database with same CATH superfamily
5DNNA 3MNNA 1P3BD 2Y2NA 5AV6B 3X1UC 1PZRA 2NZDB 4WU8B 3F6TA 4NE5A 3AZKC 3AZGA 2NQBC 4J8WB 3AN2B 2ZY3A 3EPKA 4YM6A 5DNNB 3MNNB 4YM6C 3TU4D 3B6FD 5CPIC 1F1EA 1S32A 1S32C 5CPKD 3AZGB 3X1VA 3W96A 3W96C 1HQ3C 2Y2IA 2BYKA 2Y2LA 3B0CT 3W97A 5GT0A 3W97C 4XUJA 4XUJC 1S32B 4DQYB 3X1VB 3W96B 5GT3A 2Y2GA 5GT3C 1P3OA 5B1MD 1P3OC 3AZLC 1P3BA 5G49A 5F99D 4NE6A 2BYKB 5GT0B 3W97B 2ZY2A 4XUJB 5AV9D 3H0MC 1P3MC 4KUDD 3WA9D 1A7WA 5GT3B 1P3OB 1P3BB 5G49B 2Y2KA 3TU4A 3B6FA 3TU4C 1M1AC 3UT9D 1P3KC 5CPKA 5CPKC 5B2JD 3A6ND 3NQUA 5BT1C 3O62D 4XZQC 3TU4B 3B6FB 3REKC 2XD1A 1T3UA 5CPKB 1EQZD 1B6WA 3MGSC 3KUYC 1KX4D 5B24D 5B1MA 3NQUB 3H0RC 5F99A 3WTPC 1ULYA 3AZED 5AV9A 4H9PA 5AV9C 4X23C 5AVBC 4G92B 4KUDA 3WA9A 3WA9C 5B1MB 5F99B 3W99D 2XD5A 1P3PD 3UT9A 5AV9B 3UT9C 4H9PB 2F8NH 5AV8D 1P3GC 3AV2D 4KUDB 3WA9B 5B2JA 5B2JC 3A6NA 3O62A 3A6NC 4H9SA 5B32D 5CP6D 3UT9B 2L5AA 3REIC 3REJC 3C1BD 5B2JB 1KX4A 5B24A 2AROA 3A6NB 2AROC 3O62B 1P3AD 4YS3D 2HUEC 1BFMA 3WAAD 5B33D 3AZEA 3AZEC 4ZBJB 2Y2OA 2ZY5A 4J8XD 1AOIC 1EQZB 2FJ7D 3UTAD 1KX4B 3B0DC 5B24B 1F66C 3X1UD 3W99A 3W99C 1P3PA 1KX5C 3AZEB 1P3PC 3AZKD 2NQBD 5AV8A 3AV2A 4WJ3C 1WWIA 2RIQA 3NQJA 1N1JA 5AVCD 5CPID 3W99B 5B32A 1P3PB 5B32C 5CP6A 3AZND 5AV8B 3LZ0D 3AV2B 1HQ3D 3C1CC 3C1BA 4AWLC 2BG1A 5C3IC 3NQJB 3AZMD 1P3AA 4YS3A 2G5IC 4J8VC 1N1JB 4YS3C 3AZFC 1P3AC 3WAAA 5B33A 1H3OA 5B32B 5CP6B 4HGAC 4J8XA 3W98C 1W2EA 2Y2JA 4JJND 3C1BB 3AZJC 3RELD 4AWLB 3UTAA 3AZLD 3UTAC 3X1UA 1P3AB 4YS3B 3LELC 4H9QA 5B33B 1H3OB 2DF4C 3AZKA 3WAAB 5BNVA 4M6BA 4Z2MG 2NQBA 1P3MD 4J8XB 4KHAA 2FJ7B 3UTAB 5CPIA 5AVCA 4DRBA 3X1UB 1M1AD 5AVCC 3LJAC 4H9QB 3AZIC 3AZKB 1P3KD 5BNVB 5KDMA 2NQBB 3VH5T 3AZNA 3LZ0A 3AZNC 1HQ3A 3LZ0C 4KHAB 5BT1D 4XZQD 3AZMA 2F8ND 4YM6B 2UWXA 3AZMC 5CPIB 5AVCB 2CWEA 3REKD 4H9NA 2PYOC 3MGSD 5AY8D 5KDMB 3AFAC 3KUYD 3AZNB 3LZ0B 1HQ3B 2RVQD 5E5AC 4JJNA 3RELA 4JJNC 3AZLA 3EG5B 3RELC 3MGPC 1M18C 3WTPD 3AZMB 3X1TD 2ZM5A 4CSRA 3AZHD 4H9NB 5B31C 5AVBD 4X23D 1P3MA 3VH6A 4JJNB 3RELB 3AZLB 1M1AA 4CSRB 1P3KA 1BH8A 3A1IA 1P3GD 1P3MB 5B32G 4NE3A 3FDDA 4XZQA 2F8NA 3MGRA 1M1AB 3REKA 3MGRC 3REID 2G5HC 1P3KB 3REJD 3MGSA 5AY8A 3KUYA 1BH8B 5FUGA 5AY8C 1P3FD 2RVQC 3KWQD 2AROD 2YFVA 4XZQB 5BO0A 3WTPA 3X1TA 2F8NB 3X1TC 4WZSB 3REKB 3AZHA 2YFWA 3AZHC 4X23A 5AVBA 1AOID 3MGSB 5AY8B 3KUYB 5FUGB 2Y2HA 1P3ID 1Z2CB 3LZ1D 1F66D 2YFVB 3WTPB 5BO0B 5B40C 3X1TB 1KX5D 3AZHB 2YFWB 4X23B 5AVBB 4H9RA 1P3GA 4QLCD 2F8NK 4R8PC 5JA4A 5AV5D 3EPHA 3REIA 5B0ZC 3VH5A 3REJA 4H9RB 3V9RA 3UTBC 1P3GB 1P3FA 1U35D 3C1CD 1P3FC 4ZUXC 4J8UD 3B6GD 3KWQA 3KWQC 1TZYD 4J8VD 3AZFD 5JA4B 1P34C 3VH6W 3REIB 1KX3C 1AOIA 3REHC 3REJB 4WU9D 4Z66D 3V9RB 1P3FB 1ID3D 3W98D 1P3IA 2F2AC 5B31G 3AZJD 1P3IC 3MGQC 4KGCC 1HTAA 3LZ1A 5BS7C 2AROB 3LZ1C 3KWQB 1F66A 2HUEB 3LELD 3AV1D 1KX5A 3B0BA 5JRGC 1AOIB 4H9OA 4QLCA 2FJ7A 4QLCC 5GSUC 1P3IB 1P3LC 3B0DB 5CHLB 1F66B 4G91C 5AV5A 3LJAD 5AV5C 1KX5B 3AZID 5DNMD 3A1KA 2F8NG 3KSYA 4H9OB 1U35A 3C1CA 4QLCB 1U35C 2JE5A 5B1LC 4J8UA 3B6GA 4J8UC 2HIOC 3B6GC 1TZYA 4J8VA 3AZFA 4G91B 1TZYC 4LD9D 3AYWD 5AV5B 1KU5A 1M19D 2PYOD 3AFAD 1ID3A 4Z66A 4WU9A 3W98A 1ID3C 4Z66C 4UPKA 4WU9C 3C1CB 1U35B 5E5AD 3AZJA 4J8UB 3MGPD 5C3IB 3B6GB 2LY8A 1M18D 1TZYB 4J8VB 3LELA 3AZFB 3AV1A 3AV1C 3R45A 5B31D 4HGAB 1ID3B 4Z66B 4WU9B 3W98B 2FJ7C 3AZJB 5B0YD 3LJAA 3LELB 3AV1B 3AZIA 5DNMA 3R45B 5DNMC 5AV6C 3B0CW 4J8WC 2VQRA 4LD9A 3AYWA 1M19A 3LJAB 3MGRD 3AYWC 1M19C 5DNNC 3MNNC 5DNMB 3AZIB 4LD9C 2PYOA 3AFAA 2FFFB 5E5AA 3AZGC 3MGPA 1M18A 3X1SD 4LD9B 3AYWB 1M19B 2J8PA 5B31A 2PYOB 3WTPE 3AFAB 3H0LC 5E5AB 3X1VC 3MGPB 1M18B 5B40D 5B0YA 3WKJD 5B0YC 5B31B 5GT0C 1BH9A 4EO5C 4R8PD 5B0YB 1P3BC 5B0ZD 2DQNC 5GXQD 5CPJD 1BH9B 3UTBD 4EO5B 3KXBD 4ZUXD 2Y2PA 1P34D 4CAYA 5B2ID 3X1SA 1ZLAD 4Z5TD 3X1SC 3MGRB 1KX3D 3B6FC 3REHD 2IO5C 3MGQD 1JFIA 4KGCD 5B40A 3WKJA 4CAYB 3WKJC 3X1SB 2CV5D 3KFUG 5JRGD 2W8SA 5GSUD 1P3LD 4G92C 2IO5B 1JFIB 4R8PA 5B40B 3WKJB 5B1MC 5F99C 1R4VA 5B0ZA 2ZY4A 5GXQA 3UTBA 5CPJA 5GXQC 5CPJC 3KXBA 5B1LD 4ZUXA 3KXBC 4DRAA 4KUDC 2HIOD 4R8PB 4WV4B 1P34A 5B2IA 1ZLAA 4Z5TA 5B2IC 1ZLAC 4Z5TC 1KX3A 5B0ZB 4WNNA 3EPJA 3REHA 4E44A 5GXQB 3UTBB 5CPJB 2BYMA 2Y2QA 3KXBB 3MVDD 4ZUXB 3MGQA 4KGCA 5BS7A 1P34B 5B2IB 2CV5A 1ZLAB 3O62C 4Z5TB 2CV5C 4H9SC 1KX3B 5JRGA 4WNNB 3REHB 1Q9CA 2BYMB 4ZBJC 5GSUA 1P3LA 1EQZA 1EQZC 3MGQB 4KGCB 3LZ1B 1KX4C 5B24C 2CV5B 5AV6D 2NZDD 4WU8D 5JRGB 2JSSA 3IP4C 4Z2MH 5B1LA 5GSUB 4J8WD 1P3LB 3AN2D 2HIOA 3VH6T 3EPLA 5DNND 3MNND 1WWSA 3AZGD 3MVDA 5B1LB 3MVDC 3P5JB 5AV8C 3AV2C 2HIOB 4UUZA 4YM6D 2JCHA 1S32D 5CP6C 3MVDB 3X1VD 5BNXA 3W96D 1TAFA 4E45A 4UUZB 3C1BC 3VH5W 5AV6A 2NZDA 4NFTA 5GT0D 4WU8A 2Y2MA 3W97D 3AL0C 3WAAC 4XUJD 5B33C 4WU8C 2NZDC 4J8WA 4J8XC 1B67A 3AN2A 5BNXB 1TAFB 3AN2C 5GT3D 1P3OD
chains in the Genus database with same CATH topology
5DNNA 3MNNA 1P3BD 2Y2NA 5AV6B 3X1UC 1PZRA 2NZDB 4WU8B 3F6TA 4NE5A 3AZKC 3AZGA 2NQBC 4J8WB 3AN2B 2ZY3A 3EPKA 4YM6A 5DNNB 3MNNB 4YM6C 3TU4D 3B6FD 5CPIC 1F1EA 1S32A 1S32C 5CPKD 3AZGB 3X1VA 3W96A 3W96C 1HQ3C 2Y2IA 2BYKA 2Y2LA 3B0CT 3W97A 5GT0A 3W97C 4XUJA 4XUJC 1S32B 4DQYB 3X1VB 3W96B 5GT3A 2Y2GA 5GT3C 1P3OA 5B1MD 1P3OC 3AZLC 1P3BA 5G49A 5F99D 4NE6A 2BYKB 5GT0B 3W97B 2ZY2A 4XUJB 5AV9D 3H0MC 1P3MC 4KUDD 3WA9D 1A7WA 5GT3B 1P3OB 1P3BB 5G49B 2Y2KA 3TU4A 3B6FA 3TU4C 1M1AC 3UT9D 1P3KC 5CPKA 5CPKC 5B2JD 3A6ND 3NQUA 5BT1C 3O62D 4XZQC 3TU4B 3B6FB 3REKC 2XD1A 1T3UA 5CPKB 1EQZD 1B6WA 3MGSC 3KUYC 1KX4D 5B24D 5B1MA 3NQUB 3H0RC 5F99A 3WTPC 1ULYA 3AZED 5AV9A 4H9PA 5AV9C 4X23C 5AVBC 4G92B 4KUDA 3WA9A 3WA9C 5B1MB 5F99B 3W99D 2XD5A 1P3PD 3UT9A 5AV9B 3UT9C 4H9PB 2F8NH 5AV8D 1P3GC 3AV2D 4KUDB 3WA9B 5B2JA 5B2JC 3A6NA 3O62A 3A6NC 4H9SA 5B32D 5CP6D 3UT9B 2L5AA 3REIC 3REJC 3C1BD 5B2JB 1KX4A 5B24A 2AROA 3A6NB 2AROC 3O62B 1P3AD 4YS3D 2HUEC 1BFMA 3WAAD 5B33D 3AZEA 3AZEC 4ZBJB 2Y2OA 2ZY5A 4J8XD 1AOIC 1EQZB 2FJ7D 3UTAD 1KX4B 3B0DC 5B24B 1F66C 3X1UD 3W99A 3W99C 1P3PA 1KX5C 3AZEB 1P3PC 3AZKD 2NQBD 5AV8A 3AV2A 4WJ3C 1WWIA 2RIQA 3NQJA 1N1JA 5AVCD 5CPID 3W99B 5B32A 1P3PB 5B32C 5CP6A 3AZND 5AV8B 3LZ0D 3AV2B 1HQ3D 3C1CC 3C1BA 4AWLC 2BG1A 5C3IC 3NQJB 3AZMD 1P3AA 4YS3A 2G5IC 4J8VC 1N1JB 4YS3C 3AZFC 1P3AC 3WAAA 5B33A 1H3OA 5B32B 5CP6B 4HGAC 4J8XA 3W98C 1W2EA 2Y2JA 4JJND 3C1BB 3AZJC 3RELD 4AWLB 3UTAA 3AZLD 3UTAC 3X1UA 1P3AB 4YS3B 3LELC 4H9QA 5B33B 1H3OB 2DF4C 3AZKA 3WAAB 5BNVA 4M6BA 4Z2MG 2NQBA 1P3MD 4J8XB 4KHAA 2FJ7B 3UTAB 5CPIA 5AVCA 4DRBA 3X1UB 1M1AD 5AVCC 3LJAC 4H9QB 3AZIC 3AZKB 1P3KD 5BNVB 5KDMA 2NQBB 3VH5T 3AZNA 3LZ0A 3AZNC 1HQ3A 3LZ0C 4KHAB 5BT1D 4XZQD 3AZMA 2F8ND 4YM6B 2UWXA 3AZMC 5CPIB 5AVCB 2CWEA 3REKD 4H9NA 2PYOC 3MGSD 5AY8D 5KDMB 3AFAC 3KUYD 3AZNB 3LZ0B 1HQ3B 2RVQD 5E5AC 4JJNA 3RELA 4JJNC 3AZLA 3EG5B 3RELC 3MGPC 1M18C 3WTPD 3AZMB 3X1TD 2ZM5A 4CSRA 3AZHD 4H9NB 5B31C 5AVBD 4X23D 1P3MA 3VH6A 4JJNB 3RELB 3AZLB 1M1AA 4CSRB 1P3KA 1BH8A 3A1IA 1P3GD 1P3MB 5B32G 4NE3A 3FDDA 4XZQA 2F8NA 3MGRA 1M1AB 3REKA 3MGRC 3REID 2G5HC 1P3KB 3REJD 3MGSA 5AY8A 3KUYA 1BH8B 5FUGA 5AY8C 1P3FD 2RVQC 3KWQD 2AROD 2YFVA 4XZQB 5BO0A 3WTPA 3X1TA 2F8NB 3X1TC 4WZSB 3REKB 3AZHA 2YFWA 3AZHC 4X23A 5AVBA 1AOID 3MGSB 5AY8B 3KUYB 5FUGB 2Y2HA 1P3ID 1Z2CB 3LZ1D 1F66D 2YFVB 3WTPB 5BO0B 5B40C 3X1TB 1KX5D 3AZHB 2YFWB 4X23B 5AVBB 4H9RA 1P3GA 4QLCD 2F8NK 4R8PC 5JA4A 5AV5D 3EPHA 3REIA 5B0ZC 3VH5A 3REJA 4H9RB 3V9RA 3UTBC 1P3GB 1P3FA 1U35D 3C1CD 1P3FC 4ZUXC 4J8UD 3B6GD 3KWQA 3KWQC 1TZYD 4J8VD 3AZFD 5JA4B 1P34C 3VH6W 3REIB 1KX3C 1AOIA 3REHC 3REJB 4WU9D 4Z66D 3V9RB 1P3FB 1ID3D 3W98D 1P3IA 2F2AC 5B31G 3AZJD 1P3IC 3MGQC 4KGCC 1HTAA 3LZ1A 5BS7C 2AROB 3LZ1C 3KWQB 1F66A 2HUEB 3LELD 3AV1D 1KX5A 3B0BA 5JRGC 1AOIB 4H9OA 4QLCA 2FJ7A 4QLCC 5GSUC 1P3IB 1P3LC 3B0DB 5CHLB 1F66B 4G91C 5AV5A 3LJAD 5AV5C 1KX5B 3AZID 5DNMD 3A1KA 2F8NG 3KSYA 4H9OB 1U35A 3C1CA 4QLCB 1U35C 2JE5A 5B1LC 4J8UA 3B6GA 4J8UC 2HIOC 3B6GC 1TZYA 4J8VA 3AZFA 4G91B 1TZYC 4LD9D 3AYWD 5AV5B 1KU5A 1M19D 2PYOD 3AFAD 1ID3A 4Z66A 4WU9A 3W98A 1ID3C 4Z66C 4UPKA 4WU9C 3C1CB 1U35B 5E5AD 3AZJA 4J8UB 3MGPD 5C3IB 3B6GB 2LY8A 1M18D 1TZYB 4J8VB 3LELA 3AZFB 3AV1A 3AV1C 3R45A 5B31D 4HGAB 1ID3B 4Z66B 4WU9B 3W98B 2FJ7C 3AZJB 5B0YD 3LJAA 3LELB 3AV1B 3AZIA 5DNMA 3R45B 5DNMC 5AV6C 3B0CW 4J8WC 2VQRA 4LD9A 3AYWA 1M19A 3LJAB 3MGRD 3AYWC 1M19C 5DNNC 3MNNC 5DNMB 3AZIB 4LD9C 2PYOA 3AFAA 2FFFB 5E5AA 3AZGC 3MGPA 1M18A 3X1SD 4LD9B 3AYWB 1M19B 2J8PA 5B31A 2PYOB 3WTPE 3AFAB 3H0LC 5E5AB 3X1VC 3MGPB 1M18B 5B40D 5B0YA 3WKJD 5B0YC 5B31B 5GT0C 1BH9A 4EO5C 4R8PD 5B0YB 1P3BC 5B0ZD 2DQNC 5GXQD 5CPJD 1BH9B 3UTBD 4EO5B 3KXBD 4ZUXD 2Y2PA 1P34D 4CAYA 5B2ID 3X1SA 1ZLAD 4Z5TD 3X1SC 3MGRB 1KX3D 3B6FC 3REHD 2IO5C 3MGQD 1JFIA 4KGCD 5B40A 3WKJA 4CAYB 3WKJC 3X1SB 2CV5D 3KFUG 5JRGD 2W8SA 5GSUD 1P3LD 4G92C 2IO5B 1JFIB 4R8PA 5B40B 3WKJB 5B1MC 5F99C 1R4VA 5B0ZA 2ZY4A 5GXQA 3UTBA 5CPJA 5GXQC 5CPJC 3KXBA 5B1LD 4ZUXA 3KXBC 4DRAA 4KUDC 2HIOD 4R8PB 4WV4B 1P34A 5B2IA 1ZLAA 4Z5TA 5B2IC 1ZLAC 4Z5TC 1KX3A 5B0ZB 4WNNA 3EPJA 3REHA 4E44A 5GXQB 3UTBB 5CPJB 2BYMA 2Y2QA 3KXBB 3MVDD 4ZUXB 3MGQA 4KGCA 5BS7A 1P34B 5B2IB 2CV5A 1ZLAB 3O62C 4Z5TB 2CV5C 4H9SC 1KX3B 5JRGA 4WNNB 3REHB 1Q9CA 2BYMB 4ZBJC 5GSUA 1P3LA 1EQZA 1EQZC 3MGQB 4KGCB 3LZ1B 1KX4C 5B24C 2CV5B 5AV6D 2NZDD 4WU8D 5JRGB 2JSSA 3IP4C 4Z2MH 5B1LA 5GSUB 4J8WD 1P3LB 3AN2D 2HIOA 3VH6T 3EPLA 5DNND 3MNND 1WWSA 3AZGD 3MVDA 5B1LB 3MVDC 3P5JB 5AV8C 3AV2C 2HIOB 4UUZA 4YM6D 2JCHA 1S32D 5CP6C 3MVDB 3X1VD 5BNXA 3W96D 1TAFA 4E45A 4UUZB 3C1BC 3VH5W 5AV6A 2NZDA 4NFTA 5GT0D 4WU8A 2Y2MA 3W97D 3AL0C 3WAAC 4XUJD 5B33C 4WU8C 2NZDC 4J8WA 4J8XC 1B67A 3AN2A 5BNXB 1TAFB 3AN2C 5GT3D 1P3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNN A;  3MNN A;  1P3B D;  5AV6 B;  3X1U C;  2NZD B;  4WU8 B;  4NE5 A;  3AZK C;  3AZG A;  2NQB C;  4J8W B;  3AN2 B;  4YM6 A;  5DNN B;  3MNN B;  4YM6 C;  3TU4 D;  3B6F D;  5CPI C;  1F1E A;  1S32 A;  1S32 C;  5CPK D;  3AZG B;  3X1V A;  3W96 A;  3W96 C;  1HQ3 C;  2BYK A;  3B0C T;  3W97 A;  5GT0 A;  3W97 C;  4XUJ A;  4XUJ C;  1S32 B;  3X1V B;  3W96 B;  5GT3 A;  5GT3 C;  1P3O A;  5B1M D;  1P3O C;  3AZL C;  1P3B A;  5G49 A;  5F99 D;  4NE6 A;  2BYK B;  5GT0 B;  3W97 B;  4XUJ B;  5AV9 D;  1P3M C;  4KUD D;  3WA9 D;  1A7W A;  5GT3 B;  1P3O B;  1P3B B;  5G49 B;  3TU4 A;  3B6F A;  3TU4 C;  1M1A C;  3UT9 D;  1P3K C;  5CPK A;  5CPK C;  5B2J D;  3A6N D;  3NQU A;  5BT1 C;  3O62 D;  4XZQ C;  3TU4 B;  3B6F B;  3REK C;  5CPK B;  1EQZ D;  1B6W A;  3MGS C;  3KUY C;  1KX4 D;  5B24 D;  5B1M A;  3NQU B;  5F99 A;  3WTP C;  1ULY A;  3AZE D;  5AV9 A;  4H9P A;  5AV9 C;  4X23 C;  5AVB C;  4G92 B;  4KUD A;  3WA9 A;  3WA9 C;  5B1M B;  5F99 B;  3W99 D;  1P3P D;  3UT9 A;  5AV9 B;  3UT9 C;  4H9P B;  2F8N H;  5AV8 D;  1P3G C;  3AV2 D;  4KUD B;  3WA9 B;  5B2J A;  5B2J C;  3A6N A;  3O62 A;  3A6N C;  4H9S A;  5B32 D;  5CP6 D;  3UT9 B;  2L5A A;  3REI C;  3REJ C;  3C1B D;  5B2J B;  1KX4 A;  5B24 A;  2ARO A;  3A6N B;  2ARO C;  3O62 B;  1P3A D;  4YS3 D;  2HUE C;  1BFM A;  3WAA D;  5B33 D;  3AZE A;  3AZE C;  4ZBJ B;  4J8X D;  1AOI C;  1EQZ B;  2FJ7 D;  3UTA D;  1KX4 B;  3B0D C;  5B24 B;  1F66 C;  3X1U D;  3W99 A;  3W99 C;  1P3P A;  1KX5 C;  3AZE B;  1P3P C;  3AZK D;  2NQB D;  5AV8 A;  3AV2 A;  1WWI A;  3NQJ A;  1N1J A;  5AVC D;  5CPI D;  3W99 B;  5B32 A;  1P3P B;  5B32 C;  5CP6 A;  3AZN D;  5AV8 B;  3LZ0 D;  3AV2 B;  1HQ3 D;  3C1C C;  3C1B A;  4AWL C;  5C3I C;  3NQJ B;  3AZM D;  1P3A A;  4YS3 A;  4J8V C;  1P3A C;  1N1J B;  4YS3 C;  3AZF C;  3WAA A;  5B33 A;  1H3O A;  5B32 B;  5CP6 B;  4HGA C;  4J8X A;  3W98 C;  4JJN D;  3C1B B;  3AZJ C;  3REL D;  4AWL B;  3UTA A;  3AZL D;  3UTA C;  3X1U A;  1P3A B;  4YS3 B;  3LEL C;  4H9Q A;  5B33 B;  1H3O B;  3AZK A;  3WAA B;  5BNV A;  4M6B A;  4Z2M G;  2NQB A;  1P3M D;  4J8X B;  4KHA A;  2FJ7 B;  3UTA B;  5CPI A;  5AVC A;  4DRB A;  3X1U B;  1M1A D;  5AVC C;  3LJA C;  4H9Q B;  3AZI C;  3AZK B;  1P3K D;  5BNV B;  5KDM A;  2NQB B;  3VH5 T;  3AZN A;  3LZ0 A;  3AZN C;  1HQ3 A;  3LZ0 C;  4KHA B;  5BT1 D;  4XZQ D;  3AZM A;  2F8N D;  4YM6 B;  3AZM C;  5CPI B;  5AVC B;  2CWE A;  3REK D;  4H9N A;  2PYO C;  3MGS D;  5AY8 D;  5KDM B;  3AFA C;  3KUY D;  3AZN B;  3LZ0 B;  1HQ3 B;  2RVQ D;  5E5A C;  4JJN A;  3REL A;  4JJN C;  3AZL A;  3REL C;  3MGP C;  1M18 C;  3WTP D;  3AZM B;  3X1T D;  4CSR A;  3AZH D;  4H9N B;  5B31 C;  5AVB D;  4X23 D;  1P3M A;  3VH6 A;  4JJN B;  3REL B;  3AZL B;  1M1A A;  4CSR B;  1P3K A;  1BH8 A;  1P3G D;  1P3M B;  5B32 G;  4NE3 A;  4XZQ A;  2F8N A;  3MGR A;  1M1A B;  3REK A;  3MGR C;  3REI D;  1P3K B;  3REJ D;  3MGS A;  5AY8 A;  3KUY A;  1BH8 B;  5FUG A;  5AY8 C;  1P3F D;  2RVQ C;  3KWQ D;  2ARO D;  2YFV A;  4XZQ B;  5BO0 A;  3WTP A;  3X1T A;  2F8N B;  3X1T C;  4WZS B;  3REK B;  3AZH A;  2YFW A;  3AZH C;  4X23 A;  5AVB A;  1AOI D;  3MGS B;  5AY8 B;  3KUY B;  5FUG B;  1P3I D;  3LZ1 D;  1F66 D;  2YFV B;  3WTP B;  5BO0 B;  5B40 C;  3X1T B;  1KX5 D;  3AZH B;  2YFW B;  4X23 B;  5AVB B;  4H9R A;  1P3G A;  4QLC D;  2F8N K;  4R8P C;  5JA4 A;  5AV5 D;  3REI A;  5B0Z C;  3VH5 A;  3REJ A;  4H9R B;  3V9R A;  3UTB C;  1P3G B;  1P3F A;  1U35 D;  3C1C D;  1P3F C;  4ZUX C;  4J8U D;  3B6G D;  3KWQ A;  3KWQ C;  1TZY D;  4J8V D;  3AZF D;  5JA4 B;  1P34 C;  3VH6 W;  3REI B;  1KX3 C;  1AOI A;  3REH C;  3REJ B;  4WU9 D;  4Z66 D;  3V9R B;  1P3F B;  1ID3 D;  3W98 D;  1P3I A;  5B31 G;  3AZJ D;  1P3I C;  3MGQ C;  4KGC C;  1HTA A;  3LZ1 A;  5BS7 C;  2ARO B;  3LZ1 C;  3KWQ B;  1F66 A;  2HUE B;  3LEL D;  3AV1 D;  1KX5 A;  3B0B A;  5JRG C;  1AOI B;  4H9O A;  4QLC A;  2FJ7 A;  4QLC C;  5GSU C;  1P3I B;  1P3L C;  3B0D B;  5CHL B;  1F66 B;  4G91 C;  5AV5 A;  3LJA D;  5AV5 C;  1KX5 B;  3AZI D;  5DNM D;  2F8N G;  3KSY A;  4H9O B;  1U35 A;  3C1C A;  4QLC B;  1U35 C;  5B1L C;  4J8U A;  3B6G A;  4J8U C;  2HIO C;  3B6G C;  1TZY A;  4J8V A;  3AZF A;  4G91 B;  1TZY C;  4LD9 D;  3AYW D;  5AV5 B;  1KU5 A;  1M19 D;  2PYO D;  3AFA D;  1ID3 A;  4Z66 A;  4WU9 A;  3W98 A;  1ID3 C;  4Z66 C;  4WU9 C;  1U35 B;  3C1C B;  5E5A D;  3AZJ A;  4J8U B;  3MGP D;  5C3I B;  3B6G B;  2LY8 A;  1M18 D;  1TZY B;  4J8V B;  3LEL A;  3AZF B;  3AV1 A;  3AV1 C;  3R45 A;  5B31 D;  4HGA B;  1ID3 B;  4Z66 B;  4WU9 B;  3W98 B;  2FJ7 C;  3AZJ B;  5B0Y D;  3LJA A;  3LEL B;  3AV1 B;  3AZI A;  5DNM A;  3R45 B;  5DNM C;  5AV6 C;  3B0C W;  4J8W C;  4LD9 A;  3AYW A;  1M19 A;  3LJA B;  3MGR D;  3AYW C;  1M19 C;  5DNN C;  3MNN C;  5DNM B;  3AZI B;  4LD9 C;  2PYO A;  3AFA A;  3AZG C;  5E5A A;  3MGP A;  1M18 A;  3X1S D;  4LD9 B;  3AYW B;  1M19 B;  5B31 A;  2PYO B;  3WTP E;  3AFA B;  5E5A B;  3X1V C;  3MGP B;  1M18 B;  5B40 D;  5B0Y A;  3WKJ D;  5B0Y C;  5B31 B;  5GT0 C;  1BH9 A;  4EO5 C;  4R8P D;  5B0Y B;  1P3B C;  5B0Z D;  5GXQ D;  5CPJ D;  1BH9 B;  3UTB D;  4EO5 B;  3KXB D;  4ZUX D;  1P34 D;  4CAY A;  5B2I D;  3X1S A;  1ZLA D;  4Z5T D;  3X1S C;  3MGR B;  1KX3 D;  3B6F C;  3REH D;  2IO5 C;  3MGQ D;  1JFI A;  4KGC D;  5B40 A;  3WKJ A;  4CAY B;  3WKJ C;  3X1S B;  2CV5 D;  5JRG D;  5GSU D;  1P3L D;  4G92 C;  2IO5 B;  1JFI B;  4R8P A;  5B40 B;  3WKJ B;  5B1M C;  5F99 C;  1R4V A;  5B0Z A;  5GXQ A;  3UTB A;  5CPJ A;  5GXQ C;  5CPJ C;  3KXB A;  5B1L D;  4ZUX A;  3KXB C;  4DRA A;  4KUD C;  2HIO D;  4R8P B;  4WV4 B;  1P34 A;  5B2I A;  1ZLA A;  4Z5T A;  5B2I C;  1ZLA C;  4Z5T C;  1KX3 A;  5B0Z B;  4WNN A;  3REH A;  4E44 A;  5GXQ B;  3UTB B;  5CPJ B;  2BYM A;  3KXB B;  3MVD D;  4ZUX B;  3MGQ A;  4KGC A;  5BS7 A;  1P34 B;  5B2I B;  2CV5 A;  1ZLA B;  3O62 C;  4Z5T B;  2CV5 C;  4H9S C;  1KX3 B;  5JRG A;  4WNN B;  3REH B;  1Q9C A;  2BYM B;  4ZBJ C;  5GSU A;  1P3L A;  1EQZ A;  1EQZ C;  3MGQ B;  4KGC B;  3LZ1 B;  1KX4 C;  5B24 C;  2CV5 B;  5AV6 D;  2NZD D;  4WU8 D;  5JRG B;  2JSS A;  4Z2M H;  5B1L A;  5GSU B;  4J8W D;  1P3L B;  3AN2 D;  2HIO A;  3VH6 T;  5DNN D;  3MNN D;  1WWS A;  3AZG D;  3MVD A;  5B1L B;  3MVD C;  5AV8 C;  3AV2 C;  2HIO B;  4UUZ A;  4YM6 D;  1S32 D;  5CP6 C;  3MVD B;  3X1V D;  5BNX A;  3W96 D;  1TAF A;  4E45 A;  4UUZ B;  3C1B C;  3VH5 W;  5AV6 A;  2NZD A;  4NFT A;  5GT0 D;  4WU8 A;  3W97 D;  2NZD C;  3WAA C;  4XUJ D;  5B33 C;  4WU8 C;  4J8W A;  4J8X C;  1B67 A;  3AN2 A;  5BNX B;  1TAF B;  3AN2 C;  5GT3 D;  1P3O D; 
#chains in the Genus database with same CATH topology
 5DNN A;  3MNN A;  1P3B D;  2Y2N A;  5AV6 B;  3X1U C;  1PZR A;  2NZD B;  4WU8 B;  3F6T A;  4NE5 A;  3AZK C;  3AZG A;  2NQB C;  4J8W B;  3AN2 B;  2ZY3 A;  3EPK A;  4YM6 A;  5DNN B;  3MNN B;  4YM6 C;  3TU4 D;  3B6F D;  5CPI C;  1F1E A;  1S32 A;  1S32 C;  5CPK D;  3AZG B;  3X1V A;  3W96 A;  3W96 C;  1HQ3 C;  2Y2I A;  2BYK A;  2Y2L A;  3B0C T;  3W97 A;  5GT0 A;  3W97 C;  4XUJ A;  4XUJ C;  1S32 B;  4DQY B;  3X1V B;  3W96 B;  5GT3 A;  2Y2G A;  5GT3 C;  1P3O A;  5B1M D;  1P3O C;  3AZL C;  1P3B A;  5G49 A;  5F99 D;  4NE6 A;  2BYK B;  5GT0 B;  3W97 B;  2ZY2 A;  4XUJ B;  5AV9 D;  3H0M C;  1P3M C;  4KUD D;  3WA9 D;  1A7W A;  5GT3 B;  1P3O B;  1P3B B;  5G49 B;  2Y2K A;  3TU4 A;  3B6F A;  3TU4 C;  1M1A C;  3UT9 D;  1P3K C;  5CPK A;  5CPK C;  5B2J D;  3A6N D;  3NQU A;  5BT1 C;  3O62 D;  4XZQ C;  3TU4 B;  3B6F B;  3REK C;  2XD1 A;  1T3U A;  5CPK B;  1EQZ D;  1B6W A;  3MGS C;  3KUY C;  1KX4 D;  5B24 D;  5B1M A;  3NQU B;  3H0R C;  5F99 A;  3WTP C;  1ULY A;  3AZE D;  5AV9 A;  4H9P A;  5AV9 C;  4X23 C;  5AVB C;  4G92 B;  4KUD A;  3WA9 A;  3WA9 C;  5B1M B;  5F99 B;  3W99 D;  2XD5 A;  1P3P D;  3UT9 A;  5AV9 B;  3UT9 C;  4H9P B;  2F8N H;  5AV8 D;  1P3G C;  3AV2 D;  4KUD B;  3WA9 B;  5B2J A;  5B2J C;  3A6N A;  3O62 A;  3A6N C;  4H9S A;  5B32 D;  5CP6 D;  3UT9 B;  2L5A A;  3REI C;  3REJ C;  3C1B D;  5B2J B;  1KX4 A;  5B24 A;  2ARO A;  3A6N B;  2ARO C;  3O62 B;  1P3A D;  4YS3 D;  2HUE C;  1BFM A;  3WAA D;  5B33 D;  3AZE A;  3AZE C;  4ZBJ B;  2Y2O A;  2ZY5 A;  4J8X D;  1AOI C;  1EQZ B;  2FJ7 D;  3UTA D;  1KX4 B;  3B0D C;  5B24 B;  1F66 C;  3X1U D;  3W99 A;  3W99 C;  1P3P A;  1KX5 C;  3AZE B;  1P3P C;  3AZK D;  2NQB D;  5AV8 A;  3AV2 A;  4WJ3 C;  1WWI A;  2RIQ A;  3NQJ A;  1N1J A;  5AVC D;  5CPI D;  3W99 B;  5B32 A;  1P3P B;  5B32 C;  5CP6 A;  3AZN D;  5AV8 B;  3LZ0 D;  3AV2 B;  1HQ3 D;  3C1C C;  3C1B A;  4AWL C;  2BG1 A;  5C3I C;  3NQJ B;  3AZM D;  1P3A A;  4YS3 A;  2G5I C;  4J8V C;  1N1J B;  4YS3 C;  3AZF C;  1P3A C;  3WAA A;  5B33 A;  1H3O A;  5B32 B;  5CP6 B;  4HGA C;  4J8X A;  3W98 C;  1W2E A;  2Y2J A;  4JJN D;  3C1B B;  3AZJ C;  3REL D;  4AWL B;  3UTA A;  3AZL D;  3UTA C;  3X1U A;  1P3A B;  4YS3 B;  3LEL C;  4H9Q A;  5B33 B;  1H3O B;  2DF4 C;  3AZK A;  3WAA B;  5BNV A;  4M6B A;  4Z2M G;  2NQB A;  1P3M D;  4J8X B;  4KHA A;  2FJ7 B;  3UTA B;  5CPI A;  5AVC A;  4DRB A;  3X1U B;  1M1A D;  5AVC C;  3LJA C;  4H9Q B;  3AZI C;  3AZK B;  1P3K D;  5BNV B;  5KDM A;  2NQB B;  3VH5 T;  3AZN A;  3LZ0 A;  3AZN C;  1HQ3 A;  3LZ0 C;  4KHA B;  5BT1 D;  4XZQ D;  3AZM A;  2F8N D;  4YM6 B;  2UWX A;  3AZM C;  5CPI B;  5AVC B;  2CWE A;  3REK D;  4H9N A;  2PYO C;  3MGS D;  5AY8 D;  5KDM B;  3AFA C;  3KUY D;  3AZN B;  3LZ0 B;  1HQ3 B;  2RVQ D;  5E5A C;  4JJN A;  3REL A;  4JJN C;  3AZL A;  3EG5 B;  3REL C;  3MGP C;  1M18 C;  3WTP D;  3AZM B;  3X1T D;  2ZM5 A;  4CSR A;  3AZH D;  4H9N B;  5B31 C;  5AVB D;  4X23 D;  1P3M A;  3VH6 A;  4JJN B;  3REL B;  3AZL B;  1M1A A;  4CSR B;  1P3K A;  1BH8 A;  3A1I A;  1P3G D;  1P3M B;  5B32 G;  4NE3 A;  3FDD A;  4XZQ A;  2F8N A;  3MGR A;  1M1A B;  3REK A;  3MGR C;  3REI D;  2G5H C;  1P3K B;  3REJ D;  3MGS A;  5AY8 A;  3KUY A;  1BH8 B;  5FUG A;  5AY8 C;  1P3F D;  2RVQ C;  3KWQ D;  2ARO D;  2YFV A;  4XZQ B;  5BO0 A;  3WTP A;  3X1T A;  2F8N B;  3X1T C;  4WZS B;  3REK B;  3AZH A;  2YFW A;  3AZH C;  4X23 A;  5AVB A;  1AOI D;  3MGS B;  5AY8 B;  3KUY B;  5FUG B;  2Y2H A;  1P3I D;  1Z2C B;  3LZ1 D;  1F66 D;  2YFV B;  3WTP B;  5BO0 B;  5B40 C;  3X1T B;  1KX5 D;  3AZH B;  2YFW B;  4X23 B;  5AVB B;  4H9R A;  1P3G A;  4QLC D;  2F8N K;  4R8P C;  5JA4 A;  5AV5 D;  3EPH A;  3REI A;  5B0Z C;  3VH5 A;  3REJ A;  4H9R B;  3V9R A;  3UTB C;  1P3G B;  1P3F A;  1U35 D;  3C1C D;  1P3F C;  4ZUX C;  4J8U D;  3B6G D;  3KWQ A;  3KWQ C;  1TZY D;  4J8V D;  3AZF D;  5JA4 B;  1P34 C;  3VH6 W;  3REI B;  1KX3 C;  1AOI A;  3REH C;  3REJ B;  4WU9 D;  4Z66 D;  3V9R B;  1P3F B;  1ID3 D;  3W98 D;  1P3I A;  2F2A C;  5B31 G;  3AZJ D;  1P3I C;  3MGQ C;  4KGC C;  1HTA A;  3LZ1 A;  5BS7 C;  2ARO B;  3LZ1 C;  3KWQ B;  1F66 A;  2HUE B;  3LEL D;  3AV1 D;  1KX5 A;  3B0B A;  5JRG C;  1AOI B;  4H9O A;  4QLC A;  2FJ7 A;  4QLC C;  5GSU C;  1P3I B;  1P3L C;  3B0D B;  5CHL B;  1F66 B;  4G91 C;  5AV5 A;  3LJA D;  5AV5 C;  1KX5 B;  3AZI D;  5DNM D;  3A1K A;  2F8N G;  3KSY A;  4H9O B;  1U35 A;  3C1C A;  4QLC B;  1U35 C;  2JE5 A;  5B1L C;  4J8U A;  3B6G A;  4J8U C;  2HIO C;  3B6G C;  1TZY A;  4J8V A;  3AZF A;  4G91 B;  1TZY C;  4LD9 D;  3AYW D;  5AV5 B;  1KU5 A;  1M19 D;  2PYO D;  3AFA D;  1ID3 A;  4Z66 A;  4WU9 A;  3W98 A;  1ID3 C;  4Z66 C;  4UPK A;  4WU9 C;  3C1C B;  1U35 B;  5E5A D;  3AZJ A;  4J8U B;  3MGP D;  5C3I B;  3B6G B;  2LY8 A;  1M18 D;  1TZY B;  4J8V B;  3LEL A;  3AZF B;  3AV1 A;  3AV1 C;  3R45 A;  5B31 D;  4HGA B;  1ID3 B;  4Z66 B;  4WU9 B;  3W98 B;  2FJ7 C;  3AZJ B;  5B0Y D;  3LJA A;  3LEL B;  3AV1 B;  3AZI A;  5DNM A;  3R45 B;  5DNM C;  5AV6 C;  3B0C W;  4J8W C;  2VQR A;  4LD9 A;  3AYW A;  1M19 A;  3LJA B;  3MGR D;  3AYW C;  1M19 C;  5DNN C;  3MNN C;  5DNM B;  3AZI B;  4LD9 C;  2PYO A;  3AFA A;  2FFF B;  5E5A A;  3AZG C;  3MGP A;  1M18 A;  3X1S D;  4LD9 B;  3AYW B;  1M19 B;  2J8P A;  5B31 A;  2PYO B;  3WTP E;  3AFA B;  3H0L C;  5E5A B;  3X1V C;  3MGP B;  1M18 B;  5B40 D;  5B0Y A;  3WKJ D;  5B0Y C;  5B31 B;  5GT0 C;  1BH9 A;  4EO5 C;  4R8P D;  5B0Y B;  1P3B C;  5B0Z D;  2DQN C;  5GXQ D;  5CPJ D;  1BH9 B;  3UTB D;  4EO5 B;  3KXB D;  4ZUX D;  2Y2P A;  1P34 D;  4CAY A;  5B2I D;  3X1S A;  1ZLA D;  4Z5T D;  3X1S C;  3MGR B;  1KX3 D;  3B6F C;  3REH D;  2IO5 C;  3MGQ D;  1JFI A;  4KGC D;  5B40 A;  3WKJ A;  4CAY B;  3WKJ C;  3X1S B;  2CV5 D;  3KFU G;  5JRG D;  2W8S A;  5GSU D;  1P3L D;  4G92 C;  2IO5 B;  1JFI B;  4R8P A;  5B40 B;  3WKJ B;  5B1M C;  5F99 C;  1R4V A;  5B0Z A;  2ZY4 A;  5GXQ A;  3UTB A;  5CPJ A;  5GXQ C;  5CPJ C;  3KXB A;  5B1L D;  4ZUX A;  3KXB C;  4DRA A;  4KUD C;  2HIO D;  4R8P B;  4WV4 B;  1P34 A;  5B2I A;  1ZLA A;  4Z5T A;  5B2I C;  1ZLA C;  4Z5T C;  1KX3 A;  5B0Z B;  4WNN A;  3EPJ A;  3REH A;  4E44 A;  5GXQ B;  3UTB B;  5CPJ B;  2BYM A;  2Y2Q A;  3KXB B;  3MVD D;  4ZUX B;  3MGQ A;  4KGC A;  5BS7 A;  1P34 B;  5B2I B;  2CV5 A;  1ZLA B;  3O62 C;  4Z5T B;  2CV5 C;  4H9S C;  1KX3 B;  5JRG A;  4WNN B;  3REH B;  1Q9C A;  2BYM B;  4ZBJ C;  5GSU A;  1P3L A;  1EQZ A;  1EQZ C;  3MGQ B;  4KGC B;  3LZ1 B;  1KX4 C;  5B24 C;  2CV5 B;  5AV6 D;  2NZD D;  4WU8 D;  5JRG B;  2JSS A;  3IP4 C;  4Z2M H;  5B1L A;  5GSU B;  4J8W D;  1P3L B;  3AN2 D;  2HIO A;  3VH6 T;  3EPL A;  5DNN D;  3MNN D;  1WWS A;  3AZG D;  3MVD A;  5B1L B;  3MVD C;  3P5J B;  5AV8 C;  3AV2 C;  2HIO B;  4UUZ A;  4YM6 D;  2JCH A;  1S32 D;  5CP6 C;  3MVD B;  3X1V D;  5BNX A;  3W96 D;  1TAF A;  4E45 A;  4UUZ B;  3C1B C;  3VH5 W;  5AV6 A;  2NZD A;  4NFT A;  5GT0 D;  4WU8 A;  2Y2M A;  3W97 D;  3AL0 C;  3WAA C;  4XUJ D;  5B33 C;  4WU8 C;  2NZD C;  4J8W A;  4J8X C;  1B67 A;  3AN2 A;  5BNX B;  1TAF B;  3AN2 C;  5GT3 D;  1P3O D; 
#chains in the Genus database with same CATH homology
 5DNN A;  3MNN A;  1P3B D;  2Y2N A;  5AV6 B;  3X1U C;  1PZR A;  2NZD B;  4WU8 B;  3F6T A;  4NE5 A;  3AZK C;  3AZG A;  2NQB C;  4J8W B;  3AN2 B;  2ZY3 A;  3EPK A;  4YM6 A;  5DNN B;  3MNN B;  4YM6 C;  3TU4 D;  3B6F D;  5CPI C;  1F1E A;  1S32 A;  1S32 C;  5CPK D;  3AZG B;  3X1V A;  3W96 A;  3W96 C;  1HQ3 C;  2Y2I A;  2BYK A;  2Y2L A;  3B0C T;  3W97 A;  5GT0 A;  3W97 C;  4XUJ A;  4XUJ C;  1S32 B;  4DQY B;  3X1V B;  3W96 B;  5GT3 A;  2Y2G A;  5GT3 C;  1P3O A;  5B1M D;  1P3O C;  3AZL C;  1P3B A;  5G49 A;  5F99 D;  4NE6 A;  2BYK B;  5GT0 B;  3W97 B;  2ZY2 A;  4XUJ B;  5AV9 D;  3H0M C;  1P3M C;  4KUD D;  3WA9 D;  1A7W A;  5GT3 B;  1P3O B;  1P3B B;  5G49 B;  2Y2K A;  3TU4 A;  3B6F A;  3TU4 C;  1M1A C;  3UT9 D;  1P3K C;  5CPK A;  5CPK C;  5B2J D;  3A6N D;  3NQU A;  5BT1 C;  3O62 D;  4XZQ C;  3TU4 B;  3B6F B;  3REK C;  2XD1 A;  1T3U A;  5CPK B;  1EQZ D;  1B6W A;  3MGS C;  3KUY C;  1KX4 D;  5B24 D;  5B1M A;  3NQU B;  3H0R C;  5F99 A;  3WTP C;  1ULY A;  3AZE D;  5AV9 A;  4H9P A;  5AV9 C;  4X23 C;  5AVB C;  4G92 B;  4KUD A;  3WA9 A;  3WA9 C;  5B1M B;  5F99 B;  3W99 D;  2XD5 A;  1P3P D;  3UT9 A;  5AV9 B;  3UT9 C;  4H9P B;  2F8N H;  5AV8 D;  1P3G C;  3AV2 D;  4KUD B;  3WA9 B;  5B2J A;  5B2J C;  3A6N A;  3O62 A;  3A6N C;  4H9S A;  5B32 D;  5CP6 D;  3UT9 B;  2L5A A;  3REI C;  3REJ C;  3C1B D;  5B2J B;  1KX4 A;  5B24 A;  2ARO A;  3A6N B;  2ARO C;  3O62 B;  1P3A D;  4YS3 D;  2HUE C;  1BFM A;  3WAA D;  5B33 D;  3AZE A;  3AZE C;  4ZBJ B;  2Y2O A;  2ZY5 A;  4J8X D;  1AOI C;  1EQZ B;  2FJ7 D;  3UTA D;  1KX4 B;  3B0D C;  5B24 B;  1F66 C;  3X1U D;  3W99 A;  3W99 C;  1P3P A;  1KX5 C;  3AZE B;  1P3P C;  3AZK D;  2NQB D;  5AV8 A;  3AV2 A;  4WJ3 C;  1WWI A;  2RIQ A;  3NQJ A;  1N1J A;  5AVC D;  5CPI D;  3W99 B;  5B32 A;  1P3P B;  5B32 C;  5CP6 A;  3AZN D;  5AV8 B;  3LZ0 D;  3AV2 B;  1HQ3 D;  3C1C C;  3C1B A;  4AWL C;  2BG1 A;  5C3I C;  3NQJ B;  3AZM D;  1P3A A;  4YS3 A;  2G5I C;  4J8V C;  1N1J B;  4YS3 C;  3AZF C;  1P3A C;  3WAA A;  5B33 A;  1H3O A;  5B32 B;  5CP6 B;  4HGA C;  4J8X A;  3W98 C;  1W2E A;  2Y2J A;  4JJN D;  3C1B B;  3AZJ C;  3REL D;  4AWL B;  3UTA A;  3AZL D;  3UTA C;  3X1U A;  1P3A B;  4YS3 B;  3LEL C;  4H9Q A;  5B33 B;  1H3O B;  2DF4 C;  3AZK A;  3WAA B;  5BNV A;  4M6B A;  4Z2M G;  2NQB A;  1P3M D;  4J8X B;  4KHA A;  2FJ7 B;  3UTA B;  5CPI A;  5AVC A;  4DRB A;  3X1U B;  1M1A D;  5AVC C;  3LJA C;  4H9Q B;  3AZI C;  3AZK B;  1P3K D;  5BNV B;  5KDM A;  2NQB B;  3VH5 T;  3AZN A;  3LZ0 A;  3AZN C;  1HQ3 A;  3LZ0 C;  4KHA B;  5BT1 D;  4XZQ D;  3AZM A;  2F8N D;  4YM6 B;  2UWX A;  3AZM C;  5CPI B;  5AVC B;  2CWE A;  3REK D;  4H9N A;  2PYO C;  3MGS D;  5AY8 D;  5KDM B;  3AFA C;  3KUY D;  3AZN B;  3LZ0 B;  1HQ3 B;  2RVQ D;  5E5A C;  4JJN A;  3REL A;  4JJN C;  3AZL A;  3EG5 B;  3REL C;  3MGP C;  1M18 C;  3WTP D;  3AZM B;  3X1T D;  2ZM5 A;  4CSR A;  3AZH D;  4H9N B;  5B31 C;  5AVB D;  4X23 D;  1P3M A;  3VH6 A;  4JJN B;  3REL B;  3AZL B;  1M1A A;  4CSR B;  1P3K A;  1BH8 A;  3A1I A;  1P3G D;  1P3M B;  5B32 G;  4NE3 A;  3FDD A;  4XZQ A;  2F8N A;  3MGR A;  1M1A B;  3REK A;  3MGR C;  3REI D;  2G5H C;  1P3K B;  3REJ D;  3MGS A;  5AY8 A;  3KUY A;  1BH8 B;  5FUG A;  5AY8 C;  1P3F D;  2RVQ C;  3KWQ D;  2ARO D;  2YFV A;  4XZQ B;  5BO0 A;  3WTP A;  3X1T A;  2F8N B;  3X1T C;  4WZS B;  3REK B;  3AZH A;  2YFW A;  3AZH C;  4X23 A;  5AVB A;  1AOI D;  3MGS B;  5AY8 B;  3KUY B;  5FUG B;  2Y2H A;  1P3I D;  1Z2C B;  3LZ1 D;  1F66 D;  2YFV B;  3WTP B;  5BO0 B;  5B40 C;  3X1T B;  1KX5 D;  3AZH B;  2YFW B;  4X23 B;  5AVB B;  4H9R A;  1P3G A;  4QLC D;  2F8N K;  4R8P C;  5JA4 A;  5AV5 D;  3EPH A;  3REI A;  5B0Z C;  3VH5 A;  3REJ A;  4H9R B;  3V9R A;  3UTB C;  1P3G B;  1P3F A;  1U35 D;  3C1C D;  1P3F C;  4ZUX C;  4J8U D;  3B6G D;  3KWQ A;  3KWQ C;  1TZY D;  4J8V D;  3AZF D;  5JA4 B;  1P34 C;  3VH6 W;  3REI B;  1KX3 C;  1AOI A;  3REH C;  3REJ B;  4WU9 D;  4Z66 D;  3V9R B;  1P3F B;  1ID3 D;  3W98 D;  1P3I A;  2F2A C;  5B31 G;  3AZJ D;  1P3I C;  3MGQ C;  4KGC C;  1HTA A;  3LZ1 A;  5BS7 C;  2ARO B;  3LZ1 C;  3KWQ B;  1F66 A;  2HUE B;  3LEL D;  3AV1 D;  1KX5 A;  3B0B A;  5JRG C;  1AOI B;  4H9O A;  4QLC A;  2FJ7 A;  4QLC C;  5GSU C;  1P3I B;  1P3L C;  3B0D B;  5CHL B;  1F66 B;  4G91 C;  5AV5 A;  3LJA D;  5AV5 C;  1KX5 B;  3AZI D;  5DNM D;  3A1K A;  2F8N G;  3KSY A;  4H9O B;  1U35 A;  3C1C A;  4QLC B;  1U35 C;  2JE5 A;  5B1L C;  4J8U A;  3B6G A;  4J8U C;  2HIO C;  3B6G C;  1TZY A;  4J8V A;  3AZF A;  4G91 B;  1TZY C;  4LD9 D;  3AYW D;  5AV5 B;  1KU5 A;  1M19 D;  2PYO D;  3AFA D;  1ID3 A;  4Z66 A;  4WU9 A;  3W98 A;  1ID3 C;  4Z66 C;  4UPK A;  4WU9 C;  3C1C B;  1U35 B;  5E5A D;  3AZJ A;  4J8U B;  3MGP D;  5C3I B;  3B6G B;  2LY8 A;  1M18 D;  1TZY B;  4J8V B;  3LEL A;  3AZF B;  3AV1 A;  3AV1 C;  3R45 A;  5B31 D;  4HGA B;  1ID3 B;  4Z66 B;  4WU9 B;  3W98 B;  2FJ7 C;  3AZJ B;  5B0Y D;  3LJA A;  3LEL B;  3AV1 B;  3AZI A;  5DNM A;  3R45 B;  5DNM C;  5AV6 C;  3B0C W;  4J8W C;  2VQR A;  4LD9 A;  3AYW A;  1M19 A;  3LJA B;  3MGR D;  3AYW C;  1M19 C;  5DNN C;  3MNN C;  5DNM B;  3AZI B;  4LD9 C;  2PYO A;  3AFA A;  2FFF B;  5E5A A;  3AZG C;  3MGP A;  1M18 A;  3X1S D;  4LD9 B;  3AYW B;  1M19 B;  2J8P A;  5B31 A;  2PYO B;  3WTP E;  3AFA B;  3H0L C;  5E5A B;  3X1V C;  3MGP B;  1M18 B;  5B40 D;  5B0Y A;  3WKJ D;  5B0Y C;  5B31 B;  5GT0 C;  1BH9 A;  4EO5 C;  4R8P D;  5B0Y B;  1P3B C;  5B0Z D;  2DQN C;  5GXQ D;  5CPJ D;  1BH9 B;  3UTB D;  4EO5 B;  3KXB D;  4ZUX D;  2Y2P A;  1P34 D;  4CAY A;  5B2I D;  3X1S A;  1ZLA D;  4Z5T D;  3X1S C;  3MGR B;  1KX3 D;  3B6F C;  3REH D;  2IO5 C;  3MGQ D;  1JFI A;  4KGC D;  5B40 A;  3WKJ A;  4CAY B;  3WKJ C;  3X1S B;  2CV5 D;  3KFU G;  5JRG D;  2W8S A;  5GSU D;  1P3L D;  4G92 C;  2IO5 B;  1JFI B;  4R8P A;  5B40 B;  3WKJ B;  5B1M C;  5F99 C;  1R4V A;  5B0Z A;  2ZY4 A;  5GXQ A;  3UTB A;  5CPJ A;  5GXQ C;  5CPJ C;  3KXB A;  5B1L D;  4ZUX A;  3KXB C;  4DRA A;  4KUD C;  2HIO D;  4R8P B;  4WV4 B;  1P34 A;  5B2I A;  1ZLA A;  4Z5T A;  5B2I C;  1ZLA C;  4Z5T C;  1KX3 A;  5B0Z B;  4WNN A;  3EPJ A;  3REH A;  4E44 A;  5GXQ B;  3UTB B;  5CPJ B;  2BYM A;  2Y2Q A;  3KXB B;  3MVD D;  4ZUX B;  3MGQ A;  4KGC A;  5BS7 A;  1P34 B;  5B2I B;  2CV5 A;  1ZLA B;  3O62 C;  4Z5T B;  2CV5 C;  4H9S C;  1KX3 B;  5JRG A;  4WNN B;  3REH B;  1Q9C A;  2BYM B;  4ZBJ C;  5GSU A;  1P3L A;  1EQZ A;  1EQZ C;  3MGQ B;  4KGC B;  3LZ1 B;  1KX4 C;  5B24 C;  2CV5 B;  5AV6 D;  2NZD D;  4WU8 D;  5JRG B;  2JSS A;  3IP4 C;  4Z2M H;  5B1L A;  5GSU B;  4J8W D;  1P3L B;  3AN2 D;  2HIO A;  3VH6 T;  3EPL A;  5DNN D;  3MNN D;  1WWS A;  3AZG D;  3MVD A;  5B1L B;  3MVD C;  3P5J B;  5AV8 C;  3AV2 C;  2HIO B;  4UUZ A;  4YM6 D;  2JCH A;  1S32 D;  5CP6 C;  3MVD B;  3X1V D;  5BNX A;  3W96 D;  1TAF A;  4E45 A;  4UUZ B;  3C1B C;  3VH5 W;  5AV6 A;  2NZD A;  4NFT A;  5GT0 D;  4WU8 A;  2Y2M A;  3W97 D;  3AL0 C;  3WAA C;  4XUJ D;  5B33 C;  4WU8 C;  2NZD C;  4J8W A;  4J8X C;  1B67 A;  3AN2 A;  5BNX B;  1TAF B;  3AN2 C;  5GT3 D;  1P3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...