4LD9A

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9A00
4DRAA 1P3LB 1BH8A 3AZFB 5AV9C 4G92C 3MGSB 3WAAC 1P3OA 5B1MC 1KX3A 5F99D 5GT3C 5CPIA 4R8PA 5JA4A 3AZGC 1P3GD 4QLCA 4H9NA 3LJAD 3WTPD 2YFWB 3WA9C 4JJNA 5B40C 4WU8B 1F66B 1P3PD 1EQZA 2F8NB 5G49A 1HQ3A 5AY8A 5GXQD 4KUDC 1N1JA 3C1CD 1M1AC 5BNVA 4J8UB 2L5AA 3W97A 3W99B 4HGAC 1M19A 1P3FA 5FUGA 2AROD 3LZ1C 5B1LC 1P3AA 2FJ7D 4XZQA 1P3OB 4YS3A 1KX3B 5AV5D 5BS7C 4R8PB 5CPIB 2NQBD 4QLCB 4H9NB 2CWEA 3W98A 5GSUA 4AWLC 4J8WD 4H9PB 3VH6T 1P3MD 3AZIA 3TU4D 1EQZB 4LD9A 2F8NH 5G49B 5AY8B 5E5AA 1P3KB 1TZYA 3X1TD 1N1JB 3VH5W 5B0YA 1P34D 1AOIA 3A6NA 4XUJC 3UT9D 3AZFC 5B33D 3W97B 5GT0B 3AZHD 3MGSC 1P3FB 5FUGB 1B67A 3REJA 3X1VD 4Z5TD 1P3AB 4XZQB 5B1MA 5AV6B 3AZNA 3REIC 4CAYA 4YS3B 3REHA 4NE6A 1B6WA 1ZLAD 3KWQA 3W98B 1P3IA 3KUYD 3AZJB 3AZIB 3AZEC 4J8UC 5BNXA 3UTAA 5B2IA 4WU9A 3W99C 5E5AB 5AV9D 1TZYB 3VH5A 3WAAD 3AZKA 3A6NB 5AVCD 1P3OC 1KX3C 3REJB 3WA9D 5B40D 4J8XA 5CPIC 4R8PC 4H9OA 4QLCC 5B1MB 5B2JD 5GT3B 4CAYB 3AZGB 4JJNC 3REHB 3X1UD 3KWQB 4KUDD 1M1AD 1ULYA 1EQZC 5DNMA 1HQ3C 5AY8C 4DRBA 5BNXB 3LZ1D 5B2IB 3UTAB 5B1LD 3W97C 1S32A 2HIOC 4J8VA 1M19C 2PYOA 5JRGA 1P3FC 1P3AC 4XZQC 5CHLB 4YS3C 3MVDA 4J8XB 4H9OB 5BT1C 3W98C 5GSUC 3X1SD 3KXBA 3REKA 1ID3D 4ZUXA 3LELA 2YFVA 3AZIC 4LD9C 5DNMB 1P3LD 5E5AC 3AZEA 1TZYC 3MGSD 5B0YC 1M18A 1AOIC 4WZSB 3A6NC 1S32B 4J8VB 4XUJB 2PYOB 5JRGB 3AZMD 3REJC 4WU8D 1F66D 5CPKD 3AZNC 5AVBA 2F8ND 3MVDB 3REHC 5F99A 3REIB 3KWQC 2CV5D 1P3GA 1KX4D 1P3IC 3AV1A 5CP6A 1R4VA 3REKB 3W99D 1P3PA 4ZUXB 3LELB 2RVQD 3C1BA 3KSYA 3UTAC 4WU9C 5B2IC 3AZEB 3C1CA 3MGQA 3W96A 5BO0A 3AZKC 1KX3D 2HIOA 2JSSA 5CPID 4R8PD 4QLCD 1BH8B 3NQJA 4J8XC 4H9QA 5AV8A 1EQZD 5AVBB 5JA4B 5AY8D 3WTPE 5F99B 3B0CT 1KU5A 1P3KD 4JJNB 5DNMC 4WV4B 3AV1B 3MNNA 5KDMA 3AV2A 5CP6B 5GT0D 1HQ3B 3TU4A 5CPJA 1P3FD 2IO5B 3C1BB 4YM6A 5B32G 1P3AD 5BNVB 3RELA 4XZQD 1S32C 5DNNA 5AV6D 4J8VC 3MGQB 2PYOC 5B32D 5JRGC 3W96B 4YS3D 3UT9A 4H9SA 2HIOB 5B24D 1M19B 3AZHA 1TAFA 3W98D 5B0ZA 3MVDC 4Z66D 4KGCA 4H9QB 3MGPA 3AZJD 2NZDA 5AV8B 3WKJA 3AZID 4WNNA 3KXBC 3REKC 5E5AD 1ZLAA 5GSUB 4ZUXC 1TZYD 3LELC 2BYKA 3MNNB 5KDMB 3A6ND 3AV2B 2F8NK 4LD9B 2HUEB 3B6GA 1M18C 5CPJB 3REJD 4YM6B 1U35A 3RELB 5B0YB 3R45A 5B1MD 5DNNB 1AOIB 2LY8A 5GT3D 3AZGD 3REHD 3UT9B 3B6FA 5B31A 3AZHB 3LZ0A 5AVCA 3KWQD 1TAFB 5AVBC 5B0ZB 3B0DB 5F99C 3AZNB 4KGCB 3MGPB 5B2JA 1P3GC 2NZDB 3WKJB 3AFAA 3MGRA 3AV1C 4NE5A 4WNNB 5CP6C 3UTAD 5B2ID 3X1UA 1P3IB 1P3PC 2BYKB 2IO5C 3C1BC 3UTBA 1P3BA 3C1CC 3B6GB 3MGQC 4WU9B 3W96C 1U35B 4J8XD 3R45B 3AZKB 1BH9A 3B6FB 5B31B 3LZ0B 5AVCB 5AV8C 3VH5T 5DNMD 1H3OA 4NE3A 4CSRA 3AYWA 3AFAB 3MGRB 3X1SA 3MNNC 3AV2C 4E44A 1KX5A 1ID3A 2HUEC 3AN2A 1S32D 4X23A 4J8VD 4XUJD 3TU4C 3AZFD 3AZLA 5JRGD 5CPJC 1P3LA 2PYOD 4YM6C 3RELC 3UTBB 3O62A 1P3BB 5DNNC 3MVDD 3UT9C 4H9SC 3VH6W 3REID 3AZHC 1BH9B 2F8NG 5B0ZC 3AZMA 3B0DC 4WU8A 1F66A 4KGCC 4ZUXD 3MGPC 2NZDC 5CPKA 3LELD 3WKJC 1H3OB 1WWSA 3LJAA 3WTPA 1ZLAC 3AZED 4J8UD 2CV5A 4CSRB 1KX4A 3KXBB 3AYWB 1BFMA 4G91B 1KX5B 2YFVB 1ID3B 3AN2B 3B6GC 4X23B 3AZLB 5GXQA 1U35C 4Z2MH 1M18B 3O62B 1P3OD 5AVBD 3B6FC 3VH6A 5B31C 3LZ0C 5AVCC 2AROA 4JJND 3AZMB 2FJ7A 4KHAA 3AV1D 5CP6D 4H9PA 1HTAA 4ZBJC 4EO5B 1HQ3D 5B2JC 5CPKB 5AV5A 1A7WA 3AFAC 3MGRC 3C1BD 2NQBA 1P3GB 3X1UC 3LJAB 3WTPB 1P3KA 4J8WA 2CV5B 1KX4B 3MGQD 3W96D 3W97D 1P3PB 2HIOD 1P3MA 3UTBC 1M19D 5GT0A 1P3BC 5GXQB 3X1TA 3C1CB 4NFTA 5BO0B 5AV6A 1P34A 5AV8D 5B32A 5B33A 5BT1D 5B24A 3NQJB 5GSUD 3X1VA 2AROB 4Z5TA 4H9RA 2FJ7B 4KHAB 3MNND 3AV2D 4Z66A 4LD9D 3AZJA 3AYWC 5AV5B 3V9RA 5CPJD 3X1SC 4G91C 4YM6D 2NQBB 1KX5C 1ID3C 3RELD 5B0YD 3KUYA 4J8WB 5DNND 3AN2C 5C3IC 4X23C 3AZLC 1AOID 1P3LC 1P3MB 3TU4B 3O62C 2BYMA 5B0ZD 5AV9A 3X1TB 3AZND 3WAAA 4KGCD 3MGPD 2NZDD 1P34B 3WKJD 4UUZA 5GT3A 5B32B 5B33B 3AZMC 3AZGA 5B24B 4WU8C 1F66C 1P3ID 4EO5C 3X1VB 5CPKC 3WA9A 5B40A 4Z5TB 4H9RB 3LJAC 3WTPC 4Z66B 2CV5C 1KX4C 3B6GD 4WU9D 3V9RB 1ZLAB 4KUDA 1WWIA 1U35D 1M1AA 3KUYB 3AZKD 2RVQC 5B31G 5GXQC 3B6FD 5B31D 2BYMB 3LZ0D 3LZ1A 5B1LA 3NQUA 5AV9B 4G92B 3WAAB 4M6BA 2AROC 4UUZB 1JFIA 5BS7A 3AFAD 3MGRD 2FJ7C 4Z2MG 3WA9B 5B40B 5AV5C 2NQBC 5B2JB 4ZBJB 3UTBD 1P3KC 4J8WC 1P3BD 3X1UB 4KUDB 1P3MC 1M1AB 5GT0C 1Q9CA 3AZFA 4XUJA 3B0CW 3X1TC 4E45A 4HGAB 3MGSA 5AV6C 1F1EA 1P34C 3LZ1B 5B32C 5B33C 5B1LB 3NQUB 5B24C 2YFWA 3REIA 3X1VC 3KXBD 3AYWD 4Z5TC 3REKD 1JFIB 1KX5D 4Z66C 2F8NA 3AZJC 4AWLB 3AN2D 4X23D 3AZLD 1M18D 3O62D 3KUYC 4J8UA 3X1SB 3W99A 3B0BA 5C3IB
chains in the Genus database with same CATH superfamily
4DRAA 1P3LB 1BH8A 3AZFB 5AV9C 4G92C 3MGSB 3WAAC 1P3OA 5B1MC 1KX3A 5F99D 5GT3C 5CPIA 4R8PA 5JA4A 3AZGC 1P3GD 4QLCA 4H9NA 3LJAD 3WTPD 2YFWB 3WA9C 4JJNA 5B40C 4WU8B 1F66B 1P3PD 1EQZA 2F8NB 5G49A 1HQ3A 5AY8A 5GXQD 2DQNC 4KUDC 1N1JA 3C1CD 1M1AC 5BNVA 2VQRA 4J8UB 2L5AA 3W97A 3W99B 4HGAC 1M19A 1P3FA 5FUGA 2AROD 3LZ1C 5B1LC 1P3AA 2FJ7D 4XZQA 1Z2CB 1P3OB 4YS3A 1KX3B 5AV5D 5BS7C 4R8PB 5CPIB 2NQBD 4QLCB 3IP4C 4H9NB 2CWEA 3W98A 5GSUA 4AWLC 4J8WD 4H9PB 3VH6T 1P3MD 3AZIA 3TU4D 1EQZB 4LD9A 2F8NH 5G49B 5AY8B 5E5AA 2ZM5A 2JCHA 1P3KB 1TZYA 3X1TD 1N1JB 3VH5W 5B0YA 1P34D 1AOIA 3A6NA 4XUJC 3UT9D 3AZFC 5B33D 3W97B 5GT0B 3AZHD 2J8PA 3MGSC 1P3FB 5FUGB 1B67A 3REJA 3X1VD 4Z5TD 1P3AB 4XZQB 5B1MA 5AV6B 3AZNA 3REIC 2Y2HA 4CAYA 4YS3B 3REHA 4NE6A 1B6WA 1ZLAD 3KWQA 3W98B 1P3IA 3KUYD 3AZJB 2G5HC 3AZIB 3AZEC 4J8UC 5BNXA 3UTAA 5B2IA 4WU9A 3W99C 5E5AB 5AV9D 1TZYB 3VH5A 3WAAD 3AZKA 3A6NB 1T3UA 5AVCD 1P3OC 1KX3C 3REJB 3WA9D 5B40D 4J8XA 5CPIC 4R8PC 4H9OA 4QLCC 5B1MB 5B2JD 5GT3B 4CAYB 3AZGB 4JJNC 3REHB 3X1UD 3KWQB 4KUDD 1M1AD 1ULYA 1EQZC 5DNMA 1HQ3C 5AY8C 2RIQA 2Y2NA 3F6TA 4DRBA 5BNXB 3LZ1D 5B2IB 3EPLA 5B1LD 3UTAB 3W97C 1S32A 2HIOC 4J8VA 4WJ3C 1M19C 2PYOA 5JRGA 1P3FC 1P3AC 4XZQC 5CHLB 4YS3C 3MVDA 4J8XB 4H9OB 5BT1C 3W98C 5GSUC 2F2AC 3X1SD 3KXBA 3REKA 1ID3D 4ZUXA 3LELA 2YFVA 3AZIC 4LD9C 5DNMB 1P3LD 5E5AC 3AZEA 1TZYC 3MGSD 5B0YC 1M18A 1AOIC 2Y2IA 4WZSB 3A6NC 1S32B 4J8VB 4XUJB 2PYOB 5JRGB 3AZMD 3REJC 4DQYB 4WU8D 1F66D 5CPKD 3AZNC 3A1IA 5AVBA 2F8ND 3MVDB 3REHC 3P5JB 5F99A 3REIB 3AL0C 3KWQC 2CV5D 1P3GA 1KX4D 1P3IC 3AV1A 5CP6A 1R4VA 3REKB 3W99D 1P3PA 4ZUXB 3LELB 2RVQD 3C1BA 3KSYA 3UTAC 4WU9C 5B2IC 3AZEB 3C1CA 3MGQA 3W96A 5BO0A 3AZKC 1KX3D 2HIOA 2JSSA 5CPID 4R8PD 4QLCD 1BH8B 3NQJA 2G5IC 4J8XC 4H9QA 5AV8A 2FFFB 1EQZD 5AVBB 5JA4B 5AY8D 3WTPE 5F99B 3B0CT 1KU5A 1P3KD 4JJNB 5DNMC 4WV4B 3AV1B 3MNNA 5KDMA 3AV2A 5CP6B 5GT0D 1HQ3B 3TU4A 2Y2KA 5CPJA 2IO5B 3C1BB 1P3FD 4YM6A 5B32G 1P3AD 5BNVB 3RELA 4XZQD 1S32C 5DNNA 5AV6D 4J8VC 3MGQB 2PYOC 5B32D 5JRGC 3W96B 4YS3D 3UT9A 4H9SA 2HIOB 5B24D 1M19B 3AZHA 1TAFA 3W98D 5B0ZA 3MVDC 2XD5A 4Z66D 4KGCA 4H9QB 3MGPA 3AZJD 2NZDA 5AV8B 3WKJA 3AZID 4WNNA 3KXBC 3REKC 5E5AD 1ZLAA 2ZY4A 5GSUB 4ZUXC 1TZYD 3LELC 2BYKA 3MNNB 5KDMB 3A6ND 3AV2B 2F8NK 4LD9B 2HUEB 3B6GA 1M18C 5CPJB 3REJD 4YM6B 1U35A 3RELB 5B0YB 3R45A 5B1MD 5DNNB 2Y2LA 2LY8A 1AOIB 5GT3D 3AZGD 3FDDA 3REHD 3UT9B 3B6FA 5B31A 3AZHB 3LZ0A 5AVCA 3KWQD 1TAFB 5AVBC 5B0ZB 3B0DB 5F99C 3AZNB 4KGCB 3MGPB 2ZY5A 5B2JA 1P3GC 2NZDB 3WKJB 3AFAA 3MGRA 3AV1C 4NE5A 4WNNB 5CP6C 3UTAD 3EG5B 5B2ID 3X1UA 1P3IB 1P3PC 2BYKB 2IO5C 3C1BC 3UTBA 1P3BA 3C1CC 3B6GB 3MGQC 4WU9B 3W96C 1U35B 4J8XD 3R45B 3AZKB 1BH9A 3B6FB 5B31B 3LZ0B 5AVCB 5AV8C 3VH5T 5DNMD 1H3OA 4NE3A 4CSRA 3H0RC 3AYWA 2Y2JA 3AFAB 3MGRB 3X1SA 3MNNC 3AV2C 4E44A 1KX5A 1ID3A 2HUEC 3AN2A 1S32D 4X23A 4J8VD 4XUJD 2DF4C 3TU4C 3AZFD 5JRGD 3AZLA 5CPJC 1P3LA 4YM6C 2PYOD 1W2EA 2XD1A 3RELC 3UTBB 3O62A 1P3BB 2JE5A 5DNNC 3MVDD 3UT9C 4H9SC 3VH6W 3REID 3AZHC 1BH9B 2F8NG 2Y2OA 5B0ZC 3AZMA 3B0DC 4WU8A 1F66A 4KGCC 4ZUXD 3MGPC 2NZDC 5CPKA 3LELD 3WKJC 3KFUG 1H3OB 1WWSA 3LJAA 3WTPA 1ZLAC 3AZED 4J8UD 2CV5A 4CSRB 1KX4A 3KXBB 3AYWB 1BFMA 3EPKA 4G91B 1KX5B 2YFVB 1ID3B 3AN2B 3B6GC 4X23B 3AZLB 5GXQA 1U35C 2BG1A 4Z2MH 1M18B 3O62B 1P3OD 5AVBD 3B6FC 3VH6A 5B31C 3LZ0C 5AVCC 2AROA 4JJND 3AZMB 2FJ7A 4KHAA 3AV1D 3EPJA 5CP6D 4H9PA 1HTAA 4ZBJC 4EO5B 1HQ3D 5B2JC 5CPKB 5AV5A 1A7WA 3AFAC 3MGRC 3C1BD 3H0MC 1P3GB 2NQBA 3X1UC 3LJAB 3WTPB 1P3KA 4J8WA 2CV5B 1KX4B 2ZY2A 3MGQD 3W96D 3W97D 1P3PB 2HIOD 1P3MA 3UTBC 1M19D 5GT0A 1PZRA 1P3BC 5GXQB 2Y2GA 3X1TA 3C1CB 4NFTA 2Y2PA 5BO0B 5AV6A 1P34A 5AV8D 5B32A 5B33A 2W8SA 5BT1D 5B24A 3NQJB 5GSUD 3X1VA 2AROB 4Z5TA 4H9RA 2FJ7B 4KHAB 3MNND 3AV2D 4Z66A 4LD9D 3AZJA 3AYWC 5AV5B 3V9RA 5CPJD 3X1SC 4G91C 4YM6D 2NQBB 1KX5C 1ID3C 3RELD 5B0YD 4UPKA 3KUYA 3A1KA 5DNND 5C3IC 4X23C 4J8WB 3AZLC 3AN2C 1AOID 1P3LC 2Y2QA 1P3MB 3TU4B 3O62C 2BYMA 5B0ZD 5AV9A 3X1TB 3AZND 3WAAA 4KGCD 3MGPD 2NZDD 1P34B 3WKJD 2UWXA 4UUZA 5GT3A 5B32B 5B33B 3AZMC 3AZGA 5B24B 4WU8C 1F66C 1P3ID 4EO5C 3X1VB 5CPKC 3WA9A 5B40A 4Z5TB 4H9RB 3LJAC 3WTPC 4Z66B 2CV5C 1KX4C 3B6GD 4WU9D 3V9RB 1ZLAB 4KUDA 1WWIA 1U35D 1M1AA 3KUYB 3AZKD 2RVQC 2Y2MA 5GXQC 5B31G 3EPHA 3B6FD 5B31D 2BYMB 3LZ0D 3LZ1A 5B1LA 3NQUA 5AV9B 4G92B 3WAAB 4M6BA 2AROC 4UUZB 1JFIA 5BS7A 3AFAD 3MGRD 2FJ7C 4Z2MG 3WA9B 5B40B 5AV5C 2NQBC 5B2JB 4ZBJB 3UTBD 1P3KC 4J8WC 1P3BD 3X1UB 4KUDB 1P3MC 1M1AB 5GT0C 1Q9CA 3AZFA 4XUJA 3B0CW 3X1TC 4E45A 4HGAB 3MGSA 5AV6C 1F1EA 1P34C 3LZ1B 5B32C 5B33C 5B1LB 3NQUB 5B24C 2YFWA 3H0LC 3REIA 3X1VC 3KXBD 3AYWD 4Z5TC 3REKD 1JFIB 1KX5D 4Z66C 2F8NA 3AZJC 4AWLB 3AN2D 4X23D 3AZLD 1M18D 3O62D 3KUYC 4J8UA 3X1SB 3W99A 3B0BA 2ZY3A 5C3IB
chains in the Genus database with same CATH topology
4DRAA 1P3LB 1BH8A 3AZFB 5AV9C 4G92C 3MGSB 3WAAC 1P3OA 5B1MC 1KX3A 5F99D 5GT3C 5CPIA 4R8PA 5JA4A 3AZGC 1P3GD 4QLCA 4H9NA 3LJAD 3WTPD 2YFWB 3WA9C 4JJNA 5B40C 4WU8B 1F66B 1P3PD 1EQZA 2F8NB 5G49A 1HQ3A 5AY8A 5GXQD 2DQNC 4KUDC 1N1JA 3C1CD 1M1AC 5BNVA 2VQRA 4J8UB 2L5AA 3W97A 3W99B 4HGAC 1M19A 1P3FA 5FUGA 2AROD 3LZ1C 5B1LC 1P3AA 2FJ7D 4XZQA 1Z2CB 1P3OB 4YS3A 1KX3B 5AV5D 5BS7C 4R8PB 5CPIB 2NQBD 4QLCB 3IP4C 4H9NB 2CWEA 3W98A 5GSUA 4AWLC 4J8WD 4H9PB 3VH6T 1P3MD 3AZIA 3TU4D 1EQZB 4LD9A 2F8NH 5G49B 5AY8B 5E5AA 2ZM5A 2JCHA 1P3KB 1TZYA 3X1TD 1N1JB 3VH5W 5B0YA 1P34D 1AOIA 3A6NA 4XUJC 3UT9D 3AZFC 5B33D 3W97B 5GT0B 3AZHD 2J8PA 3MGSC 1P3FB 5FUGB 1B67A 3REJA 3X1VD 4Z5TD 1P3AB 4XZQB 5B1MA 5AV6B 3AZNA 3REIC 2Y2HA 4CAYA 4YS3B 3REHA 4NE6A 1B6WA 1ZLAD 3KWQA 3W98B 1P3IA 3KUYD 3AZJB 2G5HC 3AZIB 3AZEC 4J8UC 5BNXA 3UTAA 5B2IA 4WU9A 3W99C 5E5AB 5AV9D 1TZYB 3VH5A 3WAAD 3AZKA 3A6NB 1T3UA 5AVCD 1P3OC 1KX3C 3REJB 3WA9D 5B40D 4J8XA 5CPIC 4R8PC 4H9OA 4QLCC 5B1MB 5B2JD 5GT3B 4CAYB 3AZGB 4JJNC 3REHB 3X1UD 3KWQB 4KUDD 1M1AD 1ULYA 1EQZC 5DNMA 1HQ3C 5AY8C 2RIQA 2Y2NA 3F6TA 4DRBA 5BNXB 3LZ1D 5B2IB 3EPLA 5B1LD 3UTAB 3W97C 1S32A 2HIOC 4J8VA 4WJ3C 1M19C 2PYOA 5JRGA 1P3FC 1P3AC 4XZQC 5CHLB 4YS3C 3MVDA 4J8XB 4H9OB 5BT1C 3W98C 5GSUC 2F2AC 3X1SD 3KXBA 3REKA 1ID3D 4ZUXA 3LELA 2YFVA 3AZIC 4LD9C 5DNMB 1P3LD 5E5AC 3AZEA 1TZYC 3MGSD 5B0YC 1M18A 1AOIC 2Y2IA 4WZSB 3A6NC 1S32B 4J8VB 4XUJB 2PYOB 5JRGB 3AZMD 3REJC 4DQYB 4WU8D 1F66D 5CPKD 3AZNC 3A1IA 5AVBA 2F8ND 3MVDB 3REHC 3P5JB 5F99A 3REIB 3AL0C 3KWQC 2CV5D 1P3GA 1KX4D 1P3IC 3AV1A 5CP6A 1R4VA 3REKB 3W99D 1P3PA 4ZUXB 3LELB 2RVQD 3C1BA 3KSYA 3UTAC 4WU9C 5B2IC 3AZEB 3C1CA 3MGQA 3W96A 5BO0A 3AZKC 1KX3D 2HIOA 2JSSA 5CPID 4R8PD 4QLCD 1BH8B 3NQJA 2G5IC 4J8XC 4H9QA 5AV8A 2FFFB 1EQZD 5AVBB 5JA4B 5AY8D 3WTPE 5F99B 3B0CT 1KU5A 1P3KD 4JJNB 5DNMC 4WV4B 3AV1B 3MNNA 5KDMA 3AV2A 5CP6B 5GT0D 1HQ3B 3TU4A 2Y2KA 5CPJA 2IO5B 3C1BB 1P3FD 4YM6A 5B32G 1P3AD 5BNVB 3RELA 4XZQD 1S32C 5DNNA 5AV6D 4J8VC 3MGQB 2PYOC 5B32D 5JRGC 3W96B 4YS3D 3UT9A 4H9SA 2HIOB 5B24D 1M19B 3AZHA 1TAFA 3W98D 5B0ZA 3MVDC 2XD5A 4Z66D 4KGCA 4H9QB 3MGPA 3AZJD 2NZDA 5AV8B 3WKJA 3AZID 4WNNA 3KXBC 3REKC 5E5AD 1ZLAA 2ZY4A 5GSUB 4ZUXC 1TZYD 3LELC 2BYKA 3MNNB 5KDMB 3A6ND 3AV2B 2F8NK 4LD9B 2HUEB 3B6GA 1M18C 5CPJB 3REJD 4YM6B 1U35A 3RELB 5B0YB 3R45A 5B1MD 5DNNB 2Y2LA 2LY8A 1AOIB 5GT3D 3AZGD 3FDDA 3REHD 3UT9B 3B6FA 5B31A 3AZHB 3LZ0A 5AVCA 3KWQD 1TAFB 5AVBC 5B0ZB 3B0DB 5F99C 3AZNB 4KGCB 3MGPB 2ZY5A 5B2JA 1P3GC 2NZDB 3WKJB 3AFAA 3MGRA 3AV1C 4NE5A 4WNNB 5CP6C 3UTAD 3EG5B 5B2ID 3X1UA 1P3IB 1P3PC 2BYKB 2IO5C 3C1BC 3UTBA 1P3BA 3C1CC 3B6GB 3MGQC 4WU9B 3W96C 1U35B 4J8XD 3R45B 3AZKB 1BH9A 3B6FB 5B31B 3LZ0B 5AVCB 5AV8C 3VH5T 5DNMD 1H3OA 4NE3A 4CSRA 3H0RC 3AYWA 2Y2JA 3AFAB 3MGRB 3X1SA 3MNNC 3AV2C 4E44A 1KX5A 1ID3A 2HUEC 3AN2A 1S32D 4X23A 4J8VD 4XUJD 2DF4C 3TU4C 3AZFD 5JRGD 3AZLA 5CPJC 1P3LA 4YM6C 2PYOD 1W2EA 2XD1A 3RELC 3UTBB 3O62A 1P3BB 2JE5A 5DNNC 3MVDD 3UT9C 4H9SC 3VH6W 3REID 3AZHC 1BH9B 2F8NG 2Y2OA 5B0ZC 3AZMA 3B0DC 4WU8A 1F66A 4KGCC 4ZUXD 3MGPC 2NZDC 5CPKA 3LELD 3WKJC 3KFUG 1H3OB 1WWSA 3LJAA 3WTPA 1ZLAC 3AZED 4J8UD 2CV5A 4CSRB 1KX4A 3KXBB 3AYWB 1BFMA 3EPKA 4G91B 1KX5B 2YFVB 1ID3B 3AN2B 3B6GC 4X23B 3AZLB 5GXQA 1U35C 2BG1A 4Z2MH 1M18B 3O62B 1P3OD 5AVBD 3B6FC 3VH6A 5B31C 3LZ0C 5AVCC 2AROA 4JJND 3AZMB 2FJ7A 4KHAA 3AV1D 3EPJA 5CP6D 4H9PA 1HTAA 4ZBJC 4EO5B 1HQ3D 5B2JC 5CPKB 5AV5A 1A7WA 3AFAC 3MGRC 3C1BD 3H0MC 1P3GB 2NQBA 3X1UC 3LJAB 3WTPB 1P3KA 4J8WA 2CV5B 1KX4B 2ZY2A 3MGQD 3W96D 3W97D 1P3PB 2HIOD 1P3MA 3UTBC 1M19D 5GT0A 1PZRA 1P3BC 5GXQB 2Y2GA 3X1TA 3C1CB 4NFTA 2Y2PA 5BO0B 5AV6A 1P34A 5AV8D 5B32A 5B33A 2W8SA 5BT1D 5B24A 3NQJB 5GSUD 3X1VA 2AROB 4Z5TA 4H9RA 2FJ7B 4KHAB 3MNND 3AV2D 4Z66A 4LD9D 3AZJA 3AYWC 5AV5B 3V9RA 5CPJD 3X1SC 4G91C 4YM6D 2NQBB 1KX5C 1ID3C 3RELD 5B0YD 4UPKA 3KUYA 3A1KA 5DNND 5C3IC 4X23C 4J8WB 3AZLC 3AN2C 1AOID 1P3LC 2Y2QA 1P3MB 3TU4B 3O62C 2BYMA 5B0ZD 5AV9A 3X1TB 3AZND 3WAAA 4KGCD 3MGPD 2NZDD 1P34B 3WKJD 2UWXA 4UUZA 5GT3A 5B32B 5B33B 3AZMC 3AZGA 5B24B 4WU8C 1F66C 1P3ID 4EO5C 3X1VB 5CPKC 3WA9A 5B40A 4Z5TB 4H9RB 3LJAC 3WTPC 4Z66B 2CV5C 1KX4C 3B6GD 4WU9D 3V9RB 1ZLAB 4KUDA 1WWIA 1U35D 1M1AA 3KUYB 3AZKD 2RVQC 2Y2MA 5GXQC 5B31G 3EPHA 3B6FD 5B31D 2BYMB 3LZ0D 3LZ1A 5B1LA 3NQUA 5AV9B 4G92B 3WAAB 4M6BA 2AROC 4UUZB 1JFIA 5BS7A 3AFAD 3MGRD 2FJ7C 4Z2MG 3WA9B 5B40B 5AV5C 2NQBC 5B2JB 4ZBJB 3UTBD 1P3KC 4J8WC 1P3BD 3X1UB 4KUDB 1P3MC 1M1AB 5GT0C 1Q9CA 3AZFA 4XUJA 3B0CW 3X1TC 4E45A 4HGAB 3MGSA 5AV6C 1F1EA 1P34C 3LZ1B 5B32C 5B33C 5B1LB 3NQUB 5B24C 2YFWA 3H0LC 3REIA 3X1VC 3KXBD 3AYWD 4Z5TC 3REKD 1JFIB 1KX5D 4Z66C 2F8NA 3AZJC 4AWLB 3AN2D 4X23D 3AZLD 1M18D 3O62D 3KUYC 4J8UA 3X1SB 3W99A 3B0BA 2ZY3A 5C3IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRA A;  1P3L B;  1BH8 A;  3AZF B;  5AV9 C;  4G92 C;  3MGS B;  3WAA C;  1P3O A;  5B1M C;  1KX3 A;  5F99 D;  5GT3 C;  5CPI A;  4R8P A;  5JA4 A;  3AZG C;  1P3G D;  4QLC A;  4H9N A;  3LJA D;  3WTP D;  2YFW B;  3WA9 C;  4JJN A;  5B40 C;  4WU8 B;  1F66 B;  1P3P D;  1EQZ A;  2F8N B;  5G49 A;  1HQ3 A;  5AY8 A;  5GXQ D;  4KUD C;  1N1J A;  3C1C D;  1M1A C;  5BNV A;  4J8U B;  2L5A A;  3W97 A;  3W99 B;  4HGA C;  1M19 A;  1P3F A;  5FUG A;  2ARO D;  3LZ1 C;  5B1L C;  1P3A A;  2FJ7 D;  4XZQ A;  1P3O B;  4YS3 A;  1KX3 B;  5AV5 D;  5BS7 C;  4R8P B;  5CPI B;  2NQB D;  4QLC B;  4H9N B;  2CWE A;  3W98 A;  5GSU A;  4AWL C;  4J8W D;  4H9P B;  3VH6 T;  1P3M D;  3AZI A;  3TU4 D;  1EQZ B;  4LD9 A;  2F8N H;  5G49 B;  5AY8 B;  5E5A A;  1P3K B;  1TZY A;  3X1T D;  1N1J B;  3VH5 W;  5B0Y A;  1P34 D;  1AOI A;  3A6N A;  4XUJ C;  3UT9 D;  3AZF C;  5B33 D;  3W97 B;  5GT0 B;  3AZH D;  3MGS C;  1P3F B;  5FUG B;  1B67 A;  3REJ A;  3X1V D;  4Z5T D;  1P3A B;  4XZQ B;  5B1M A;  5AV6 B;  3AZN A;  3REI C;  4CAY A;  4YS3 B;  3REH A;  4NE6 A;  1B6W A;  1ZLA D;  3KWQ A;  3W98 B;  1P3I A;  3KUY D;  3AZJ B;  3AZI B;  3AZE C;  4J8U C;  5BNX A;  3UTA A;  5B2I A;  4WU9 A;  3W99 C;  5E5A B;  5AV9 D;  1TZY B;  3VH5 A;  3WAA D;  3AZK A;  3A6N B;  5AVC D;  1P3O C;  1KX3 C;  3REJ B;  3WA9 D;  5B40 D;  4J8X A;  5CPI C;  4R8P C;  4H9O A;  4QLC C;  5B1M B;  5B2J D;  5GT3 B;  4CAY B;  3AZG B;  4JJN C;  3REH B;  3X1U D;  3KWQ B;  4KUD D;  1M1A D;  1ULY A;  1EQZ C;  5DNM A;  1HQ3 C;  5AY8 C;  4DRB A;  5BNX B;  3LZ1 D;  5B2I B;  3UTA B;  5B1L D;  3W97 C;  1S32 A;  2HIO C;  4J8V A;  1M19 C;  2PYO A;  5JRG A;  1P3F C;  1P3A C;  4XZQ C;  5CHL B;  4YS3 C;  3MVD A;  4J8X B;  4H9O B;  5BT1 C;  3W98 C;  5GSU C;  3X1S D;  3KXB A;  3REK A;  1ID3 D;  4ZUX A;  3LEL A;  2YFV A;  3AZI C;  4LD9 C;  5DNM B;  1P3L D;  5E5A C;  3AZE A;  1TZY C;  3MGS D;  5B0Y C;  1M18 A;  1AOI C;  4WZS B;  3A6N C;  1S32 B;  4J8V B;  4XUJ B;  2PYO B;  5JRG B;  3AZM D;  3REJ C;  4WU8 D;  1F66 D;  5CPK D;  3AZN C;  5AVB A;  2F8N D;  3MVD B;  3REH C;  5F99 A;  3REI B;  3KWQ C;  2CV5 D;  1P3G A;  1KX4 D;  1P3I C;  3AV1 A;  5CP6 A;  1R4V A;  3REK B;  3W99 D;  1P3P A;  4ZUX B;  3LEL B;  2RVQ D;  3C1B A;  3KSY A;  3UTA C;  4WU9 C;  5B2I C;  3AZE B;  3C1C A;  3MGQ A;  3W96 A;  5BO0 A;  3AZK C;  1KX3 D;  2HIO A;  2JSS A;  5CPI D;  4R8P D;  4QLC D;  1BH8 B;  3NQJ A;  4J8X C;  4H9Q A;  5AV8 A;  1EQZ D;  5AVB B;  5JA4 B;  5AY8 D;  3WTP E;  5F99 B;  3B0C T;  1KU5 A;  1P3K D;  4JJN B;  5DNM C;  4WV4 B;  3AV1 B;  3MNN A;  5KDM A;  3AV2 A;  5CP6 B;  5GT0 D;  1HQ3 B;  3TU4 A;  5CPJ A;  1P3F D;  2IO5 B;  3C1B B;  4YM6 A;  5B32 G;  1P3A D;  5BNV B;  3REL A;  4XZQ D;  1S32 C;  5DNN A;  5AV6 D;  4J8V C;  3MGQ B;  2PYO C;  5B32 D;  5JRG C;  3W96 B;  4YS3 D;  3UT9 A;  4H9S A;  2HIO B;  5B24 D;  1M19 B;  3AZH A;  1TAF A;  3W98 D;  5B0Z A;  3MVD C;  4Z66 D;  4KGC A;  4H9Q B;  3MGP A;  3AZJ D;  2NZD A;  5AV8 B;  3WKJ A;  3AZI D;  4WNN A;  3KXB C;  3REK C;  5E5A D;  1ZLA A;  5GSU B;  4ZUX C;  1TZY D;  3LEL C;  2BYK A;  3MNN B;  5KDM B;  3A6N D;  3AV2 B;  2F8N K;  4LD9 B;  2HUE B;  3B6G A;  1M18 C;  5CPJ B;  3REJ D;  4YM6 B;  1U35 A;  3REL B;  5B0Y B;  3R45 A;  5B1M D;  5DNN B;  1AOI B;  2LY8 A;  5GT3 D;  3AZG D;  3REH D;  3UT9 B;  3B6F A;  5B31 A;  3AZH B;  3LZ0 A;  5AVC A;  3KWQ D;  1TAF B;  5AVB C;  5B0Z B;  3B0D B;  5F99 C;  3AZN B;  4KGC B;  3MGP B;  5B2J A;  1P3G C;  2NZD B;  3WKJ B;  3AFA A;  3MGR A;  3AV1 C;  4NE5 A;  4WNN B;  5CP6 C;  3UTA D;  5B2I D;  3X1U A;  1P3I B;  1P3P C;  2BYK B;  2IO5 C;  3C1B C;  3UTB A;  1P3B A;  3C1C C;  3B6G B;  3MGQ C;  4WU9 B;  3W96 C;  1U35 B;  4J8X D;  3R45 B;  3AZK B;  1BH9 A;  3B6F B;  5B31 B;  3LZ0 B;  5AVC B;  5AV8 C;  3VH5 T;  5DNM D;  1H3O A;  4NE3 A;  4CSR A;  3AYW A;  3AFA B;  3MGR B;  3X1S A;  3MNN C;  3AV2 C;  4E44 A;  1KX5 A;  1ID3 A;  2HUE C;  3AN2 A;  1S32 D;  4X23 A;  4J8V D;  4XUJ D;  3TU4 C;  3AZF D;  3AZL A;  5JRG D;  5CPJ C;  1P3L A;  2PYO D;  4YM6 C;  3REL C;  3UTB B;  3O62 A;  1P3B B;  5DNN C;  3MVD D;  3UT9 C;  4H9S C;  3VH6 W;  3REI D;  3AZH C;  1BH9 B;  2F8N G;  5B0Z C;  3AZM A;  3B0D C;  4WU8 A;  1F66 A;  4KGC C;  4ZUX D;  3MGP C;  2NZD C;  5CPK A;  3LEL D;  3WKJ C;  1H3O B;  1WWS A;  3LJA A;  3WTP A;  1ZLA C;  3AZE D;  4J8U D;  2CV5 A;  4CSR B;  1KX4 A;  3KXB B;  3AYW B;  1BFM A;  4G91 B;  1KX5 B;  2YFV B;  1ID3 B;  3AN2 B;  3B6G C;  4X23 B;  3AZL B;  5GXQ A;  1U35 C;  4Z2M H;  1M18 B;  3O62 B;  1P3O D;  5AVB D;  3B6F C;  3VH6 A;  5B31 C;  3LZ0 C;  5AVC C;  2ARO A;  4JJN D;  3AZM B;  2FJ7 A;  4KHA A;  3AV1 D;  5CP6 D;  4H9P A;  1HTA A;  4ZBJ C;  4EO5 B;  1HQ3 D;  5B2J C;  5CPK B;  5AV5 A;  1A7W A;  3AFA C;  3MGR C;  3C1B D;  2NQB A;  1P3G B;  3X1U C;  3LJA B;  3WTP B;  1P3K A;  4J8W A;  2CV5 B;  1KX4 B;  3MGQ D;  3W96 D;  3W97 D;  1P3P B;  2HIO D;  1P3M A;  3UTB C;  1M19 D;  5GT0 A;  1P3B C;  5GXQ B;  3X1T A;  3C1C B;  4NFT A;  5BO0 B;  5AV6 A;  1P34 A;  5AV8 D;  5B32 A;  5B33 A;  5BT1 D;  5B24 A;  3NQJ B;  5GSU D;  3X1V A;  2ARO B;  4Z5T A;  4H9R A;  2FJ7 B;  4KHA B;  3MNN D;  3AV2 D;  4Z66 A;  4LD9 D;  3AZJ A;  3AYW C;  5AV5 B;  3V9R A;  5CPJ D;  3X1S C;  4G91 C;  4YM6 D;  2NQB B;  1KX5 C;  1ID3 C;  3REL D;  5B0Y D;  3KUY A;  4J8W B;  5DNN D;  3AN2 C;  5C3I C;  4X23 C;  3AZL C;  1AOI D;  1P3L C;  1P3M B;  3TU4 B;  3O62 C;  2BYM A;  5B0Z D;  5AV9 A;  3X1T B;  3AZN D;  3WAA A;  4KGC D;  3MGP D;  2NZD D;  1P34 B;  3WKJ D;  4UUZ A;  5GT3 A;  5B32 B;  5B33 B;  3AZM C;  3AZG A;  5B24 B;  4WU8 C;  1F66 C;  1P3I D;  4EO5 C;  3X1V B;  5CPK C;  3WA9 A;  5B40 A;  4Z5T B;  4H9R B;  3LJA C;  3WTP C;  4Z66 B;  2CV5 C;  1KX4 C;  3B6G D;  4WU9 D;  3V9R B;  1ZLA B;  4KUD A;  1WWI A;  1U35 D;  1M1A A;  3KUY B;  3AZK D;  2RVQ C;  5B31 G;  5GXQ C;  3B6F D;  5B31 D;  2BYM B;  3LZ0 D;  3LZ1 A;  5B1L A;  3NQU A;  5AV9 B;  4G92 B;  3WAA B;  4M6B A;  2ARO C;  4UUZ B;  1JFI A;  5BS7 A;  3AFA D;  3MGR D;  2FJ7 C;  4Z2M G;  3WA9 B;  5B40 B;  5AV5 C;  2NQB C;  5B2J B;  4ZBJ B;  3UTB D;  1P3K C;  4J8W C;  1P3B D;  3X1U B;  4KUD B;  1P3M C;  1M1A B;  5GT0 C;  1Q9C A;  3AZF A;  4XUJ A;  3B0C W;  3X1T C;  4E45 A;  4HGA B;  3MGS A;  5AV6 C;  1F1E A;  1P34 C;  3LZ1 B;  5B32 C;  5B33 C;  5B1L B;  3NQU B;  5B24 C;  2YFW A;  3REI A;  3X1V C;  3KXB D;  3AYW D;  4Z5T C;  3REK D;  1JFI B;  1KX5 D;  4Z66 C;  2F8N A;  3AZJ C;  4AWL B;  3AN2 D;  4X23 D;  3AZL D;  1M18 D;  3O62 D;  3KUY C;  4J8U A;  3X1S B;  3W99 A;  3B0B A;  5C3I B; 
#chains in the Genus database with same CATH topology
 4DRA A;  1P3L B;  1BH8 A;  3AZF B;  5AV9 C;  4G92 C;  3MGS B;  3WAA C;  1P3O A;  5B1M C;  1KX3 A;  5F99 D;  5GT3 C;  5CPI A;  4R8P A;  5JA4 A;  3AZG C;  1P3G D;  4QLC A;  4H9N A;  3LJA D;  3WTP D;  2YFW B;  3WA9 C;  4JJN A;  5B40 C;  4WU8 B;  1F66 B;  1P3P D;  1EQZ A;  2F8N B;  5G49 A;  1HQ3 A;  5AY8 A;  5GXQ D;  2DQN C;  4KUD C;  1N1J A;  3C1C D;  1M1A C;  5BNV A;  2VQR A;  4J8U B;  2L5A A;  3W97 A;  3W99 B;  4HGA C;  1M19 A;  1P3F A;  5FUG A;  2ARO D;  3LZ1 C;  5B1L C;  1P3A A;  2FJ7 D;  4XZQ A;  1Z2C B;  1P3O B;  4YS3 A;  1KX3 B;  5AV5 D;  5BS7 C;  4R8P B;  5CPI B;  2NQB D;  4QLC B;  3IP4 C;  4H9N B;  2CWE A;  3W98 A;  5GSU A;  4AWL C;  4J8W D;  4H9P B;  3VH6 T;  1P3M D;  3AZI A;  3TU4 D;  1EQZ B;  4LD9 A;  2F8N H;  5G49 B;  5AY8 B;  5E5A A;  2ZM5 A;  2JCH A;  1P3K B;  1TZY A;  3X1T D;  1N1J B;  3VH5 W;  5B0Y A;  1P34 D;  1AOI A;  3A6N A;  4XUJ C;  3UT9 D;  3AZF C;  5B33 D;  3W97 B;  5GT0 B;  3AZH D;  2J8P A;  3MGS C;  1P3F B;  5FUG B;  1B67 A;  3REJ A;  3X1V D;  4Z5T D;  1P3A B;  4XZQ B;  5B1M A;  5AV6 B;  3AZN A;  3REI C;  2Y2H A;  4CAY A;  4YS3 B;  3REH A;  4NE6 A;  1B6W A;  1ZLA D;  3KWQ A;  3W98 B;  1P3I A;  3KUY D;  3AZJ B;  2G5H C;  3AZI B;  3AZE C;  4J8U C;  5BNX A;  3UTA A;  5B2I A;  4WU9 A;  3W99 C;  5E5A B;  5AV9 D;  1TZY B;  3VH5 A;  3WAA D;  3AZK A;  3A6N B;  1T3U A;  5AVC D;  1P3O C;  1KX3 C;  3REJ B;  3WA9 D;  5B40 D;  4J8X A;  5CPI C;  4R8P C;  4H9O A;  4QLC C;  5B1M B;  5B2J D;  5GT3 B;  4CAY B;  3AZG B;  4JJN C;  3REH B;  3X1U D;  3KWQ B;  4KUD D;  1M1A D;  1ULY A;  1EQZ C;  5DNM A;  1HQ3 C;  5AY8 C;  2RIQ A;  2Y2N A;  3F6T A;  4DRB A;  5BNX B;  3LZ1 D;  5B2I B;  3EPL A;  5B1L D;  3UTA B;  3W97 C;  1S32 A;  2HIO C;  4J8V A;  4WJ3 C;  1M19 C;  2PYO A;  5JRG A;  1P3F C;  1P3A C;  4XZQ C;  5CHL B;  4YS3 C;  3MVD A;  4J8X B;  4H9O B;  5BT1 C;  3W98 C;  5GSU C;  2F2A C;  3X1S D;  3KXB A;  3REK A;  1ID3 D;  4ZUX A;  3LEL A;  2YFV A;  3AZI C;  4LD9 C;  5DNM B;  1P3L D;  5E5A C;  3AZE A;  1TZY C;  3MGS D;  5B0Y C;  1M18 A;  1AOI C;  2Y2I A;  4WZS B;  3A6N C;  1S32 B;  4J8V B;  4XUJ B;  2PYO B;  5JRG B;  3AZM D;  3REJ C;  4DQY B;  4WU8 D;  1F66 D;  5CPK D;  3AZN C;  3A1I A;  5AVB A;  2F8N D;  3MVD B;  3REH C;  3P5J B;  5F99 A;  3REI B;  3AL0 C;  3KWQ C;  2CV5 D;  1P3G A;  1KX4 D;  1P3I C;  3AV1 A;  5CP6 A;  1R4V A;  3REK B;  3W99 D;  1P3P A;  4ZUX B;  3LEL B;  2RVQ D;  3C1B A;  3KSY A;  3UTA C;  4WU9 C;  5B2I C;  3AZE B;  3C1C A;  3MGQ A;  3W96 A;  5BO0 A;  3AZK C;  1KX3 D;  2HIO A;  2JSS A;  5CPI D;  4R8P D;  4QLC D;  1BH8 B;  3NQJ A;  2G5I C;  4J8X C;  4H9Q A;  5AV8 A;  2FFF B;  1EQZ D;  5AVB B;  5JA4 B;  5AY8 D;  3WTP E;  5F99 B;  3B0C T;  1KU5 A;  1P3K D;  4JJN B;  5DNM C;  4WV4 B;  3AV1 B;  3MNN A;  5KDM A;  3AV2 A;  5CP6 B;  5GT0 D;  1HQ3 B;  3TU4 A;  2Y2K A;  5CPJ A;  2IO5 B;  3C1B B;  1P3F D;  4YM6 A;  5B32 G;  1P3A D;  5BNV B;  3REL A;  4XZQ D;  1S32 C;  5DNN A;  5AV6 D;  4J8V C;  3MGQ B;  2PYO C;  5B32 D;  5JRG C;  3W96 B;  4YS3 D;  3UT9 A;  4H9S A;  2HIO B;  5B24 D;  1M19 B;  3AZH A;  1TAF A;  3W98 D;  5B0Z A;  3MVD C;  2XD5 A;  4Z66 D;  4KGC A;  4H9Q B;  3MGP A;  3AZJ D;  2NZD A;  5AV8 B;  3WKJ A;  3AZI D;  4WNN A;  3KXB C;  3REK C;  5E5A D;  1ZLA A;  2ZY4 A;  5GSU B;  4ZUX C;  1TZY D;  3LEL C;  2BYK A;  3MNN B;  5KDM B;  3A6N D;  3AV2 B;  2F8N K;  4LD9 B;  2HUE B;  3B6G A;  1M18 C;  5CPJ B;  3REJ D;  4YM6 B;  1U35 A;  3REL B;  5B0Y B;  3R45 A;  5B1M D;  5DNN B;  2Y2L A;  2LY8 A;  1AOI B;  5GT3 D;  3AZG D;  3FDD A;  3REH D;  3UT9 B;  3B6F A;  5B31 A;  3AZH B;  3LZ0 A;  5AVC A;  3KWQ D;  1TAF B;  5AVB C;  5B0Z B;  3B0D B;  5F99 C;  3AZN B;  4KGC B;  3MGP B;  2ZY5 A;  5B2J A;  1P3G C;  2NZD B;  3WKJ B;  3AFA A;  3MGR A;  3AV1 C;  4NE5 A;  4WNN B;  5CP6 C;  3UTA D;  3EG5 B;  5B2I D;  3X1U A;  1P3I B;  1P3P C;  2BYK B;  2IO5 C;  3C1B C;  3UTB A;  1P3B A;  3C1C C;  3B6G B;  3MGQ C;  4WU9 B;  3W96 C;  1U35 B;  4J8X D;  3R45 B;  3AZK B;  1BH9 A;  3B6F B;  5B31 B;  3LZ0 B;  5AVC B;  5AV8 C;  3VH5 T;  5DNM D;  1H3O A;  4NE3 A;  4CSR A;  3H0R C;  3AYW A;  2Y2J A;  3AFA B;  3MGR B;  3X1S A;  3MNN C;  3AV2 C;  4E44 A;  1KX5 A;  1ID3 A;  2HUE C;  3AN2 A;  1S32 D;  4X23 A;  4J8V D;  4XUJ D;  2DF4 C;  3TU4 C;  3AZF D;  5JRG D;  3AZL A;  5CPJ C;  1P3L A;  4YM6 C;  2PYO D;  1W2E A;  2XD1 A;  3REL C;  3UTB B;  3O62 A;  1P3B B;  2JE5 A;  5DNN C;  3MVD D;  3UT9 C;  4H9S C;  3VH6 W;  3REI D;  3AZH C;  1BH9 B;  2F8N G;  2Y2O A;  5B0Z C;  3AZM A;  3B0D C;  4WU8 A;  1F66 A;  4KGC C;  4ZUX D;  3MGP C;  2NZD C;  5CPK A;  3LEL D;  3WKJ C;  3KFU G;  1H3O B;  1WWS A;  3LJA A;  3WTP A;  1ZLA C;  3AZE D;  4J8U D;  2CV5 A;  4CSR B;  1KX4 A;  3KXB B;  3AYW B;  1BFM A;  3EPK A;  4G91 B;  1KX5 B;  2YFV B;  1ID3 B;  3AN2 B;  3B6G C;  4X23 B;  3AZL B;  5GXQ A;  1U35 C;  2BG1 A;  4Z2M H;  1M18 B;  3O62 B;  1P3O D;  5AVB D;  3B6F C;  3VH6 A;  5B31 C;  3LZ0 C;  5AVC C;  2ARO A;  4JJN D;  3AZM B;  2FJ7 A;  4KHA A;  3AV1 D;  3EPJ A;  5CP6 D;  4H9P A;  1HTA A;  4ZBJ C;  4EO5 B;  1HQ3 D;  5B2J C;  5CPK B;  5AV5 A;  1A7W A;  3AFA C;  3MGR C;  3C1B D;  3H0M C;  1P3G B;  2NQB A;  3X1U C;  3LJA B;  3WTP B;  1P3K A;  4J8W A;  2CV5 B;  1KX4 B;  2ZY2 A;  3MGQ D;  3W96 D;  3W97 D;  1P3P B;  2HIO D;  1P3M A;  3UTB C;  1M19 D;  5GT0 A;  1PZR A;  1P3B C;  5GXQ B;  2Y2G A;  3X1T A;  3C1C B;  4NFT A;  2Y2P A;  5BO0 B;  5AV6 A;  1P34 A;  5AV8 D;  5B32 A;  5B33 A;  2W8S A;  5BT1 D;  5B24 A;  3NQJ B;  5GSU D;  3X1V A;  2ARO B;  4Z5T A;  4H9R A;  2FJ7 B;  4KHA B;  3MNN D;  3AV2 D;  4Z66 A;  4LD9 D;  3AZJ A;  3AYW C;  5AV5 B;  3V9R A;  5CPJ D;  3X1S C;  4G91 C;  4YM6 D;  2NQB B;  1KX5 C;  1ID3 C;  3REL D;  5B0Y D;  4UPK A;  3KUY A;  3A1K A;  5DNN D;  5C3I C;  4X23 C;  4J8W B;  3AZL C;  3AN2 C;  1AOI D;  1P3L C;  2Y2Q A;  1P3M B;  3TU4 B;  3O62 C;  2BYM A;  5B0Z D;  5AV9 A;  3X1T B;  3AZN D;  3WAA A;  4KGC D;  3MGP D;  2NZD D;  1P34 B;  3WKJ D;  2UWX A;  4UUZ A;  5GT3 A;  5B32 B;  5B33 B;  3AZM C;  3AZG A;  5B24 B;  4WU8 C;  1F66 C;  1P3I D;  4EO5 C;  3X1V B;  5CPK C;  3WA9 A;  5B40 A;  4Z5T B;  4H9R B;  3LJA C;  3WTP C;  4Z66 B;  2CV5 C;  1KX4 C;  3B6G D;  4WU9 D;  3V9R B;  1ZLA B;  4KUD A;  1WWI A;  1U35 D;  1M1A A;  3KUY B;  3AZK D;  2RVQ C;  2Y2M A;  5GXQ C;  5B31 G;  3EPH A;  3B6F D;  5B31 D;  2BYM B;  3LZ0 D;  3LZ1 A;  5B1L A;  3NQU A;  5AV9 B;  4G92 B;  3WAA B;  4M6B A;  2ARO C;  4UUZ B;  1JFI A;  5BS7 A;  3AFA D;  3MGR D;  2FJ7 C;  4Z2M G;  3WA9 B;  5B40 B;  5AV5 C;  2NQB C;  5B2J B;  4ZBJ B;  3UTB D;  1P3K C;  4J8W C;  1P3B D;  3X1U B;  4KUD B;  1P3M C;  1M1A B;  5GT0 C;  1Q9C A;  3AZF A;  4XUJ A;  3B0C W;  3X1T C;  4E45 A;  4HGA B;  3MGS A;  5AV6 C;  1F1E A;  1P34 C;  3LZ1 B;  5B32 C;  5B33 C;  5B1L B;  3NQU B;  5B24 C;  2YFW A;  3H0L C;  3REI A;  3X1V C;  3KXB D;  3AYW D;  4Z5T C;  3REK D;  1JFI B;  1KX5 D;  4Z66 C;  2F8N A;  3AZJ C;  4AWL B;  3AN2 D;  4X23 D;  3AZL D;  1M18 D;  3O62 D;  3KUY C;  4J8U A;  3X1S B;  3W99 A;  3B0B A;  2ZY3 A;  5C3I B; 
#chains in the Genus database with same CATH homology
 4DRA A;  1P3L B;  1BH8 A;  3AZF B;  5AV9 C;  4G92 C;  3MGS B;  3WAA C;  1P3O A;  5B1M C;  1KX3 A;  5F99 D;  5GT3 C;  5CPI A;  4R8P A;  5JA4 A;  3AZG C;  1P3G D;  4QLC A;  4H9N A;  3LJA D;  3WTP D;  2YFW B;  3WA9 C;  4JJN A;  5B40 C;  4WU8 B;  1F66 B;  1P3P D;  1EQZ A;  2F8N B;  5G49 A;  1HQ3 A;  5AY8 A;  5GXQ D;  2DQN C;  4KUD C;  1N1J A;  3C1C D;  1M1A C;  5BNV A;  2VQR A;  4J8U B;  2L5A A;  3W97 A;  3W99 B;  4HGA C;  1M19 A;  1P3F A;  5FUG A;  2ARO D;  3LZ1 C;  5B1L C;  1P3A A;  2FJ7 D;  4XZQ A;  1Z2C B;  1P3O B;  4YS3 A;  1KX3 B;  5AV5 D;  5BS7 C;  4R8P B;  5CPI B;  2NQB D;  4QLC B;  3IP4 C;  4H9N B;  2CWE A;  3W98 A;  5GSU A;  4AWL C;  4J8W D;  4H9P B;  3VH6 T;  1P3M D;  3AZI A;  3TU4 D;  1EQZ B;  4LD9 A;  2F8N H;  5G49 B;  5AY8 B;  5E5A A;  2ZM5 A;  2JCH A;  1P3K B;  1TZY A;  3X1T D;  1N1J B;  3VH5 W;  5B0Y A;  1P34 D;  1AOI A;  3A6N A;  4XUJ C;  3UT9 D;  3AZF C;  5B33 D;  3W97 B;  5GT0 B;  3AZH D;  2J8P A;  3MGS C;  1P3F B;  5FUG B;  1B67 A;  3REJ A;  3X1V D;  4Z5T D;  1P3A B;  4XZQ B;  5B1M A;  5AV6 B;  3AZN A;  3REI C;  2Y2H A;  4CAY A;  4YS3 B;  3REH A;  4NE6 A;  1B6W A;  1ZLA D;  3KWQ A;  3W98 B;  1P3I A;  3KUY D;  3AZJ B;  2G5H C;  3AZI B;  3AZE C;  4J8U C;  5BNX A;  3UTA A;  5B2I A;  4WU9 A;  3W99 C;  5E5A B;  5AV9 D;  1TZY B;  3VH5 A;  3WAA D;  3AZK A;  3A6N B;  1T3U A;  5AVC D;  1P3O C;  1KX3 C;  3REJ B;  3WA9 D;  5B40 D;  4J8X A;  5CPI C;  4R8P C;  4H9O A;  4QLC C;  5B1M B;  5B2J D;  5GT3 B;  4CAY B;  3AZG B;  4JJN C;  3REH B;  3X1U D;  3KWQ B;  4KUD D;  1M1A D;  1ULY A;  1EQZ C;  5DNM A;  1HQ3 C;  5AY8 C;  2RIQ A;  2Y2N A;  3F6T A;  4DRB A;  5BNX B;  3LZ1 D;  5B2I B;  3EPL A;  5B1L D;  3UTA B;  3W97 C;  1S32 A;  2HIO C;  4J8V A;  4WJ3 C;  1M19 C;  2PYO A;  5JRG A;  1P3F C;  1P3A C;  4XZQ C;  5CHL B;  4YS3 C;  3MVD A;  4J8X B;  4H9O B;  5BT1 C;  3W98 C;  5GSU C;  2F2A C;  3X1S D;  3KXB A;  3REK A;  1ID3 D;  4ZUX A;  3LEL A;  2YFV A;  3AZI C;  4LD9 C;  5DNM B;  1P3L D;  5E5A C;  3AZE A;  1TZY C;  3MGS D;  5B0Y C;  1M18 A;  1AOI C;  2Y2I A;  4WZS B;  3A6N C;  1S32 B;  4J8V B;  4XUJ B;  2PYO B;  5JRG B;  3AZM D;  3REJ C;  4DQY B;  4WU8 D;  1F66 D;  5CPK D;  3AZN C;  3A1I A;  5AVB A;  2F8N D;  3MVD B;  3REH C;  3P5J B;  5F99 A;  3REI B;  3AL0 C;  3KWQ C;  2CV5 D;  1P3G A;  1KX4 D;  1P3I C;  3AV1 A;  5CP6 A;  1R4V A;  3REK B;  3W99 D;  1P3P A;  4ZUX B;  3LEL B;  2RVQ D;  3C1B A;  3KSY A;  3UTA C;  4WU9 C;  5B2I C;  3AZE B;  3C1C A;  3MGQ A;  3W96 A;  5BO0 A;  3AZK C;  1KX3 D;  2HIO A;  2JSS A;  5CPI D;  4R8P D;  4QLC D;  1BH8 B;  3NQJ A;  2G5I C;  4J8X C;  4H9Q A;  5AV8 A;  2FFF B;  1EQZ D;  5AVB B;  5JA4 B;  5AY8 D;  3WTP E;  5F99 B;  3B0C T;  1KU5 A;  1P3K D;  4JJN B;  5DNM C;  4WV4 B;  3AV1 B;  3MNN A;  5KDM A;  3AV2 A;  5CP6 B;  5GT0 D;  1HQ3 B;  3TU4 A;  2Y2K A;  5CPJ A;  2IO5 B;  3C1B B;  1P3F D;  4YM6 A;  5B32 G;  1P3A D;  5BNV B;  3REL A;  4XZQ D;  1S32 C;  5DNN A;  5AV6 D;  4J8V C;  3MGQ B;  2PYO C;  5B32 D;  5JRG C;  3W96 B;  4YS3 D;  3UT9 A;  4H9S A;  2HIO B;  5B24 D;  1M19 B;  3AZH A;  1TAF A;  3W98 D;  5B0Z A;  3MVD C;  2XD5 A;  4Z66 D;  4KGC A;  4H9Q B;  3MGP A;  3AZJ D;  2NZD A;  5AV8 B;  3WKJ A;  3AZI D;  4WNN A;  3KXB C;  3REK C;  5E5A D;  1ZLA A;  2ZY4 A;  5GSU B;  4ZUX C;  1TZY D;  3LEL C;  2BYK A;  3MNN B;  5KDM B;  3A6N D;  3AV2 B;  2F8N K;  4LD9 B;  2HUE B;  3B6G A;  1M18 C;  5CPJ B;  3REJ D;  4YM6 B;  1U35 A;  3REL B;  5B0Y B;  3R45 A;  5B1M D;  5DNN B;  2Y2L A;  2LY8 A;  1AOI B;  5GT3 D;  3AZG D;  3FDD A;  3REH D;  3UT9 B;  3B6F A;  5B31 A;  3AZH B;  3LZ0 A;  5AVC A;  3KWQ D;  1TAF B;  5AVB C;  5B0Z B;  3B0D B;  5F99 C;  3AZN B;  4KGC B;  3MGP B;  2ZY5 A;  5B2J A;  1P3G C;  2NZD B;  3WKJ B;  3AFA A;  3MGR A;  3AV1 C;  4NE5 A;  4WNN B;  5CP6 C;  3UTA D;  3EG5 B;  5B2I D;  3X1U A;  1P3I B;  1P3P C;  2BYK B;  2IO5 C;  3C1B C;  3UTB A;  1P3B A;  3C1C C;  3B6G B;  3MGQ C;  4WU9 B;  3W96 C;  1U35 B;  4J8X D;  3R45 B;  3AZK B;  1BH9 A;  3B6F B;  5B31 B;  3LZ0 B;  5AVC B;  5AV8 C;  3VH5 T;  5DNM D;  1H3O A;  4NE3 A;  4CSR A;  3H0R C;  3AYW A;  2Y2J A;  3AFA B;  3MGR B;  3X1S A;  3MNN C;  3AV2 C;  4E44 A;  1KX5 A;  1ID3 A;  2HUE C;  3AN2 A;  1S32 D;  4X23 A;  4J8V D;  4XUJ D;  2DF4 C;  3TU4 C;  3AZF D;  5JRG D;  3AZL A;  5CPJ C;  1P3L A;  4YM6 C;  2PYO D;  1W2E A;  2XD1 A;  3REL C;  3UTB B;  3O62 A;  1P3B B;  2JE5 A;  5DNN C;  3MVD D;  3UT9 C;  4H9S C;  3VH6 W;  3REI D;  3AZH C;  1BH9 B;  2F8N G;  2Y2O A;  5B0Z C;  3AZM A;  3B0D C;  4WU8 A;  1F66 A;  4KGC C;  4ZUX D;  3MGP C;  2NZD C;  5CPK A;  3LEL D;  3WKJ C;  3KFU G;  1H3O B;  1WWS A;  3LJA A;  3WTP A;  1ZLA C;  3AZE D;  4J8U D;  2CV5 A;  4CSR B;  1KX4 A;  3KXB B;  3AYW B;  1BFM A;  3EPK A;  4G91 B;  1KX5 B;  2YFV B;  1ID3 B;  3AN2 B;  3B6G C;  4X23 B;  3AZL B;  5GXQ A;  1U35 C;  2BG1 A;  4Z2M H;  1M18 B;  3O62 B;  1P3O D;  5AVB D;  3B6F C;  3VH6 A;  5B31 C;  3LZ0 C;  5AVC C;  2ARO A;  4JJN D;  3AZM B;  2FJ7 A;  4KHA A;  3AV1 D;  3EPJ A;  5CP6 D;  4H9P A;  1HTA A;  4ZBJ C;  4EO5 B;  1HQ3 D;  5B2J C;  5CPK B;  5AV5 A;  1A7W A;  3AFA C;  3MGR C;  3C1B D;  3H0M C;  1P3G B;  2NQB A;  3X1U C;  3LJA B;  3WTP B;  1P3K A;  4J8W A;  2CV5 B;  1KX4 B;  2ZY2 A;  3MGQ D;  3W96 D;  3W97 D;  1P3P B;  2HIO D;  1P3M A;  3UTB C;  1M19 D;  5GT0 A;  1PZR A;  1P3B C;  5GXQ B;  2Y2G A;  3X1T A;  3C1C B;  4NFT A;  2Y2P A;  5BO0 B;  5AV6 A;  1P34 A;  5AV8 D;  5B32 A;  5B33 A;  2W8S A;  5BT1 D;  5B24 A;  3NQJ B;  5GSU D;  3X1V A;  2ARO B;  4Z5T A;  4H9R A;  2FJ7 B;  4KHA B;  3MNN D;  3AV2 D;  4Z66 A;  4LD9 D;  3AZJ A;  3AYW C;  5AV5 B;  3V9R A;  5CPJ D;  3X1S C;  4G91 C;  4YM6 D;  2NQB B;  1KX5 C;  1ID3 C;  3REL D;  5B0Y D;  4UPK A;  3KUY A;  3A1K A;  5DNN D;  5C3I C;  4X23 C;  4J8W B;  3AZL C;  3AN2 C;  1AOI D;  1P3L C;  2Y2Q A;  1P3M B;  3TU4 B;  3O62 C;  2BYM A;  5B0Z D;  5AV9 A;  3X1T B;  3AZN D;  3WAA A;  4KGC D;  3MGP D;  2NZD D;  1P34 B;  3WKJ D;  2UWX A;  4UUZ A;  5GT3 A;  5B32 B;  5B33 B;  3AZM C;  3AZG A;  5B24 B;  4WU8 C;  1F66 C;  1P3I D;  4EO5 C;  3X1V B;  5CPK C;  3WA9 A;  5B40 A;  4Z5T B;  4H9R B;  3LJA C;  3WTP C;  4Z66 B;  2CV5 C;  1KX4 C;  3B6G D;  4WU9 D;  3V9R B;  1ZLA B;  4KUD A;  1WWI A;  1U35 D;  1M1A A;  3KUY B;  3AZK D;  2RVQ C;  2Y2M A;  5GXQ C;  5B31 G;  3EPH A;  3B6F D;  5B31 D;  2BYM B;  3LZ0 D;  3LZ1 A;  5B1L A;  3NQU A;  5AV9 B;  4G92 B;  3WAA B;  4M6B A;  2ARO C;  4UUZ B;  1JFI A;  5BS7 A;  3AFA D;  3MGR D;  2FJ7 C;  4Z2M G;  3WA9 B;  5B40 B;  5AV5 C;  2NQB C;  5B2J B;  4ZBJ B;  3UTB D;  1P3K C;  4J8W C;  1P3B D;  3X1U B;  4KUD B;  1P3M C;  1M1A B;  5GT0 C;  1Q9C A;  3AZF A;  4XUJ A;  3B0C W;  3X1T C;  4E45 A;  4HGA B;  3MGS A;  5AV6 C;  1F1E A;  1P34 C;  3LZ1 B;  5B32 C;  5B33 C;  5B1L B;  3NQU B;  5B24 C;  2YFW A;  3H0L C;  3REI A;  3X1V C;  3KXB D;  3AYW D;  4Z5T C;  3REK D;  1JFI B;  1KX5 D;  4Z66 C;  2F8N A;  3AZJ C;  4AWL B;  3AN2 D;  4X23 D;  3AZL D;  1M18 D;  3O62 D;  3KUY C;  4J8U A;  3X1S B;  3W99 A;  3B0B A;  2ZY3 A;  5C3I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...