4LD9C

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
RAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 21
structure length 98
sequence length 98
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9C00
3W98B 2IO5C 5B0YB 5AV5B 4Z2MH 5B2IC 3MNNC 5BO0A 1P3IA 4J8UD 1U35A 5BT1C 2NZDA 3UTAC 2BYKB 3AZLC 1HQ3B 5B32D 3TU4C 1S32C 3REHD 1P3LD 1TZYD 2FJ7B 5CPIC 4J8XD 1JFIB 3REKD 3AZJA 3X1SC 3LZ0B 5GXQC 3AV2C 3KXBD 1U35B 1KX4A 2NZDB 4H9PB 3MGRB 3LZ1B 4NE3A 5B2ID 3MNND 5G49B 5B40B 5AV9C 3C1BB 4J8VD 1P3PD 3MGSB 4X23B 5BT1D 1P3LA 4YM6C 5E5AA 1TZYA 3AZLD 3TU4D 5CP6A 1S32D 1P3AA 5CPID 3X1UA 3UTBB 3X1VC 3O62B 2CV5C 1P3MA 3R45A 5B31A 5DNNA 5CPJA 1P3OA 2YFWB 3X1SD 4H9QB 3B6GC 3V9RB 5GXQD 3REIB 3AV2D 3UT9B 5GT3B 5BNXA 5B24A 4WU9B 3AZEB 4G91C 2NQBB 1P3PA 4J8VA 3AYWB 3AFAA 5AVCC 5AV9D 4M6BA 4WV4B 3B6FA 1P34A 5F99B 3AZMB 2BYMB 1M19C 1TAFB 2CV5D 3X1VD 3WA9A 4XUJB 1KX3B 5JRGB 4LD9C 3B6GD 3AFAB 2HIOB 1N1JB 4HGAB 1F1EA 3W96C 4KHAA 3RELA 2F8NH 3AN2A 5B32G 3LJAC 4QLCB 4YS3C 3WA9B 4WU8D 3MVDC 4EO5B 4ZUXA 3W99D 3A6NA 1M19D 2AROA 3AZNB 5AV8C 1F66C 3B6GA 5GSUB 4LD9D 2HUEB 1M18A 1P3GC 1B67A 3W96D 3AZFC 5AV6A 3KWQB 4WU8A 3LJAD 3AV1C 3KUYB 4YS3D 4JJND 1BH9A 3MVDD 3W98C 3AZKC 5B0YC 3W99A 5AV5C 3MGQB 1AOIA 3NQJA 2JSSA 3AZHD 5BS7A 5CPKB 1HQ3C 5AV8D 4R8PB 1F66D 2FJ7C 1P3GD 1ZLAB 3REJB 1EQZA 4KUDC 3AZGB 4WNNB 3AZFD 3LZ0C 4JJNA 3AV1D 3MGRC 5B0ZA 3W98D 4CAYA 3LZ1C 5B1LA 4XZQC 3AZKD 5B0YD 5AV5D 3AZHA 5B40C 2RVQC 3C1BC 1KX5C 3MGSC 4X23C 1HQ3D 3C1CA 4ZBJB 1ULYA 3W97A 3WAAC 3UTBC 3O62C 5B2JB 5AY8D 5GT0B 5DNMB 4KUDD 5AVBA 4Z5TA 3VH6A 5FUGA 5KDMB 3LZ0D 1P3KB 4KGCD 4UUZA 4J8WA 3UT9C 5GT3C 3WTPA 4WU9C 3MGRD 3AZEC 3LZ1D 1ID3B 4XZQD 1P3FC 4AWLB 2NQBC 3MGPB 3AYWC 5B33B 2PYOB 5B40D 5B1MD 3C1BD 1KX5D 3MGSD 4X23D 3X1TA 3LELA 4H9NA 5F99C 5BO0B 3AZMC 1P3IB 3B0CT 4UUZB 5AY8A 3WAAD 5C3IB 3UTBD 3O62D 4KUDA 4XUJC 1WWSA 1KX3C 3KSYA 5JRGC 4J8UA 4KGCA 2HIOC 1WWIA 4HGAC 5B32A 3REHA 4H9RA 3AZJB 3UTAD 3UT9D 4Z2MG 4XZQA 4WU9D 4J8XA 3AZED 3VH5T 1P3FD 4H9SC 5B1MA 3AYWD 2F8ND 1KX4B 4QLCC 3REKA 2NQBD 2F8NK 3KXBA 4Z66C 4EO5C 3AZMD 3WKJC 1P3LB 4G92B 5E5AB 1TZYB 4XUJD 3AZNC 5B2IA 5CP6B 3MNNA 1P3AB 1KX3D 5JRGD 5GSUC 4NFTA 3X1UB 1P3MB 2HUEC 3R45B 5B31B 3UTAA 3AZLA 2HIOD 5DNNB 3TU4A 5CPJB 1S32A 1P3OB 4YM6D 1M1AC 1P3FA 5CPIA 2F8NA 3KWQC 3KUYC 4QLCD 5BNXB 3X1SA 5B24B 5GXQA 4J8VB 1P3PB 3AV2A 4Z66D 3MGQC 1P3BC 3WKJD 3B0CW 3B6FB 3AZND 1P34B 5CPKC 2YFVA 4R8PC 5AV9A 5BNVA 5GSUD 4WZSB 5AVCD 4YM6A 1ZLAC 3REJC 1M1AD 3AZGC 2CV5A 3X1VA 3KWQD 4CSRA 3VH5W 4KHAB 3KUYD 5JA4A 3RELB 3AN2B 1HTAA 5AV9B 4H9OA 3MGQD 1P3BD 4ZUXB 5CPKD 3A6NB 5AVCA 4ZBJC 4R8PD 1H3OA 3AZIC 2AROB 5B2JC 2L5AA 2F8NG 5GT0C 1ZLAD 3REJD 5DNMC 3B6GB 3AZGD 1M19A 1M18B 1P3KC 4LD9A 5AV6B 1ID3C 4WU8B 4AWLC 3MGPC 5B33C 3NQUA 2PYOC 3W96A 1BH9B 3W99B 3LJAA 1P3IC 4YS3A 1AOIB 3NQJB 3MVDA 1U35C 2NZDC 5C3IC 3AZID 5B2JD 5GT0D 5DNMD 4NE6A 1BH8A 4E44A 1P3KD 1EQZB 5AV8A 1F66A 3LJAB 1ID3D 4JJNB 2FJ7D 1P3GA 3MGPD 1KX4C 5B33D 2PYOD 3B0DB 5B0ZB 4CAYB 1Q9CA 3AZFA 5B1LB 4E45A 3AZHB 3AV1A 1P3ID 1TAFA 3REIC 1U35D 1P3LC 3W98A 2NZDD 5CHLB 4G92C 4NE5A 1TZYC 5E5AC 5AV5A 5B0YA 3C1CB 3AZKA 5CP6C 1P3AC 3W97B 3X1UC 1P3MC 2RVQD 5B31C 2BYKA 1HQ3A 5DNNC 5CPJC 1P3OC 5AVBB 4Z5TB 2FJ7A 5FUGB 1JFIA 4J8WB 1KX4D 3WTPB 5B24C 1KU5A 3AZKB 3LZ0A 1P3PC 4J8VC 3AFAC 3REID 4H9PA 3MGRA 3X1TB 3LZ1A 3LELB 5GT3D 3B6FC 5E5AD 4H9NB 1P34C 4DRAA 5CP6D 5G49A 1P3AD 5B40A 3C1BA 5AY8B 1KX5A 3X1UD 3MGSA 4X23A 1P3MD 3WA9C 4KUDB 5B31D 5CPJD 5DNND 1P3OD 4J8UB 3VH6T 4KGCB 5F99D 3AZIB 3WAAA 3UTBA 3O62A 5B32B 3REHB 4H9RB 2YFWA 4XZQB 5B24D 3RELC 4H9QA 4J8XB 3AN2C 3V9RA 5B1MB 2CWEA 3REIA 1KX5B 3AFAD 3REKB 3UT9A 5GT3A 4WU9A 3AZEA 3B6FD 2NQBA 3KXBB 1P34D 4ZUXC 3AYWA 3A6NC 3WAAB 3WTPE 2AROC 2IO5B 3WA9D 5B2IB 3MNNB 5F99A 3AZMA 2LY8A 2BYMA 1M18C 3UTAB 3AZLB 4XUJA 3TU4B 1S32B 1KX3A 5JRGA 1P3FB 5CPIB 3RELD 2F8NB 5AV6C 3AN2D 4WU8C 2HIOA 1N1JA 3X1SB 3W99C 5GXQB 3AV2B 4H9SA 4ZUXD 4QLCA 3A6ND 1AOIC 2PYOA 5BS7C 2AROD 1R4VA 4Z66A 2YFVB 3WKJA 5BNVB 1B6WA 3VH6W 1M18D 4YM6B 3AZNA 1EQZC 4DRBA 5GSUA 2CV5B 3X1VB 5AV6D 4JJNC 4CSRB 1M1AA 1BFMA 5JA4B 3B0DC 5B0ZC 4Z66B 5B1LC 3WKJB 5B31G 3KWQA 4H9OB 3AZHC 3KUYA 1AOID 4G91B 3C1CC 5AVCB 3MGQA 1P3BA 3W97C 3B0BA 1H3OB 1M1AB 5CPKA 1EQZD 4R8PA 5AVBC 4Z5TC 1M19B 1A7WA 1ZLAA 3REJA 4J8WC 3WTPC 3AZGA 4LD9B 5B0ZD 4WNNA 5B1LD 1P3BB 3NQUB 3W96B 3AZJC 3X1TC 3LELC 3C1CD 4YS3B 3W97D 3MVDB 5AY8C 1BH8B 4J8UC 5AVBD 4Z5TD 4KGCC 3AZIA 5B2JA 5B32C 5GT0A 5AV8B 3REHC 5DNMA 4J8WD 1F66B 3WTPD 4J8XC 5KDMA 1P3KA 1P3GB 5B1MC 3REKC 3AZFB 3AZJD 3X1TD 3LELD 1ID3A 3KXBC 3MGPA 3AV1B 5B33A 3VH5A
chains in the Genus database with same CATH superfamily
3W98B 2ZM5A 2IO5C 5B0YB 5AV5B 4Z2MH 5B2IC 3MNNC 5BO0A 1P3IA 4J8UD 2J8PA 1U35A 5BT1C 2NZDA 3UTAC 2BYKB 3AZLC 1HQ3B 5B32D 3TU4C 1S32C 3REHD 2Y2JA 1P3LD 1TZYD 2FJ7B 5CPIC 4J8XD 1JFIB 3REKD 3AZJA 3X1SC 1Z2CB 3LZ0B 5GXQC 3AV2C 3KXBD 1U35B 1KX4A 2NZDB 4H9PB 3MGRB 3LZ1B 4NE3A 5B2ID 3MNND 5G49B 5B40B 5AV9C 3C1BB 4J8VD 1P3PD 3MGSB 4X23B 5BT1D 1P3LA 4YM6C 5E5AA 1TZYA 3AZLD 3TU4D 5CP6A 1S32D 1P3AA 5CPID 3X1UA 3UTBB 2ZY2A 3X1VC 3O62B 2CV5C 3R45A 1P3MA 2UWXA 5B31A 5DNNA 5CPJA 1P3OA 2YFWB 3X1SD 4H9QB 3B6GC 3V9RB 5GXQD 3REIB 3AV2D 3UT9B 5GT3B 5BNXA 5B24A 4WU9B 2G5IC 3AZEB 4G91C 2NQBB 1P3PA 4J8VA 3AYWB 3AFAA 5AVCC 5AV9D 4M6BA 4WV4B 3B6FA 1P34A 5F99B 3AZMB 2BYMB 1M19C 1TAFB 2CV5D 3X1VD 3WA9A 4XUJB 1KX3B 5JRGB 4LD9C 3B6GD 3AFAB 2HIOB 1N1JB 4HGAB 1F1EA 3W96C 4KHAA 3IP4C 3RELA 2F8NH 3AN2A 5B32G 3LJAC 4QLCB 4YS3C 3WA9B 4WU8D 3MVDC 2ZY4A 4EO5B 4ZUXA 3W99D 3A6NA 1M19D 2AROA 3AL0C 3AZNB 5AV8C 1F66C 3B6GA 5GSUB 4LD9D 2HUEB 1M18A 1P3GC 1B67A 3W96D 2RIQA 3AZFC 5AV6A 3KWQB 4WU8A 3LJAD 3AV1C 3KUYB 4YS3D 4JJND 1BH9A 3MVDD 3W98C 3AZKC 1T3UA 5B0YC 5AV5C 3W99A 3MGQB 1AOIA 3NQJA 2JSSA 3AZHD 5BS7A 5CPKB 1HQ3C 5AV8D 4R8PB 1F66D 2FJ7C 2G5HC 1P3GD 1ZLAB 3REJB 1EQZA 4KUDC 3AZGB 4WNNB 3AZFD 3EPJA 3LZ0C 4JJNA 3AV1D 2Y2QA 3H0LC 3MGRC 5B0ZA 3W98D 4CAYA 3LZ1C 5B1LA 4XZQC 2Y2HA 5B0YD 3AZKD 5AV5D 3AZHA 5B40C 2RVQC 3C1BC 3A1IA 1KX5C 3MGSC 4X23C 1HQ3D 3C1CA 4ZBJB 1ULYA 3W97A 3WAAC 3UTBC 2DF4C 5B2JB 3O62C 4WJ3C 5AY8D 5GT0B 5DNMB 4KUDD 5AVBA 4Z5TA 3VH6A 5FUGA 5KDMB 3LZ0D 1P3KB 4KGCD 4UUZA 2FFFB 4J8WA 3UT9C 5GT3C 3WTPA 4WU9C 3MGRD 3AZEC 3LZ1D 1ID3B 4XZQD 1P3FC 4AWLB 2NQBC 3KFUG 3MGPB 3AYWC 5B33B 2PYOB 5B40D 5B1MD 3C1BD 1KX5D 3MGSD 4X23D 3X1TA 3LELA 4H9NA 5F99C 5BO0B 3AZMC 1P3IB 3B0CT 4UUZB 5AY8A 3WAAD 5C3IB 3UTBD 3O62D 1W2EA 4XUJC 4KUDA 3H0RC 1WWSA 1KX3C 3KSYA 5JRGC 4J8UA 4KGCA 2HIOC 1WWIA 4HGAC 5B32A 3REHA 4H9RA 3AZJB 3UTAD 3UT9D 4Z2MG 4XZQA 4WU9D 4UPKA 4J8XA 3AZED 3VH5T 1P3FD 4H9SC 5B1MA 3AYWD 2F8ND 1KX4B 4QLCC 3REKA 3EG5B 2F8NK 3KXBA 4Z66C 4EO5C 3AZMD 3WKJC 1P3LB 4G92B 5E5AB 1TZYB 4XUJD 3AZNC 5B2IA 5CP6B 3MNNA 1P3AB 1KX3D 5JRGD 5GSUC 4NFTA 3X1UB 1P3MB 2ZY3A 2HUEC 3R45B 5B31B 3UTAA 3AZLA 2HIOD 5DNNB 3TU4A 5CPJB 1S32A 1P3OB 4YM6D 3F6TA 1M1AC 1P3FA 5CPIA 2XD5A 3A1KA 2F8NA 3KWQC 2XD1A 3KUYC 4QLCD 5BNXB 3X1SA 5B24B 2Y2NA 5GXQA 4J8VB 1P3PB 3AV2A 4Z66D 3MGQC 1P3BC 3WKJD 3B0CW 3B6FB 3AZND 1P34B 5CPKC 2YFVA 4R8PC 2Y2PA 5AV9A 5BNVA 5GSUD 4WZSB 5AVCD 2ZY5A 4YM6A 1ZLAC 3REJC 1M1AD 3AZGC 2Y2GA 2CV5A 3X1VA 2DQNC 3KWQD 4CSRA 3VH5W 4KHAB 3KUYD 2VQRA 3FDDA 5JA4A 3RELB 3AN2B 1HTAA 5AV9B 4H9OA 3MGQD 1P3BD 2F2AC 4ZUXB 5CPKD 3A6NB 5AVCA 4ZBJC 4R8PD 1H3OA 3AZIC 2AROB 5B2JC 2L5AA 2F8NG 5GT0C 1ZLAD 3REJD 5DNMC 3B6GB 3AZGD 3H0MC 3EPLA 1M19A 1M18B 1P3KC 4LD9A 2Y2KA 5AV6B 1ID3C 4WU8B 4AWLC 3MGPC 5B33C 2BG1A 3NQUA 2PYOC 3W96A 1BH9B 3W99B 3LJAA 1P3IC 4YS3A 1AOIB 3NQJB 3MVDA 1U35C 2NZDC 5C3IC 3AZID 5B2JD 5GT0D 5DNMD 4NE6A 1BH8A 4E44A 1P3KD 1EQZB 5AV8A 1F66A 3LJAB 2NQBD 1ID3D 4JJNB 2FJ7D 1P3GA 3MGPD 1KX4C 5B33D 2PYOD 3B0DB 5B0ZB 4CAYB 1Q9CA 3AZFA 5B1LB 4E45A 3EPKA 3AZHB 3AV1A 1P3ID 1TAFA 3REIC 1U35D 1P3LC 3W98A 2Y2OA 5CHLB 2NZDD 4G92C 4NE5A 1TZYC 5E5AC 5AV5A 5B0YA 3C1CB 2Y2MA 3AZKA 5CP6C 1P3AC 2JCHA 3W97B 3X1UC 1P3MC 2RVQD 5B31C 2BYKA 1HQ3A 5DNNC 5CPJC 1P3OC 5AVBB 4Z5TB 2FJ7A 5FUGB 1JFIA 4J8WB 1KX4D 3WTPB 5B24C 1KU5A 2JE5A 3AZKB 3LZ0A 1P3PC 4J8VC 3AFAC 3REID 4H9PA 3MGRA 3X1TB 3LZ1A 3LELB 5GT3D 3B6FC 3P5JB 4H9NB 5E5AD 1P34C 4DRAA 5CP6D 5G49A 1P3AD 5B40A 3C1BA 5AY8B 1KX5A 3X1UD 3MGSA 4X23A 1P3MD 3WA9C 4KUDB 5B31D 5CPJD 5DNND 1P3OD 4J8UB 3VH6T 4KGCB 5F99D 3AZIB 3WAAA 3UTBA 3O62A 5B32B 3REHB 4H9RB 2YFWA 4XZQB 5B24D 3RELC 4H9QA 4J8XB 3AN2C 3V9RA 5B1MB 2CWEA 3REIA 1KX5B 3AFAD 3REKB 3UT9A 5GT3A 4WU9A 3AZEA 3B6FD 2NQBA 3KXBB 1P34D 4ZUXC 3AYWA 3A6NC 3WAAB 3WTPE 2AROC 2IO5B 3WA9D 5B2IB 3MNNB 5F99A 3AZMA 2LY8A 2BYMA 1M18C 3UTAB 3AZLB 4XUJA 3TU4B 1S32B 1KX3A 5JRGA 1P3FB 5CPIB 3RELD 2F8NB 5AV6C 3AN2D 4WU8C 2HIOA 1N1JA 3X1SB 3W99C 5GXQB 3AV2B 4H9SA 4ZUXD 4QLCA 3A6ND 1AOIC 2PYOA 5BS7C 2AROD 1R4VA 4Z66A 2YFVB 3WKJA 2Y2IA 5BNVB 1B6WA 3VH6W 1M18D 4YM6B 3AZNA 1EQZC 4DRBA 5GSUA 2CV5B 3X1VB 5AV6D 4JJNC 4CSRB 1PZRA 1M1AA 1BFMA 5JA4B 3B0DC 5B0ZC 4Z66B 5B1LC 3WKJB 5B31G 3KWQA 4H9OB 3AZHC 3KUYA 1AOID 4G91B 3C1CC 5AVCB 3MGQA 1P3BA 3W97C 3B0BA 1H3OB 1M1AB 5CPKA 1EQZD 4R8PA 5AVBC 4Z5TC 1M19B 1A7WA 1ZLAA 3REJA 4J8WC 3WTPC 3AZGA 4LD9B 5B0ZD 4WNNA 5B1LD 1P3BB 3NQUB 3W96B 3AZJC 3X1TC 3LELC 3C1CD 4YS3B 3W97D 3MVDB 5AY8C 2W8SA 1BH8B 4J8UC 5AVBD 4Z5TD 4KGCC 3AZIA 5B2JA 3EPHA 5B32C 5GT0A 5AV8B 3REHC 5DNMA 4J8WD 1F66B 3WTPD 2Y2LA 4J8XC 5KDMA 1P3KA 1P3GB 5B1MC 3REKC 4DQYB 3AZFB 3AZJD 3X1TD 3LELD 1ID3A 3KXBC 3MGPA 3AV1B 5B33A 3VH5A
chains in the Genus database with same CATH topology
3W98B 2ZM5A 2IO5C 5B0YB 5AV5B 4Z2MH 5B2IC 3MNNC 5BO0A 1P3IA 4J8UD 2J8PA 1U35A 5BT1C 2NZDA 3UTAC 2BYKB 3AZLC 1HQ3B 5B32D 3TU4C 1S32C 3REHD 2Y2JA 1P3LD 1TZYD 2FJ7B 5CPIC 4J8XD 1JFIB 3REKD 3AZJA 3X1SC 1Z2CB 3LZ0B 5GXQC 3AV2C 3KXBD 1U35B 1KX4A 2NZDB 4H9PB 3MGRB 3LZ1B 4NE3A 5B2ID 3MNND 5G49B 5B40B 5AV9C 3C1BB 4J8VD 1P3PD 3MGSB 4X23B 5BT1D 1P3LA 4YM6C 5E5AA 1TZYA 3AZLD 3TU4D 5CP6A 1S32D 1P3AA 5CPID 3X1UA 3UTBB 2ZY2A 3X1VC 3O62B 2CV5C 3R45A 1P3MA 2UWXA 5B31A 5DNNA 5CPJA 1P3OA 2YFWB 3X1SD 4H9QB 3B6GC 3V9RB 5GXQD 3REIB 3AV2D 3UT9B 5GT3B 5BNXA 5B24A 4WU9B 2G5IC 3AZEB 4G91C 2NQBB 1P3PA 4J8VA 3AYWB 3AFAA 5AVCC 5AV9D 4M6BA 4WV4B 3B6FA 1P34A 5F99B 3AZMB 2BYMB 1M19C 1TAFB 2CV5D 3X1VD 3WA9A 4XUJB 1KX3B 5JRGB 4LD9C 3B6GD 3AFAB 2HIOB 1N1JB 4HGAB 1F1EA 3W96C 4KHAA 3IP4C 3RELA 2F8NH 3AN2A 5B32G 3LJAC 4QLCB 4YS3C 3WA9B 4WU8D 3MVDC 2ZY4A 4EO5B 4ZUXA 3W99D 3A6NA 1M19D 2AROA 3AL0C 3AZNB 5AV8C 1F66C 3B6GA 5GSUB 4LD9D 2HUEB 1M18A 1P3GC 1B67A 3W96D 2RIQA 3AZFC 5AV6A 3KWQB 4WU8A 3LJAD 3AV1C 3KUYB 4YS3D 4JJND 1BH9A 3MVDD 3W98C 3AZKC 1T3UA 5B0YC 5AV5C 3W99A 3MGQB 1AOIA 3NQJA 2JSSA 3AZHD 5BS7A 5CPKB 1HQ3C 5AV8D 4R8PB 1F66D 2FJ7C 2G5HC 1P3GD 1ZLAB 3REJB 1EQZA 4KUDC 3AZGB 4WNNB 3AZFD 3EPJA 3LZ0C 4JJNA 3AV1D 2Y2QA 3H0LC 3MGRC 5B0ZA 3W98D 4CAYA 3LZ1C 5B1LA 4XZQC 2Y2HA 5B0YD 3AZKD 5AV5D 3AZHA 5B40C 2RVQC 3C1BC 3A1IA 1KX5C 3MGSC 4X23C 1HQ3D 3C1CA 4ZBJB 1ULYA 3W97A 3WAAC 3UTBC 2DF4C 5B2JB 3O62C 4WJ3C 5AY8D 5GT0B 5DNMB 4KUDD 5AVBA 4Z5TA 3VH6A 5FUGA 5KDMB 3LZ0D 1P3KB 4KGCD 4UUZA 2FFFB 4J8WA 3UT9C 5GT3C 3WTPA 4WU9C 3MGRD 3AZEC 3LZ1D 1ID3B 4XZQD 1P3FC 4AWLB 2NQBC 3KFUG 3MGPB 3AYWC 5B33B 2PYOB 5B40D 5B1MD 3C1BD 1KX5D 3MGSD 4X23D 3X1TA 3LELA 4H9NA 5F99C 5BO0B 3AZMC 1P3IB 3B0CT 4UUZB 5AY8A 3WAAD 5C3IB 3UTBD 3O62D 1W2EA 4XUJC 4KUDA 3H0RC 1WWSA 1KX3C 3KSYA 5JRGC 4J8UA 4KGCA 2HIOC 1WWIA 4HGAC 5B32A 3REHA 4H9RA 3AZJB 3UTAD 3UT9D 4Z2MG 4XZQA 4WU9D 4UPKA 4J8XA 3AZED 3VH5T 1P3FD 4H9SC 5B1MA 3AYWD 2F8ND 1KX4B 4QLCC 3REKA 3EG5B 2F8NK 3KXBA 4Z66C 4EO5C 3AZMD 3WKJC 1P3LB 4G92B 5E5AB 1TZYB 4XUJD 3AZNC 5B2IA 5CP6B 3MNNA 1P3AB 1KX3D 5JRGD 5GSUC 4NFTA 3X1UB 1P3MB 2ZY3A 2HUEC 3R45B 5B31B 3UTAA 3AZLA 2HIOD 5DNNB 3TU4A 5CPJB 1S32A 1P3OB 4YM6D 3F6TA 1M1AC 1P3FA 5CPIA 2XD5A 3A1KA 2F8NA 3KWQC 2XD1A 3KUYC 4QLCD 5BNXB 3X1SA 5B24B 2Y2NA 5GXQA 4J8VB 1P3PB 3AV2A 4Z66D 3MGQC 1P3BC 3WKJD 3B0CW 3B6FB 3AZND 1P34B 5CPKC 2YFVA 4R8PC 2Y2PA 5AV9A 5BNVA 5GSUD 4WZSB 5AVCD 2ZY5A 4YM6A 1ZLAC 3REJC 1M1AD 3AZGC 2Y2GA 2CV5A 3X1VA 2DQNC 3KWQD 4CSRA 3VH5W 4KHAB 3KUYD 2VQRA 3FDDA 5JA4A 3RELB 3AN2B 1HTAA 5AV9B 4H9OA 3MGQD 1P3BD 2F2AC 4ZUXB 5CPKD 3A6NB 5AVCA 4ZBJC 4R8PD 1H3OA 3AZIC 2AROB 5B2JC 2L5AA 2F8NG 5GT0C 1ZLAD 3REJD 5DNMC 3B6GB 3AZGD 3H0MC 3EPLA 1M19A 1M18B 1P3KC 4LD9A 2Y2KA 5AV6B 1ID3C 4WU8B 4AWLC 3MGPC 5B33C 2BG1A 3NQUA 2PYOC 3W96A 1BH9B 3W99B 3LJAA 1P3IC 4YS3A 1AOIB 3NQJB 3MVDA 1U35C 2NZDC 5C3IC 3AZID 5B2JD 5GT0D 5DNMD 4NE6A 1BH8A 4E44A 1P3KD 1EQZB 5AV8A 1F66A 3LJAB 2NQBD 1ID3D 4JJNB 2FJ7D 1P3GA 3MGPD 1KX4C 5B33D 2PYOD 3B0DB 5B0ZB 4CAYB 1Q9CA 3AZFA 5B1LB 4E45A 3EPKA 3AZHB 3AV1A 1P3ID 1TAFA 3REIC 1U35D 1P3LC 3W98A 2Y2OA 5CHLB 2NZDD 4G92C 4NE5A 1TZYC 5E5AC 5AV5A 5B0YA 3C1CB 2Y2MA 3AZKA 5CP6C 1P3AC 2JCHA 3W97B 3X1UC 1P3MC 2RVQD 5B31C 2BYKA 1HQ3A 5DNNC 5CPJC 1P3OC 5AVBB 4Z5TB 2FJ7A 5FUGB 1JFIA 4J8WB 1KX4D 3WTPB 5B24C 1KU5A 2JE5A 3AZKB 3LZ0A 1P3PC 4J8VC 3AFAC 3REID 4H9PA 3MGRA 3X1TB 3LZ1A 3LELB 5GT3D 3B6FC 3P5JB 4H9NB 5E5AD 1P34C 4DRAA 5CP6D 5G49A 1P3AD 5B40A 3C1BA 5AY8B 1KX5A 3X1UD 3MGSA 4X23A 1P3MD 3WA9C 4KUDB 5B31D 5CPJD 5DNND 1P3OD 4J8UB 3VH6T 4KGCB 5F99D 3AZIB 3WAAA 3UTBA 3O62A 5B32B 3REHB 4H9RB 2YFWA 4XZQB 5B24D 3RELC 4H9QA 4J8XB 3AN2C 3V9RA 5B1MB 2CWEA 3REIA 1KX5B 3AFAD 3REKB 3UT9A 5GT3A 4WU9A 3AZEA 3B6FD 2NQBA 3KXBB 1P34D 4ZUXC 3AYWA 3A6NC 3WAAB 3WTPE 2AROC 2IO5B 3WA9D 5B2IB 3MNNB 5F99A 3AZMA 2LY8A 2BYMA 1M18C 3UTAB 3AZLB 4XUJA 3TU4B 1S32B 1KX3A 5JRGA 1P3FB 5CPIB 3RELD 2F8NB 5AV6C 3AN2D 4WU8C 2HIOA 1N1JA 3X1SB 3W99C 5GXQB 3AV2B 4H9SA 4ZUXD 4QLCA 3A6ND 1AOIC 2PYOA 5BS7C 2AROD 1R4VA 4Z66A 2YFVB 3WKJA 2Y2IA 5BNVB 1B6WA 3VH6W 1M18D 4YM6B 3AZNA 1EQZC 4DRBA 5GSUA 2CV5B 3X1VB 5AV6D 4JJNC 4CSRB 1PZRA 1M1AA 1BFMA 5JA4B 3B0DC 5B0ZC 4Z66B 5B1LC 3WKJB 5B31G 3KWQA 4H9OB 3AZHC 3KUYA 1AOID 4G91B 3C1CC 5AVCB 3MGQA 1P3BA 3W97C 3B0BA 1H3OB 1M1AB 5CPKA 1EQZD 4R8PA 5AVBC 4Z5TC 1M19B 1A7WA 1ZLAA 3REJA 4J8WC 3WTPC 3AZGA 4LD9B 5B0ZD 4WNNA 5B1LD 1P3BB 3NQUB 3W96B 3AZJC 3X1TC 3LELC 3C1CD 4YS3B 3W97D 3MVDB 5AY8C 2W8SA 1BH8B 4J8UC 5AVBD 4Z5TD 4KGCC 3AZIA 5B2JA 3EPHA 5B32C 5GT0A 5AV8B 3REHC 5DNMA 4J8WD 1F66B 3WTPD 2Y2LA 4J8XC 5KDMA 1P3KA 1P3GB 5B1MC 3REKC 4DQYB 3AZFB 3AZJD 3X1TD 3LELD 1ID3A 3KXBC 3MGPA 3AV1B 5B33A 3VH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 B;  2IO5 C;  5B0Y B;  5AV5 B;  4Z2M H;  5B2I C;  3MNN C;  5BO0 A;  1P3I A;  4J8U D;  1U35 A;  5BT1 C;  2NZD A;  3UTA C;  2BYK B;  3AZL C;  1HQ3 B;  5B32 D;  3TU4 C;  1S32 C;  3REH D;  1P3L D;  1TZY D;  2FJ7 B;  5CPI C;  4J8X D;  1JFI B;  3REK D;  3AZJ A;  3X1S C;  3LZ0 B;  5GXQ C;  3AV2 C;  3KXB D;  1U35 B;  1KX4 A;  2NZD B;  4H9P B;  3MGR B;  3LZ1 B;  4NE3 A;  5B2I D;  3MNN D;  5G49 B;  5B40 B;  5AV9 C;  3C1B B;  4J8V D;  1P3P D;  3MGS B;  4X23 B;  5BT1 D;  1P3L A;  4YM6 C;  5E5A A;  1TZY A;  3AZL D;  3TU4 D;  5CP6 A;  1S32 D;  1P3A A;  5CPI D;  3X1U A;  3UTB B;  3X1V C;  3O62 B;  2CV5 C;  1P3M A;  3R45 A;  5B31 A;  5DNN A;  5CPJ A;  1P3O A;  2YFW B;  3X1S D;  4H9Q B;  3B6G C;  3V9R B;  5GXQ D;  3REI B;  3AV2 D;  3UT9 B;  5GT3 B;  5BNX A;  5B24 A;  4WU9 B;  3AZE B;  4G91 C;  2NQB B;  1P3P A;  4J8V A;  3AYW B;  3AFA A;  5AVC C;  5AV9 D;  4M6B A;  4WV4 B;  3B6F A;  1P34 A;  5F99 B;  3AZM B;  2BYM B;  1M19 C;  1TAF B;  2CV5 D;  3X1V D;  3WA9 A;  4XUJ B;  1KX3 B;  5JRG B;  4LD9 C;  3B6G D;  3AFA B;  2HIO B;  1N1J B;  4HGA B;  1F1E A;  3W96 C;  4KHA A;  3REL A;  2F8N H;  3AN2 A;  5B32 G;  3LJA C;  4QLC B;  4YS3 C;  3WA9 B;  4WU8 D;  3MVD C;  4EO5 B;  4ZUX A;  3W99 D;  3A6N A;  1M19 D;  2ARO A;  3AZN B;  5AV8 C;  1F66 C;  3B6G A;  5GSU B;  4LD9 D;  2HUE B;  1M18 A;  1P3G C;  1B67 A;  3W96 D;  3AZF C;  5AV6 A;  3KWQ B;  4WU8 A;  3LJA D;  3AV1 C;  3KUY B;  4YS3 D;  4JJN D;  1BH9 A;  3MVD D;  3W98 C;  3AZK C;  5B0Y C;  3W99 A;  5AV5 C;  3MGQ B;  1AOI A;  3NQJ A;  2JSS A;  3AZH D;  5BS7 A;  5CPK B;  1HQ3 C;  5AV8 D;  4R8P B;  1F66 D;  2FJ7 C;  1P3G D;  1ZLA B;  3REJ B;  1EQZ A;  4KUD C;  3AZG B;  4WNN B;  3AZF D;  3LZ0 C;  4JJN A;  3AV1 D;  3MGR C;  5B0Z A;  3W98 D;  4CAY A;  3LZ1 C;  5B1L A;  4XZQ C;  3AZK D;  5B0Y D;  5AV5 D;  3AZH A;  5B40 C;  2RVQ C;  3C1B C;  1KX5 C;  3MGS C;  4X23 C;  1HQ3 D;  3C1C A;  4ZBJ B;  1ULY A;  3W97 A;  3WAA C;  3UTB C;  3O62 C;  5B2J B;  5AY8 D;  5GT0 B;  5DNM B;  4KUD D;  5AVB A;  4Z5T A;  3VH6 A;  5FUG A;  5KDM B;  3LZ0 D;  1P3K B;  4KGC D;  4UUZ A;  4J8W A;  3UT9 C;  5GT3 C;  3WTP A;  4WU9 C;  3MGR D;  3AZE C;  3LZ1 D;  1ID3 B;  4XZQ D;  1P3F C;  4AWL B;  2NQB C;  3MGP B;  3AYW C;  5B33 B;  2PYO B;  5B40 D;  5B1M D;  3C1B D;  1KX5 D;  3MGS D;  4X23 D;  3X1T A;  3LEL A;  4H9N A;  5F99 C;  5BO0 B;  3AZM C;  1P3I B;  3B0C T;  4UUZ B;  5AY8 A;  3WAA D;  5C3I B;  3UTB D;  3O62 D;  4KUD A;  4XUJ C;  1WWS A;  1KX3 C;  3KSY A;  5JRG C;  4J8U A;  4KGC A;  2HIO C;  1WWI A;  4HGA C;  5B32 A;  3REH A;  4H9R A;  3AZJ B;  3UTA D;  3UT9 D;  4Z2M G;  4XZQ A;  4WU9 D;  4J8X A;  3AZE D;  3VH5 T;  1P3F D;  4H9S C;  5B1M A;  3AYW D;  2F8N D;  1KX4 B;  4QLC C;  3REK A;  2NQB D;  2F8N K;  3KXB A;  4Z66 C;  4EO5 C;  3AZM D;  3WKJ C;  1P3L B;  4G92 B;  5E5A B;  1TZY B;  4XUJ D;  3AZN C;  5B2I A;  5CP6 B;  3MNN A;  1P3A B;  1KX3 D;  5JRG D;  5GSU C;  4NFT A;  3X1U B;  1P3M B;  2HUE C;  3R45 B;  5B31 B;  3UTA A;  3AZL A;  2HIO D;  5DNN B;  3TU4 A;  5CPJ B;  1S32 A;  1P3O B;  4YM6 D;  1M1A C;  1P3F A;  5CPI A;  2F8N A;  3KWQ C;  3KUY C;  4QLC D;  5BNX B;  3X1S A;  5B24 B;  5GXQ A;  4J8V B;  1P3P B;  3AV2 A;  4Z66 D;  3MGQ C;  1P3B C;  3WKJ D;  3B0C W;  3B6F B;  3AZN D;  1P34 B;  5CPK C;  2YFV A;  4R8P C;  5AV9 A;  5BNV A;  5GSU D;  4WZS B;  5AVC D;  4YM6 A;  1ZLA C;  3REJ C;  1M1A D;  3AZG C;  2CV5 A;  3X1V A;  3KWQ D;  4CSR A;  3VH5 W;  4KHA B;  3KUY D;  5JA4 A;  3REL B;  3AN2 B;  1HTA A;  5AV9 B;  4H9O A;  3MGQ D;  1P3B D;  4ZUX B;  5CPK D;  3A6N B;  5AVC A;  4ZBJ C;  4R8P D;  1H3O A;  3AZI C;  2ARO B;  5B2J C;  2L5A A;  2F8N G;  5GT0 C;  1ZLA D;  3REJ D;  5DNM C;  3B6G B;  3AZG D;  1M19 A;  1M18 B;  1P3K C;  4LD9 A;  5AV6 B;  1ID3 C;  4WU8 B;  4AWL C;  3MGP C;  5B33 C;  3NQU A;  2PYO C;  3W96 A;  1BH9 B;  3W99 B;  3LJA A;  1P3I C;  4YS3 A;  1AOI B;  3NQJ B;  3MVD A;  1U35 C;  2NZD C;  5C3I C;  3AZI D;  5B2J D;  5GT0 D;  5DNM D;  4NE6 A;  1BH8 A;  4E44 A;  1P3K D;  1EQZ B;  5AV8 A;  1F66 A;  3LJA B;  1ID3 D;  4JJN B;  2FJ7 D;  1P3G A;  3MGP D;  1KX4 C;  5B33 D;  2PYO D;  3B0D B;  5B0Z B;  4CAY B;  1Q9C A;  3AZF A;  5B1L B;  4E45 A;  3AZH B;  3AV1 A;  1P3I D;  1TAF A;  3REI C;  1U35 D;  1P3L C;  3W98 A;  2NZD D;  5CHL B;  4G92 C;  4NE5 A;  1TZY C;  5E5A C;  5AV5 A;  5B0Y A;  3C1C B;  3AZK A;  5CP6 C;  1P3A C;  3W97 B;  3X1U C;  1P3M C;  2RVQ D;  5B31 C;  2BYK A;  1HQ3 A;  5DNN C;  5CPJ C;  1P3O C;  5AVB B;  4Z5T B;  2FJ7 A;  5FUG B;  1JFI A;  4J8W B;  1KX4 D;  3WTP B;  5B24 C;  1KU5 A;  3AZK B;  3LZ0 A;  1P3P C;  4J8V C;  3AFA C;  3REI D;  4H9P A;  3MGR A;  3X1T B;  3LZ1 A;  3LEL B;  5GT3 D;  3B6F C;  5E5A D;  4H9N B;  1P34 C;  4DRA A;  5CP6 D;  5G49 A;  1P3A D;  5B40 A;  3C1B A;  5AY8 B;  1KX5 A;  3X1U D;  3MGS A;  4X23 A;  1P3M D;  3WA9 C;  4KUD B;  5B31 D;  5CPJ D;  5DNN D;  1P3O D;  4J8U B;  3VH6 T;  4KGC B;  5F99 D;  3AZI B;  3WAA A;  3UTB A;  3O62 A;  5B32 B;  3REH B;  4H9R B;  2YFW A;  4XZQ B;  5B24 D;  3REL C;  4H9Q A;  4J8X B;  3AN2 C;  3V9R A;  5B1M B;  2CWE A;  3REI A;  1KX5 B;  3AFA D;  3REK B;  3UT9 A;  5GT3 A;  4WU9 A;  3AZE A;  3B6F D;  2NQB A;  3KXB B;  1P34 D;  4ZUX C;  3AYW A;  3A6N C;  3WAA B;  3WTP E;  2ARO C;  2IO5 B;  3WA9 D;  5B2I B;  3MNN B;  5F99 A;  3AZM A;  2LY8 A;  2BYM A;  1M18 C;  3UTA B;  3AZL B;  4XUJ A;  3TU4 B;  1S32 B;  1KX3 A;  5JRG A;  1P3F B;  5CPI B;  3REL D;  2F8N B;  5AV6 C;  3AN2 D;  4WU8 C;  2HIO A;  1N1J A;  3X1S B;  3W99 C;  5GXQ B;  3AV2 B;  4H9S A;  4ZUX D;  4QLC A;  3A6N D;  1AOI C;  2PYO A;  5BS7 C;  2ARO D;  1R4V A;  4Z66 A;  2YFV B;  3WKJ A;  5BNV B;  1B6W A;  3VH6 W;  1M18 D;  4YM6 B;  3AZN A;  1EQZ C;  4DRB A;  5GSU A;  2CV5 B;  3X1V B;  5AV6 D;  4JJN C;  4CSR B;  1M1A A;  1BFM A;  5JA4 B;  3B0D C;  5B0Z C;  4Z66 B;  5B1L C;  3WKJ B;  5B31 G;  3KWQ A;  4H9O B;  3AZH C;  3KUY A;  1AOI D;  4G91 B;  3C1C C;  5AVC B;  3MGQ A;  1P3B A;  3W97 C;  3B0B A;  1H3O B;  1M1A B;  5CPK A;  1EQZ D;  4R8P A;  5AVB C;  4Z5T C;  1M19 B;  1A7W A;  1ZLA A;  3REJ A;  4J8W C;  3WTP C;  3AZG A;  4LD9 B;  5B0Z D;  4WNN A;  5B1L D;  1P3B B;  3NQU B;  3W96 B;  3AZJ C;  3X1T C;  3LEL C;  3C1C D;  4YS3 B;  3W97 D;  3MVD B;  5AY8 C;  1BH8 B;  4J8U C;  5AVB D;  4Z5T D;  4KGC C;  3AZI A;  5B2J A;  5B32 C;  5GT0 A;  5AV8 B;  3REH C;  5DNM A;  4J8W D;  1F66 B;  3WTP D;  4J8X C;  5KDM A;  1P3K A;  1P3G B;  5B1M C;  3REK C;  3AZF B;  3AZJ D;  3X1T D;  3LEL D;  1ID3 A;  3KXB C;  3MGP A;  3AV1 B;  5B33 A;  3VH5 A; 
#chains in the Genus database with same CATH topology
 3W98 B;  2ZM5 A;  2IO5 C;  5B0Y B;  5AV5 B;  4Z2M H;  5B2I C;  3MNN C;  5BO0 A;  1P3I A;  4J8U D;  2J8P A;  1U35 A;  5BT1 C;  2NZD A;  3UTA C;  2BYK B;  3AZL C;  1HQ3 B;  5B32 D;  3TU4 C;  1S32 C;  3REH D;  2Y2J A;  1P3L D;  1TZY D;  2FJ7 B;  5CPI C;  4J8X D;  1JFI B;  3REK D;  3AZJ A;  3X1S C;  1Z2C B;  3LZ0 B;  5GXQ C;  3AV2 C;  3KXB D;  1U35 B;  1KX4 A;  2NZD B;  4H9P B;  3MGR B;  3LZ1 B;  4NE3 A;  5B2I D;  3MNN D;  5G49 B;  5B40 B;  5AV9 C;  3C1B B;  4J8V D;  1P3P D;  3MGS B;  4X23 B;  5BT1 D;  1P3L A;  4YM6 C;  5E5A A;  1TZY A;  3AZL D;  3TU4 D;  5CP6 A;  1S32 D;  1P3A A;  5CPI D;  3X1U A;  3UTB B;  2ZY2 A;  3X1V C;  3O62 B;  2CV5 C;  3R45 A;  1P3M A;  2UWX A;  5B31 A;  5DNN A;  5CPJ A;  1P3O A;  2YFW B;  3X1S D;  4H9Q B;  3B6G C;  3V9R B;  5GXQ D;  3REI B;  3AV2 D;  3UT9 B;  5GT3 B;  5BNX A;  5B24 A;  4WU9 B;  2G5I C;  3AZE B;  4G91 C;  2NQB B;  1P3P A;  4J8V A;  3AYW B;  3AFA A;  5AVC C;  5AV9 D;  4M6B A;  4WV4 B;  3B6F A;  1P34 A;  5F99 B;  3AZM B;  2BYM B;  1M19 C;  1TAF B;  2CV5 D;  3X1V D;  3WA9 A;  4XUJ B;  1KX3 B;  5JRG B;  4LD9 C;  3B6G D;  3AFA B;  2HIO B;  1N1J B;  4HGA B;  1F1E A;  3W96 C;  4KHA A;  3IP4 C;  3REL A;  2F8N H;  3AN2 A;  5B32 G;  3LJA C;  4QLC B;  4YS3 C;  3WA9 B;  4WU8 D;  3MVD C;  2ZY4 A;  4EO5 B;  4ZUX A;  3W99 D;  3A6N A;  1M19 D;  2ARO A;  3AL0 C;  3AZN B;  5AV8 C;  1F66 C;  3B6G A;  5GSU B;  4LD9 D;  2HUE B;  1M18 A;  1P3G C;  1B67 A;  3W96 D;  2RIQ A;  3AZF C;  5AV6 A;  3KWQ B;  4WU8 A;  3LJA D;  3AV1 C;  3KUY B;  4YS3 D;  4JJN D;  1BH9 A;  3MVD D;  3W98 C;  3AZK C;  1T3U A;  5B0Y C;  5AV5 C;  3W99 A;  3MGQ B;  1AOI A;  3NQJ A;  2JSS A;  3AZH D;  5BS7 A;  5CPK B;  1HQ3 C;  5AV8 D;  4R8P B;  1F66 D;  2FJ7 C;  2G5H C;  1P3G D;  1ZLA B;  3REJ B;  1EQZ A;  4KUD C;  3AZG B;  4WNN B;  3AZF D;  3EPJ A;  3LZ0 C;  4JJN A;  3AV1 D;  2Y2Q A;  3H0L C;  3MGR C;  5B0Z A;  3W98 D;  4CAY A;  3LZ1 C;  5B1L A;  4XZQ C;  2Y2H A;  5B0Y D;  3AZK D;  5AV5 D;  3AZH A;  5B40 C;  2RVQ C;  3C1B C;  3A1I A;  1KX5 C;  3MGS C;  4X23 C;  1HQ3 D;  3C1C A;  4ZBJ B;  1ULY A;  3W97 A;  3WAA C;  3UTB C;  2DF4 C;  5B2J B;  3O62 C;  4WJ3 C;  5AY8 D;  5GT0 B;  5DNM B;  4KUD D;  5AVB A;  4Z5T A;  3VH6 A;  5FUG A;  5KDM B;  3LZ0 D;  1P3K B;  4KGC D;  4UUZ A;  2FFF B;  4J8W A;  3UT9 C;  5GT3 C;  3WTP A;  4WU9 C;  3MGR D;  3AZE C;  3LZ1 D;  1ID3 B;  4XZQ D;  1P3F C;  4AWL B;  2NQB C;  3KFU G;  3MGP B;  3AYW C;  5B33 B;  2PYO B;  5B40 D;  5B1M D;  3C1B D;  1KX5 D;  3MGS D;  4X23 D;  3X1T A;  3LEL A;  4H9N A;  5F99 C;  5BO0 B;  3AZM C;  1P3I B;  3B0C T;  4UUZ B;  5AY8 A;  3WAA D;  5C3I B;  3UTB D;  3O62 D;  1W2E A;  4XUJ C;  4KUD A;  3H0R C;  1WWS A;  1KX3 C;  3KSY A;  5JRG C;  4J8U A;  4KGC A;  2HIO C;  1WWI A;  4HGA C;  5B32 A;  3REH A;  4H9R A;  3AZJ B;  3UTA D;  3UT9 D;  4Z2M G;  4XZQ A;  4WU9 D;  4UPK A;  4J8X A;  3AZE D;  3VH5 T;  1P3F D;  4H9S C;  5B1M A;  3AYW D;  2F8N D;  1KX4 B;  4QLC C;  3REK A;  3EG5 B;  2F8N K;  3KXB A;  4Z66 C;  4EO5 C;  3AZM D;  3WKJ C;  1P3L B;  4G92 B;  5E5A B;  1TZY B;  4XUJ D;  3AZN C;  5B2I A;  5CP6 B;  3MNN A;  1P3A B;  1KX3 D;  5JRG D;  5GSU C;  4NFT A;  3X1U B;  1P3M B;  2ZY3 A;  2HUE C;  3R45 B;  5B31 B;  3UTA A;  3AZL A;  2HIO D;  5DNN B;  3TU4 A;  5CPJ B;  1S32 A;  1P3O B;  4YM6 D;  3F6T A;  1M1A C;  1P3F A;  5CPI A;  2XD5 A;  3A1K A;  2F8N A;  3KWQ C;  2XD1 A;  3KUY C;  4QLC D;  5BNX B;  3X1S A;  5B24 B;  2Y2N A;  5GXQ A;  4J8V B;  1P3P B;  3AV2 A;  4Z66 D;  3MGQ C;  1P3B C;  3WKJ D;  3B0C W;  3B6F B;  3AZN D;  1P34 B;  5CPK C;  2YFV A;  4R8P C;  2Y2P A;  5AV9 A;  5BNV A;  5GSU D;  4WZS B;  5AVC D;  2ZY5 A;  4YM6 A;  1ZLA C;  3REJ C;  1M1A D;  3AZG C;  2Y2G A;  2CV5 A;  3X1V A;  2DQN C;  3KWQ D;  4CSR A;  3VH5 W;  4KHA B;  3KUY D;  2VQR A;  3FDD A;  5JA4 A;  3REL B;  3AN2 B;  1HTA A;  5AV9 B;  4H9O A;  3MGQ D;  1P3B D;  2F2A C;  4ZUX B;  5CPK D;  3A6N B;  5AVC A;  4ZBJ C;  4R8P D;  1H3O A;  3AZI C;  2ARO B;  5B2J C;  2L5A A;  2F8N G;  5GT0 C;  1ZLA D;  3REJ D;  5DNM C;  3B6G B;  3AZG D;  3H0M C;  3EPL A;  1M19 A;  1M18 B;  1P3K C;  4LD9 A;  2Y2K A;  5AV6 B;  1ID3 C;  4WU8 B;  4AWL C;  3MGP C;  5B33 C;  2BG1 A;  3NQU A;  2PYO C;  3W96 A;  1BH9 B;  3W99 B;  3LJA A;  1P3I C;  4YS3 A;  1AOI B;  3NQJ B;  3MVD A;  1U35 C;  2NZD C;  5C3I C;  3AZI D;  5B2J D;  5GT0 D;  5DNM D;  4NE6 A;  1BH8 A;  4E44 A;  1P3K D;  1EQZ B;  5AV8 A;  1F66 A;  3LJA B;  2NQB D;  1ID3 D;  4JJN B;  2FJ7 D;  1P3G A;  3MGP D;  1KX4 C;  5B33 D;  2PYO D;  3B0D B;  5B0Z B;  4CAY B;  1Q9C A;  3AZF A;  5B1L B;  4E45 A;  3EPK A;  3AZH B;  3AV1 A;  1P3I D;  1TAF A;  3REI C;  1U35 D;  1P3L C;  3W98 A;  2Y2O A;  5CHL B;  2NZD D;  4G92 C;  4NE5 A;  1TZY C;  5E5A C;  5AV5 A;  5B0Y A;  3C1C B;  2Y2M A;  3AZK A;  5CP6 C;  1P3A C;  2JCH A;  3W97 B;  3X1U C;  1P3M C;  2RVQ D;  5B31 C;  2BYK A;  1HQ3 A;  5DNN C;  5CPJ C;  1P3O C;  5AVB B;  4Z5T B;  2FJ7 A;  5FUG B;  1JFI A;  4J8W B;  1KX4 D;  3WTP B;  5B24 C;  1KU5 A;  2JE5 A;  3AZK B;  3LZ0 A;  1P3P C;  4J8V C;  3AFA C;  3REI D;  4H9P A;  3MGR A;  3X1T B;  3LZ1 A;  3LEL B;  5GT3 D;  3B6F C;  3P5J B;  4H9N B;  5E5A D;  1P34 C;  4DRA A;  5CP6 D;  5G49 A;  1P3A D;  5B40 A;  3C1B A;  5AY8 B;  1KX5 A;  3X1U D;  3MGS A;  4X23 A;  1P3M D;  3WA9 C;  4KUD B;  5B31 D;  5CPJ D;  5DNN D;  1P3O D;  4J8U B;  3VH6 T;  4KGC B;  5F99 D;  3AZI B;  3WAA A;  3UTB A;  3O62 A;  5B32 B;  3REH B;  4H9R B;  2YFW A;  4XZQ B;  5B24 D;  3REL C;  4H9Q A;  4J8X B;  3AN2 C;  3V9R A;  5B1M B;  2CWE A;  3REI A;  1KX5 B;  3AFA D;  3REK B;  3UT9 A;  5GT3 A;  4WU9 A;  3AZE A;  3B6F D;  2NQB A;  3KXB B;  1P34 D;  4ZUX C;  3AYW A;  3A6N C;  3WAA B;  3WTP E;  2ARO C;  2IO5 B;  3WA9 D;  5B2I B;  3MNN B;  5F99 A;  3AZM A;  2LY8 A;  2BYM A;  1M18 C;  3UTA B;  3AZL B;  4XUJ A;  3TU4 B;  1S32 B;  1KX3 A;  5JRG A;  1P3F B;  5CPI B;  3REL D;  2F8N B;  5AV6 C;  3AN2 D;  4WU8 C;  2HIO A;  1N1J A;  3X1S B;  3W99 C;  5GXQ B;  3AV2 B;  4H9S A;  4ZUX D;  4QLC A;  3A6N D;  1AOI C;  2PYO A;  5BS7 C;  2ARO D;  1R4V A;  4Z66 A;  2YFV B;  3WKJ A;  2Y2I A;  5BNV B;  1B6W A;  3VH6 W;  1M18 D;  4YM6 B;  3AZN A;  1EQZ C;  4DRB A;  5GSU A;  2CV5 B;  3X1V B;  5AV6 D;  4JJN C;  4CSR B;  1PZR A;  1M1A A;  1BFM A;  5JA4 B;  3B0D C;  5B0Z C;  4Z66 B;  5B1L C;  3WKJ B;  5B31 G;  3KWQ A;  4H9O B;  3AZH C;  3KUY A;  1AOI D;  4G91 B;  3C1C C;  5AVC B;  3MGQ A;  1P3B A;  3W97 C;  3B0B A;  1H3O B;  1M1A B;  5CPK A;  1EQZ D;  4R8P A;  5AVB C;  4Z5T C;  1M19 B;  1A7W A;  1ZLA A;  3REJ A;  4J8W C;  3WTP C;  3AZG A;  4LD9 B;  5B0Z D;  4WNN A;  5B1L D;  1P3B B;  3NQU B;  3W96 B;  3AZJ C;  3X1T C;  3LEL C;  3C1C D;  4YS3 B;  3W97 D;  3MVD B;  5AY8 C;  2W8S A;  1BH8 B;  4J8U C;  5AVB D;  4Z5T D;  4KGC C;  3AZI A;  5B2J A;  3EPH A;  5B32 C;  5GT0 A;  5AV8 B;  3REH C;  5DNM A;  4J8W D;  1F66 B;  3WTP D;  2Y2L A;  4J8X C;  5KDM A;  1P3K A;  1P3G B;  5B1M C;  3REK C;  4DQY B;  3AZF B;  3AZJ D;  3X1T D;  3LEL D;  1ID3 A;  3KXB C;  3MGP A;  3AV1 B;  5B33 A;  3VH5 A; 
#chains in the Genus database with same CATH homology
 3W98 B;  2ZM5 A;  2IO5 C;  5B0Y B;  5AV5 B;  4Z2M H;  5B2I C;  3MNN C;  5BO0 A;  1P3I A;  4J8U D;  2J8P A;  1U35 A;  5BT1 C;  2NZD A;  3UTA C;  2BYK B;  3AZL C;  1HQ3 B;  5B32 D;  3TU4 C;  1S32 C;  3REH D;  2Y2J A;  1P3L D;  1TZY D;  2FJ7 B;  5CPI C;  4J8X D;  1JFI B;  3REK D;  3AZJ A;  3X1S C;  1Z2C B;  3LZ0 B;  5GXQ C;  3AV2 C;  3KXB D;  1U35 B;  1KX4 A;  2NZD B;  4H9P B;  3MGR B;  3LZ1 B;  4NE3 A;  5B2I D;  3MNN D;  5G49 B;  5B40 B;  5AV9 C;  3C1B B;  4J8V D;  1P3P D;  3MGS B;  4X23 B;  5BT1 D;  1P3L A;  4YM6 C;  5E5A A;  1TZY A;  3AZL D;  3TU4 D;  5CP6 A;  1S32 D;  1P3A A;  5CPI D;  3X1U A;  3UTB B;  2ZY2 A;  3X1V C;  3O62 B;  2CV5 C;  3R45 A;  1P3M A;  2UWX A;  5B31 A;  5DNN A;  5CPJ A;  1P3O A;  2YFW B;  3X1S D;  4H9Q B;  3B6G C;  3V9R B;  5GXQ D;  3REI B;  3AV2 D;  3UT9 B;  5GT3 B;  5BNX A;  5B24 A;  4WU9 B;  2G5I C;  3AZE B;  4G91 C;  2NQB B;  1P3P A;  4J8V A;  3AYW B;  3AFA A;  5AVC C;  5AV9 D;  4M6B A;  4WV4 B;  3B6F A;  1P34 A;  5F99 B;  3AZM B;  2BYM B;  1M19 C;  1TAF B;  2CV5 D;  3X1V D;  3WA9 A;  4XUJ B;  1KX3 B;  5JRG B;  4LD9 C;  3B6G D;  3AFA B;  2HIO B;  1N1J B;  4HGA B;  1F1E A;  3W96 C;  4KHA A;  3IP4 C;  3REL A;  2F8N H;  3AN2 A;  5B32 G;  3LJA C;  4QLC B;  4YS3 C;  3WA9 B;  4WU8 D;  3MVD C;  2ZY4 A;  4EO5 B;  4ZUX A;  3W99 D;  3A6N A;  1M19 D;  2ARO A;  3AL0 C;  3AZN B;  5AV8 C;  1F66 C;  3B6G A;  5GSU B;  4LD9 D;  2HUE B;  1M18 A;  1P3G C;  1B67 A;  3W96 D;  2RIQ A;  3AZF C;  5AV6 A;  3KWQ B;  4WU8 A;  3LJA D;  3AV1 C;  3KUY B;  4YS3 D;  4JJN D;  1BH9 A;  3MVD D;  3W98 C;  3AZK C;  1T3U A;  5B0Y C;  5AV5 C;  3W99 A;  3MGQ B;  1AOI A;  3NQJ A;  2JSS A;  3AZH D;  5BS7 A;  5CPK B;  1HQ3 C;  5AV8 D;  4R8P B;  1F66 D;  2FJ7 C;  2G5H C;  1P3G D;  1ZLA B;  3REJ B;  1EQZ A;  4KUD C;  3AZG B;  4WNN B;  3AZF D;  3EPJ A;  3LZ0 C;  4JJN A;  3AV1 D;  2Y2Q A;  3H0L C;  3MGR C;  5B0Z A;  3W98 D;  4CAY A;  3LZ1 C;  5B1L A;  4XZQ C;  2Y2H A;  5B0Y D;  3AZK D;  5AV5 D;  3AZH A;  5B40 C;  2RVQ C;  3C1B C;  3A1I A;  1KX5 C;  3MGS C;  4X23 C;  1HQ3 D;  3C1C A;  4ZBJ B;  1ULY A;  3W97 A;  3WAA C;  3UTB C;  2DF4 C;  5B2J B;  3O62 C;  4WJ3 C;  5AY8 D;  5GT0 B;  5DNM B;  4KUD D;  5AVB A;  4Z5T A;  3VH6 A;  5FUG A;  5KDM B;  3LZ0 D;  1P3K B;  4KGC D;  4UUZ A;  2FFF B;  4J8W A;  3UT9 C;  5GT3 C;  3WTP A;  4WU9 C;  3MGR D;  3AZE C;  3LZ1 D;  1ID3 B;  4XZQ D;  1P3F C;  4AWL B;  2NQB C;  3KFU G;  3MGP B;  3AYW C;  5B33 B;  2PYO B;  5B40 D;  5B1M D;  3C1B D;  1KX5 D;  3MGS D;  4X23 D;  3X1T A;  3LEL A;  4H9N A;  5F99 C;  5BO0 B;  3AZM C;  1P3I B;  3B0C T;  4UUZ B;  5AY8 A;  3WAA D;  5C3I B;  3UTB D;  3O62 D;  1W2E A;  4XUJ C;  4KUD A;  3H0R C;  1WWS A;  1KX3 C;  3KSY A;  5JRG C;  4J8U A;  4KGC A;  2HIO C;  1WWI A;  4HGA C;  5B32 A;  3REH A;  4H9R A;  3AZJ B;  3UTA D;  3UT9 D;  4Z2M G;  4XZQ A;  4WU9 D;  4UPK A;  4J8X A;  3AZE D;  3VH5 T;  1P3F D;  4H9S C;  5B1M A;  3AYW D;  2F8N D;  1KX4 B;  4QLC C;  3REK A;  3EG5 B;  2F8N K;  3KXB A;  4Z66 C;  4EO5 C;  3AZM D;  3WKJ C;  1P3L B;  4G92 B;  5E5A B;  1TZY B;  4XUJ D;  3AZN C;  5B2I A;  5CP6 B;  3MNN A;  1P3A B;  1KX3 D;  5JRG D;  5GSU C;  4NFT A;  3X1U B;  1P3M B;  2ZY3 A;  2HUE C;  3R45 B;  5B31 B;  3UTA A;  3AZL A;  2HIO D;  5DNN B;  3TU4 A;  5CPJ B;  1S32 A;  1P3O B;  4YM6 D;  3F6T A;  1M1A C;  1P3F A;  5CPI A;  2XD5 A;  3A1K A;  2F8N A;  3KWQ C;  2XD1 A;  3KUY C;  4QLC D;  5BNX B;  3X1S A;  5B24 B;  2Y2N A;  5GXQ A;  4J8V B;  1P3P B;  3AV2 A;  4Z66 D;  3MGQ C;  1P3B C;  3WKJ D;  3B0C W;  3B6F B;  3AZN D;  1P34 B;  5CPK C;  2YFV A;  4R8P C;  2Y2P A;  5AV9 A;  5BNV A;  5GSU D;  4WZS B;  5AVC D;  2ZY5 A;  4YM6 A;  1ZLA C;  3REJ C;  1M1A D;  3AZG C;  2Y2G A;  2CV5 A;  3X1V A;  2DQN C;  3KWQ D;  4CSR A;  3VH5 W;  4KHA B;  3KUY D;  2VQR A;  3FDD A;  5JA4 A;  3REL B;  3AN2 B;  1HTA A;  5AV9 B;  4H9O A;  3MGQ D;  1P3B D;  2F2A C;  4ZUX B;  5CPK D;  3A6N B;  5AVC A;  4ZBJ C;  4R8P D;  1H3O A;  3AZI C;  2ARO B;  5B2J C;  2L5A A;  2F8N G;  5GT0 C;  1ZLA D;  3REJ D;  5DNM C;  3B6G B;  3AZG D;  3H0M C;  3EPL A;  1M19 A;  1M18 B;  1P3K C;  4LD9 A;  2Y2K A;  5AV6 B;  1ID3 C;  4WU8 B;  4AWL C;  3MGP C;  5B33 C;  2BG1 A;  3NQU A;  2PYO C;  3W96 A;  1BH9 B;  3W99 B;  3LJA A;  1P3I C;  4YS3 A;  1AOI B;  3NQJ B;  3MVD A;  1U35 C;  2NZD C;  5C3I C;  3AZI D;  5B2J D;  5GT0 D;  5DNM D;  4NE6 A;  1BH8 A;  4E44 A;  1P3K D;  1EQZ B;  5AV8 A;  1F66 A;  3LJA B;  2NQB D;  1ID3 D;  4JJN B;  2FJ7 D;  1P3G A;  3MGP D;  1KX4 C;  5B33 D;  2PYO D;  3B0D B;  5B0Z B;  4CAY B;  1Q9C A;  3AZF A;  5B1L B;  4E45 A;  3EPK A;  3AZH B;  3AV1 A;  1P3I D;  1TAF A;  3REI C;  1U35 D;  1P3L C;  3W98 A;  2Y2O A;  5CHL B;  2NZD D;  4G92 C;  4NE5 A;  1TZY C;  5E5A C;  5AV5 A;  5B0Y A;  3C1C B;  2Y2M A;  3AZK A;  5CP6 C;  1P3A C;  2JCH A;  3W97 B;  3X1U C;  1P3M C;  2RVQ D;  5B31 C;  2BYK A;  1HQ3 A;  5DNN C;  5CPJ C;  1P3O C;  5AVB B;  4Z5T B;  2FJ7 A;  5FUG B;  1JFI A;  4J8W B;  1KX4 D;  3WTP B;  5B24 C;  1KU5 A;  2JE5 A;  3AZK B;  3LZ0 A;  1P3P C;  4J8V C;  3AFA C;  3REI D;  4H9P A;  3MGR A;  3X1T B;  3LZ1 A;  3LEL B;  5GT3 D;  3B6F C;  3P5J B;  4H9N B;  5E5A D;  1P34 C;  4DRA A;  5CP6 D;  5G49 A;  1P3A D;  5B40 A;  3C1B A;  5AY8 B;  1KX5 A;  3X1U D;  3MGS A;  4X23 A;  1P3M D;  3WA9 C;  4KUD B;  5B31 D;  5CPJ D;  5DNN D;  1P3O D;  4J8U B;  3VH6 T;  4KGC B;  5F99 D;  3AZI B;  3WAA A;  3UTB A;  3O62 A;  5B32 B;  3REH B;  4H9R B;  2YFW A;  4XZQ B;  5B24 D;  3REL C;  4H9Q A;  4J8X B;  3AN2 C;  3V9R A;  5B1M B;  2CWE A;  3REI A;  1KX5 B;  3AFA D;  3REK B;  3UT9 A;  5GT3 A;  4WU9 A;  3AZE A;  3B6F D;  2NQB A;  3KXB B;  1P34 D;  4ZUX C;  3AYW A;  3A6N C;  3WAA B;  3WTP E;  2ARO C;  2IO5 B;  3WA9 D;  5B2I B;  3MNN B;  5F99 A;  3AZM A;  2LY8 A;  2BYM A;  1M18 C;  3UTA B;  3AZL B;  4XUJ A;  3TU4 B;  1S32 B;  1KX3 A;  5JRG A;  1P3F B;  5CPI B;  3REL D;  2F8N B;  5AV6 C;  3AN2 D;  4WU8 C;  2HIO A;  1N1J A;  3X1S B;  3W99 C;  5GXQ B;  3AV2 B;  4H9S A;  4ZUX D;  4QLC A;  3A6N D;  1AOI C;  2PYO A;  5BS7 C;  2ARO D;  1R4V A;  4Z66 A;  2YFV B;  3WKJ A;  2Y2I A;  5BNV B;  1B6W A;  3VH6 W;  1M18 D;  4YM6 B;  3AZN A;  1EQZ C;  4DRB A;  5GSU A;  2CV5 B;  3X1V B;  5AV6 D;  4JJN C;  4CSR B;  1PZR A;  1M1A A;  1BFM A;  5JA4 B;  3B0D C;  5B0Z C;  4Z66 B;  5B1L C;  3WKJ B;  5B31 G;  3KWQ A;  4H9O B;  3AZH C;  3KUY A;  1AOI D;  4G91 B;  3C1C C;  5AVC B;  3MGQ A;  1P3B A;  3W97 C;  3B0B A;  1H3O B;  1M1A B;  5CPK A;  1EQZ D;  4R8P A;  5AVB C;  4Z5T C;  1M19 B;  1A7W A;  1ZLA A;  3REJ A;  4J8W C;  3WTP C;  3AZG A;  4LD9 B;  5B0Z D;  4WNN A;  5B1L D;  1P3B B;  3NQU B;  3W96 B;  3AZJ C;  3X1T C;  3LEL C;  3C1C D;  4YS3 B;  3W97 D;  3MVD B;  5AY8 C;  2W8S A;  1BH8 B;  4J8U C;  5AVB D;  4Z5T D;  4KGC C;  3AZI A;  5B2J A;  3EPH A;  5B32 C;  5GT0 A;  5AV8 B;  3REH C;  5DNM A;  4J8W D;  1F66 B;  3WTP D;  2Y2L A;  4J8X C;  5KDM A;  1P3K A;  1P3G B;  5B1M C;  3REK C;  4DQY B;  3AZF B;  3AZJ D;  3X1T D;  3LEL D;  1ID3 A;  3KXB C;  3MGP A;  3AV1 B;  5B33 A;  3VH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...