4LD9D

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
86
Chain Sequence
YAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 86
sequence length 86
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9D00
2PYOB 3MGSB 1HQ3C 4NE3A 4CAYA 4H9QB 1U35A 5DNMA 3AZED 4H9OA 3AV1A 3AFAB 3AV1B 4KGCD 3AN2C 3UT9D 3TU4A 3AZLC 3MGRB 4YM6A 4YM6B 3WTPE 4J8WA 5AVBB 5B0YD 3AZMC 5B1MA 3VH5A 1R4VA 5B32A 4LD9B 3REKA 4G92C 5GT0B 1P3PA 1P3PB 4H9NB 4CSRB 5AY8A 4WU8C 3AV1D 3O62C 1P3IC 3AZGA 3AZGB 3TU4D 2HUEB 3UTAA 4YM6D 4JJNA 3R45A 4JJNB 3R45B 3C1BB 2CV5A 2FJ7C 2CV5B 4H9SA 5AVBD 3AZFC 1KU5A 4Z5TA 1Q9CA 1KX3A 3REJB 4J8XA 5F99C 5CPIA 1P3FA 1P3FB 5B32D 4LD9D 4M6BA 3REKD 3LZ1B 5GT0D 3MGPC 1P3PD 1BH9B 3KWQC 5AY8D 3KUYB 2LY8A 3W99C 3VH6A 1P34C 2NZDA 5CP6A 3AZGD 3AZNA 3REHB 2YFVA 2YFVB 1HQ3B 3UTAD 4JJND 3AZEC 2CV5D 2NQBA 2NQBB 3LJAA 4E44A 2BYMA 4Z5TD 3W97A 1KX3D 2YFWA 4J8XD 5CPID 5G49A 1P3FD 3UT9C 4H9RA 3LZ1D 4H9RB 5B0YC 4NFTA 4AWLB 4EO5B 5CPKC 2NZDD 2PYOC 3MGSC 3REHD 3AZND 3B0BA 5B2IA 2NQBD 3AFAC 3LJAD 3AV1C 5BS7A 1P3LB 3W97D 4WU8B 4WZSB 1P3MB 3O62B 4WU9A 1BH8B 3TU4C 3WA9A 3X1UA 4YM6C 5AVBC 1AOIA 1H3OB 2FJ7B 4XZQB 1B67A 1TAFA 1TAFB 5B32C 4LD9C 3REKC 5GT0C 1P3PC 1ID3A 5GSUA 5B2ID 4Z66A 5AVCA 3KWQB 1P3LD 3AZGC 2HUEC 1P3AB 4E45A 3WA9D 3UTAC 4JJNC 3C1BC 3NQJB 2AROA 2CV5C 2AROB 4H9SC 4XZQD 4WNNB 4NE6A 3VH6T 5B24A 3REJC 4J8XC 5CPIC 1P3FC 5GT3A 5DNNA 4KGCB 2HIOA 3LZ1C 3UTBA 3B6GB 1BFMA 2F8NH 1ID3D 5GSUD 3UT9B 4Z66D 3RELB 2NZDC 3W98A 1F66B 3REHC 3AZKA 3AZNC 1P3AD 3WTPA 2F8NG 4CAYB 2AROD 3NQUA 2NQBC 1U35B 5DNMB 4YS3A 4YS3B 4H9OB 3W97C 5JRGA 5B24D 5GT3D 3UTBD 3B6GD 1M19A 4HGAB 3TU4B 3KXBA 4ZBJB 4J8WB 3V9RA 4AWLC 4EO5C 3RELD 1ZLAA 3W98D 1F66D 1WWSA 5B1MB 5CPJA 5CPJB 3WTPD 5B32B 3REKB 3X1TA 5B1LA 3X1TB 5B1LB 1U35D 5DNMD 4YS3D 5AY8B 1P3LC 1P3BA 1P3BB 1P3MC 2F8NA 1P3KA 3AYWA 3AYWB 3KXBD 3UTAB 4J8WD 4DRBA 4XZQC 4J8UA 3B0CW 1ZLAD 5BNVA 5BT1D 4Z5TB 1KX3B 5B1MD 5CPJD 4J8XB 5GSUC 1N1JA 5CPIB 1N1JB 4Z66C 4XUJA 5B1LD 4XUJB 3X1TD 5AV9A 5B31G 5AV8A 1P3BD 3AZHA 2F8ND 3W96A 1P3KD 1P3AC 2NZDB 5CP6B 3AZNB 2AROC 3AYWD 5CHLB 3AV2A 4J8UD 5B24C 3LJAB 5GT3C 4KGCC 2BYMB 3B6GC 3W97B 4ZUXA 4ZUXB 2YFWB 5G49B 5E5AA 1KX5A 5B0ZA 4XUJD 3REIA 5AV9D 3REIB 4QLCA 3RELC 3W98C 1F66C 1F1EA 3AZHD 3W96D 3WKJA 4KUDA 5AV5A 3WTPC 5CP6D 4DRAA 5B31A 5B31B 1U35C 4G91B 5DNMC 5B2IB 4YS3C 3MGQA 3MGQB 5BO0A 3VH5T 5AV6A 5AV6B 4ZUXD 4HGAC 4WU9B 3AN2A 1KX5D 4ZBJC 5B0ZD 3KXBC 3X1UB 3WA9B 4J8WC 3REID 4QLCD 5B2JA 1AOIB 4KHAA 4KHAB 5BT1C 5KDMA 5B1MC 5CPJC 3WKJD 3MVDA 5AV5D 3AZMA 5B31D 3X1TC 5B1LC 1ID3B 3VH6W 5GSUB 3AZJA 3AZJB 4Z66B 4UUZA 4UUZB 5AY8C 3MGQD 1P3GA 5BNXA 1P3BC 5B40A 1P3KC 5AVCB 5B40B 5AV6D 4H9PA 1HTAA 4H9PB 1P3IA 4WU9D 3AYWC 3X1UD 4X23A 4R8PA 1AOID 5B2JD 4R8PB 3B6FB 3B6FA 4Z5TC 1KX3C 3AZFA 5FUGA 5B24B 5FUGB 1M18A 1P3OA 3MVDD 5GT3B 5DNNB 3AZMD 1M18B 2HIOB 3UTBB 4XUJC 3LELA 1JFIA 5F99A 3LELB 3LZ0A 3AZJD 1TZYA 3C1CA 3MGPA 1P3GD 3AZHC 3W96C 5B40D 5AVCD 5CP6C 3MNNA 3MNNB 3W98B 2L5AA 3AZKB 1P34A 3B0DB 4NE5A 3WTPB 5B33A 4X23D 5B33B 1A7WA 3NQUB 4R8PD 3LJAC 3B6FD 1B6WA 5JRGB 4ZUXC 1M18D 1P3OD 5DNND 2HIOD 5B0ZC 3LELD 1M19B 3REIC 4QLCC 3LZ0D 1TZYD 3KXBB 3C1CD 3WAAA 3WAAB 1S32A 3V9RB 1EQZA 2BYKA 1EQZB 1ZLAB 3MNND 5B31C 5CPKA 3AZKD 1KX4A 5GXQA 1KX4B 2PYOA 4G91C 3MGSA 3X1VA 3X1VB 5B2IC 5B33D 3MGQC 4H9QA 5BS7C 5C3IB 5AV6C 3AFAA 5JRGD 2F8NB 1P3KB 4WU9C 3WA9C 3X1UC 1M19D 1P34D 1AOIC 5B2JC 3MGRA 3WAAD 2CWEA 1S32D 5AVBA 4J8UB 1EQZD 2IO5B 3MVDC 5BNVB 3AZIA 3AZIB 5CPKD 1KX4D 5GXQD 1ID3C 4LD9A 2PYOD 3AZJC 3MGSD 3X1VD 5GT0A 4H9NA 1P3GC 4CSRA 5AV9B 1M1AA 1M1AB 5AVCC 5B40C 5AV8B 3AFAD 3AZHB 3W96B 2RVQD 4X23C 4R8PC 3B6FC 3MGRD 3C1BA 3AV2B 1M18C 1P3OC 5DNNC 3AZID 1ULYA 2HIOC 4J8VA 4J8VB 3REJA 3UTBC 3LELC 3A6NA 3A6NB 5E5AB 3LZ0C 3LZ1A 1TZYC 1KX5B 5B0ZB 3C1CC 3VH5W 1BH9A 4QLCB 1M1AD 3MNNC 3KUYA 5AV8D 3AZKC 3WKJB 3B0DC 4KUDB 5AV5B 3X1SA 3X1SB 3REHA 5B33C 3B0CT 1HQ3A 3C1BD 3AV2D 5JRGC 5BO0B 4J8VD 3REJD 1M19C 3A6ND 5E5AD 2F8NK 3AN2B 3WAAC 1S32C 1EQZC 5B2JB 3AZLA 1ZLAC 3AZLB 3KUYD 5KDMB 1KX4C 5GXQC 4KUDD 3MVDB 3X1VC 3AZMB 5JA4A 3X1SD 5JA4B 1HQ3D 4G92B 4Z2MH 5C3IC 1P3GB 5BNXB 2RVQC 1P3LA 4WU8A 1P3MA 3O62A 1BH8A 1P3IB 3AN2D 3MGRC 4X23B 4J8UC 2IO5C 3AZLD 4Z2MG 1H3OA 2FJ7A 3AZIC 4XZQA 3AZFB 1P3OB 1JFIB 5F99B 5AV9C 4WV4B 3LZ0B 1M1AC 1TZYB 3C1CB 3MGPB 5AV8C 3KWQA 4WU8D 1P3MD 3O62D 3W99A 1P3ID 3W99B 1P3AA 1P34B 3NQJA 3AV2C 2JSSA 3AZEA 2FJ7D 3AZEB 4WNNA 4J8VC 3AZFD 3A6NC 4KGCA 5E5AC 3B6GA 1KX5C 5F99D 3UT9A 3MGPD 3KUYC 5B32G 3RELA 1S32B 3KWQD 2BYKB 5B0YA 3WKJC 5B0YB 5AV5C 4KUDC 1F66A 3KSYA 3X1SC 5CPKB 1WWIA 3W99D 5GXQB
chains in the Genus database with same CATH superfamily
2PYOB 3MGSB 1HQ3C 4NE3A 4CAYA 3KFUG 4H9QB 1U35A 5DNMA 3AZED 4H9OA 3AV1A 3AFAB 3AV1B 4KGCD 3AN2C 3UT9D 3TU4A 3AZLC 3MGRB 4YM6A 4YM6B 3WTPE 4J8WA 3F6TA 5AVBB 5B0YD 3AZMC 2Y2OA 2ZY2A 5B1MA 3VH5A 1R4VA 5B32A 4LD9B 3REKA 4G92C 5GT0B 1P3PA 1P3PB 4H9NB 4CSRB 5AY8A 4WU8C 3EPLA 3AV1D 3O62C 1P3IC 2XD5A 3AZGA 3AZGB 3TU4D 2HUEB 3UTAA 4YM6D 4JJNA 1PZRA 3R45A 3R45B 3C1BB 4JJNB 2CV5A 2CV5B 4H9SA 5AVBD 3AZFC 1KU5A 4Z5TA 1Q9CA 1KX3A 3REJB 4J8XA 5F99C 5CPIA 1P3FA 1P3FB 5B32D 4LD9D 4M6BA 3REKD 3LZ1B 5GT0D 3MGPC 1P3PD 1BH9B 3KWQC 5AY8D 2XD1A 3KUYB 2LY8A 3W99C 3VH6A 1P34C 2NZDA 5CP6A 2BG1A 3AZGD 3AZNA 3REHB 2YFVA 2YFVB 1HQ3B 3UTAD 4JJND 3AZEC 2CV5D 2NQBA 2NQBB 3LJAA 4E44A 2BYMA 4Z5TD 3W97A 1KX3D 2YFWA 4J8XD 2JCHA 5G49A 5CPID 1P3FD 3UT9C 4H9RA 3LZ1D 4H9RB 5B0YC 4NFTA 4AWLB 4EO5B 5CPKC 2NZDD 2PYOC 3MGSC 3REHD 3AZND 3B0BA 5B2IA 2NQBD 3AFAC 3LJAD 3AV1C 5BS7A 1P3LB 3W97D 4WU8B 4WZSB 1P3MB 1T3UA 3O62B 4WU9A 1BH8B 3P5JB 3TU4C 3WA9A 3X1UA 4YM6C 2Y2QA 5AVBC 1AOIA 1H3OB 2FJ7B 4XZQB 1B67A 1TAFA 1TAFB 5B32C 4LD9C 3REKC 5GT0C 1P3PC 1ID3A 5GSUA 5B2ID 4Z66A 3FDDA 5AVCA 3KWQB 1P3LD 3AZGC 2HUEC 1P3AB 4E45A 3WA9D 3UTAC 4JJNC 3H0LC 3C1BC 3NQJB 2AROA 2CV5C 2AROB 4H9SC 1Z2CB 4DQYB 4XZQD 4WNNB 4NE6A 3VH6T 5B24A 3REJC 4J8XC 5CPIC 1P3FC 5GT3A 5DNNA 2Y2PA 4KGCB 2HIOA 2J8PA 3LZ1C 3UTBA 3B6GB 1BFMA 2F8NH 1ID3D 5GSUD 3UT9B 4Z66D 3RELB 2NZDC 3W98A 1F66B 3REHC 3AZKA 3AZNC 1P3AD 3WTPA 2F8NG 4CAYB 2AROD 3NQUA 2NQBC 1U35B 5DNMB 4YS3A 4YS3B 4H9OB 3W97C 5JRGA 5B24D 2Y2HA 5GT3D 3UTBD 3B6GD 1M19A 4HGAB 3TU4B 3KXBA 4ZBJB 4J8WB 3V9RA 4AWLC 4EO5C 3RELD 1ZLAA 3W98D 1F66D 1WWSA 5B1MB 5CPJA 2ZM5A 5CPJB 3WTPD 5B32B 3REKB 3X1TA 5B1LA 3X1TB 5B1LB 2F2AC 3EPJA 1U35D 5DNMD 4YS3D 5AY8B 1P3LC 2Y2IA 1P3BA 1P3BB 1P3MC 2F8NA 1P3KA 1W2EA 3AYWA 3AYWB 3KXBD 2UWXA 2ZY5A 4J8WD 3UTAB 4DRBA 4XZQC 4J8UA 3B0CW 1ZLAD 5BNVA 5BT1D 4Z5TB 1KX3B 5B1MD 5CPJD 4J8XB 5GSUC 1N1JA 5CPIB 1N1JB 4Z66C 4XUJA 5B1LD 4XUJB 3X1TD 2JE5A 5AV9A 3AL0C 5B31G 5AV8A 1P3BD 3AZHA 2F8ND 3W96A 1P3KD 1P3AC 2NZDB 5CP6B 3AZNB 3EPKA 2AROC 3AYWD 5CHLB 3AV2A 4J8UD 5B24C 3LJAB 5GT3C 4KGCC 2BYMB 3B6GC 3W97B 4ZUXA 4ZUXB 2YFWB 5G49B 5E5AA 1KX5A 5B0ZA 4XUJD 2FJ7C 3REIA 5AV9D 3REIB 4QLCA 3RELC 3W98C 1F66C 1F1EA 3AZHD 3W96D 3WKJA 4KUDA 5AV5A 3WTPC 5CP6D 4DRAA 5B31A 5B31B 1U35C 2DQNC 4G91B 5DNMC 5B2IB 4YS3C 3MGQA 3MGQB 5BO0A 3VH5T 5AV6A 5AV6B 3H0RC 4ZUXD 4HGAC 4WU9B 3AN2A 1KX5D 4ZBJC 5B0ZD 3KXBC 3X1UB 3WA9B 4J8WC 3EG5B 3REID 4QLCD 5B2JA 1AOIB 4KHAA 4KHAB 5BT1C 5KDMA 5B1MC 5CPJC 3WKJD 3MVDA 5AV5D 3AZMA 5B31D 3X1TC 5B1LC 1ID3B 3VH6W 5GSUB 3AZJA 3AZJB 4Z66B 4UUZA 4UUZB 3A1IA 5AY8C 3MGQD 1P3GA 5BNXA 1P3BC 5B40A 1P3KC 5AVCB 5B40B 5AV6D 2G5IC 4H9PA 1HTAA 4H9PB 1P3IA 4WU9D 3AYWC 3X1UD 4X23A 4R8PA 1AOID 5B2JD 4R8PB 3B6FB 3B6FA 4Z5TC 1KX3C 3AZFA 5FUGA 5B24B 5FUGB 1M18A 1P3OA 3MVDD 5GT3B 5DNNB 3AZMD 1M18B 2HIOB 3UTBB 4XUJC 3LELA 1JFIA 5F99A 3LELB 2VQRA 3LZ0A 3AZJD 1TZYA 3C1CA 3MGPA 1P3GD 3AZHC 2FFFB 3W96C 5B40D 5AVCD 5CP6C 3MNNA 3MNNB 3W98B 2L5AA 3AZKB 1P34A 3B0DB 4NE5A 3WTPB 5B33A 4X23D 5B33B 1A7WA 3NQUB 4R8PD 3LJAC 3B6FD 1B6WA 5JRGB 4ZUXC 1M18D 1P3OD 5DNND 2HIOD 5B0ZC 3LELD 1M19B 3REIC 4QLCC 3LZ0D 1TZYD 3KXBB 3C1CD 3WAAA 3WAAB 1S32A 3V9RB 1EQZA 2BYKA 1EQZB 1ZLAB 3MNND 5B31C 5CPKA 3AZKD 1KX4A 5GXQA 1KX4B 2PYOA 4G91C 3MGSA 3X1VA 3X1VB 5B2IC 5B33D 3MGQC 4H9QA 5BS7C 5C3IB 5AV6C 3H0MC 5JRGD 3AFAA 2F8NB 1P3KB 4WU9C 3WA9C 3X1UC 1M19D 1P34D 1AOIC 5B2JC 3MGRA 3WAAD 2CWEA 1S32D 5AVBA 4J8UB 1EQZD 2IO5B 3MVDC 5BNVB 3AZIA 3AZIB 5CPKD 1KX4D 5GXQD 1ID3C 4LD9A 2PYOD 3AZJC 3MGSD 3X1VD 5GT0A 4H9NA 1P3GC 4CSRA 5AV9B 1M1AA 1M1AB 2ZY4A 5AVCC 5B40C 4WJ3C 5AV8B 3AFAD 3AZHB 3W96B 2RVQD 2Y2NA 4X23C 4R8PC 3B6FC 3MGRD 3C1BA 3AV2B 1M18C 1P3OC 5DNNC 3AZID 1ULYA 2HIOC 4J8VA 2RIQA 4J8VB 3REJA 2G5HC 3LELC 3A6NA 3UTBC 3A6NB 5E5AB 3LZ0C 3LZ1A 1TZYC 1KX5B 5B0ZB 3C1CC 3VH5W 1BH9A 4QLCB 1M1AD 3MNNC 3KUYA 5AV8D 3AZKC 3EPHA 3WKJB 3B0DC 4KUDB 5AV5B 3X1SA 3X1SB 2ZY3A 3REHA 5B33C 3B0CT 2Y2LA 1HQ3A 3C1BD 3AV2D 5JRGC 5BO0B 4J8VD 3REJD 1M19C 3A6ND 5E5AD 2Y2MA 2F8NK 3AN2B 3WAAC 1S32C 1EQZC 5B2JB 3AZLA 1ZLAC 3AZLB 3KUYD 5KDMB 1KX4C 5GXQC 4KUDD 3MVDB 3X1VC 3AZMB 5JA4A 3X1SD 5JA4B 3A1KA 1HQ3D 4G92B 4Z2MH 5C3IC 2DF4C 5BNXB 1P3GB 2RVQC 1P3LA 4WU8A 1P3MA 3O62A 1BH8A 1P3IB 3AN2D 3MGRC 4X23B 4J8UC 2IO5C 3AZLD 4Z2MG 1H3OA 2FJ7A 3AZIC 4XZQA 3AZFB 1P3OB 2Y2JA 1JFIB 5F99B 5AV9C 4WV4B 3LZ0B 1M1AC 1TZYB 3C1CB 3MGPB 5AV8C 2W8SA 3KWQA 3IP4C 4WU8D 1P3MD 3O62D 3W99A 1P3ID 3W99B 1P3AA 1P34B 3NQJA 3AV2C 2JSSA 2Y2KA 3AZEA 2FJ7D 3AZEB 4WNNA 4J8VC 2Y2GA 3AZFD 3A6NC 4KGCA 5E5AC 3B6GA 1KX5C 5F99D 3UT9A 4UPKA 3MGPD 3KUYC 5B32G 3RELA 1S32B 3KWQD 2BYKB 5B0YA 3WKJC 5B0YB 5AV5C 4KUDC 1F66A 3KSYA 3X1SC 5CPKB 1WWIA 3W99D 5GXQB
chains in the Genus database with same CATH topology
2PYOB 3MGSB 1HQ3C 4NE3A 4CAYA 3KFUG 4H9QB 1U35A 5DNMA 3AZED 4H9OA 3AV1A 3AFAB 3AV1B 4KGCD 3AN2C 3UT9D 3TU4A 3AZLC 3MGRB 4YM6A 4YM6B 3WTPE 4J8WA 3F6TA 5AVBB 5B0YD 3AZMC 2Y2OA 2ZY2A 5B1MA 3VH5A 1R4VA 5B32A 4LD9B 3REKA 4G92C 5GT0B 1P3PA 1P3PB 4H9NB 4CSRB 5AY8A 4WU8C 3EPLA 3AV1D 3O62C 1P3IC 2XD5A 3AZGA 3AZGB 3TU4D 2HUEB 3UTAA 4YM6D 4JJNA 1PZRA 3R45A 3R45B 3C1BB 4JJNB 2CV5A 2CV5B 4H9SA 5AVBD 3AZFC 1KU5A 4Z5TA 1Q9CA 1KX3A 3REJB 4J8XA 5F99C 5CPIA 1P3FA 1P3FB 5B32D 4LD9D 4M6BA 3REKD 3LZ1B 5GT0D 3MGPC 1P3PD 1BH9B 3KWQC 5AY8D 2XD1A 3KUYB 2LY8A 3W99C 3VH6A 1P34C 2NZDA 5CP6A 2BG1A 3AZGD 3AZNA 3REHB 2YFVA 2YFVB 1HQ3B 3UTAD 4JJND 3AZEC 2CV5D 2NQBA 2NQBB 3LJAA 4E44A 2BYMA 4Z5TD 3W97A 1KX3D 2YFWA 4J8XD 2JCHA 5G49A 5CPID 1P3FD 3UT9C 4H9RA 3LZ1D 4H9RB 5B0YC 4NFTA 4AWLB 4EO5B 5CPKC 2NZDD 2PYOC 3MGSC 3REHD 3AZND 3B0BA 5B2IA 2NQBD 3AFAC 3LJAD 3AV1C 5BS7A 1P3LB 3W97D 4WU8B 4WZSB 1P3MB 1T3UA 3O62B 4WU9A 1BH8B 3P5JB 3TU4C 3WA9A 3X1UA 4YM6C 2Y2QA 5AVBC 1AOIA 1H3OB 2FJ7B 4XZQB 1B67A 1TAFA 1TAFB 5B32C 4LD9C 3REKC 5GT0C 1P3PC 1ID3A 5GSUA 5B2ID 4Z66A 3FDDA 5AVCA 3KWQB 1P3LD 3AZGC 2HUEC 1P3AB 4E45A 3WA9D 3UTAC 4JJNC 3H0LC 3C1BC 3NQJB 2AROA 2CV5C 2AROB 4H9SC 1Z2CB 4DQYB 4XZQD 4WNNB 4NE6A 3VH6T 5B24A 3REJC 4J8XC 5CPIC 1P3FC 5GT3A 5DNNA 2Y2PA 4KGCB 2HIOA 2J8PA 3LZ1C 3UTBA 3B6GB 1BFMA 2F8NH 1ID3D 5GSUD 3UT9B 4Z66D 3RELB 2NZDC 3W98A 1F66B 3REHC 3AZKA 3AZNC 1P3AD 3WTPA 2F8NG 4CAYB 2AROD 3NQUA 2NQBC 1U35B 5DNMB 4YS3A 4YS3B 4H9OB 3W97C 5JRGA 5B24D 2Y2HA 5GT3D 3UTBD 3B6GD 1M19A 4HGAB 3TU4B 3KXBA 4ZBJB 4J8WB 3V9RA 4AWLC 4EO5C 3RELD 1ZLAA 3W98D 1F66D 1WWSA 5B1MB 5CPJA 2ZM5A 5CPJB 3WTPD 5B32B 3REKB 3X1TA 5B1LA 3X1TB 5B1LB 2F2AC 3EPJA 1U35D 5DNMD 4YS3D 5AY8B 1P3LC 2Y2IA 1P3BA 1P3BB 1P3MC 2F8NA 1P3KA 1W2EA 3AYWA 3AYWB 3KXBD 2UWXA 2ZY5A 4J8WD 3UTAB 4DRBA 4XZQC 4J8UA 3B0CW 1ZLAD 5BNVA 5BT1D 4Z5TB 1KX3B 5B1MD 5CPJD 4J8XB 5GSUC 1N1JA 5CPIB 1N1JB 4Z66C 4XUJA 5B1LD 4XUJB 3X1TD 2JE5A 5AV9A 3AL0C 5B31G 5AV8A 1P3BD 3AZHA 2F8ND 3W96A 1P3KD 1P3AC 2NZDB 5CP6B 3AZNB 3EPKA 2AROC 3AYWD 5CHLB 3AV2A 4J8UD 5B24C 3LJAB 5GT3C 4KGCC 2BYMB 3B6GC 3W97B 4ZUXA 4ZUXB 2YFWB 5G49B 5E5AA 1KX5A 5B0ZA 4XUJD 2FJ7C 3REIA 5AV9D 3REIB 4QLCA 3RELC 3W98C 1F66C 1F1EA 3AZHD 3W96D 3WKJA 4KUDA 5AV5A 3WTPC 5CP6D 4DRAA 5B31A 5B31B 1U35C 2DQNC 4G91B 5DNMC 5B2IB 4YS3C 3MGQA 3MGQB 5BO0A 3VH5T 5AV6A 5AV6B 3H0RC 4ZUXD 4HGAC 4WU9B 3AN2A 1KX5D 4ZBJC 5B0ZD 3KXBC 3X1UB 3WA9B 4J8WC 3EG5B 3REID 4QLCD 5B2JA 1AOIB 4KHAA 4KHAB 5BT1C 5KDMA 5B1MC 5CPJC 3WKJD 3MVDA 5AV5D 3AZMA 5B31D 3X1TC 5B1LC 1ID3B 3VH6W 5GSUB 3AZJA 3AZJB 4Z66B 4UUZA 4UUZB 3A1IA 5AY8C 3MGQD 1P3GA 5BNXA 1P3BC 5B40A 1P3KC 5AVCB 5B40B 5AV6D 2G5IC 4H9PA 1HTAA 4H9PB 1P3IA 4WU9D 3AYWC 3X1UD 4X23A 4R8PA 1AOID 5B2JD 4R8PB 3B6FB 3B6FA 4Z5TC 1KX3C 3AZFA 5FUGA 5B24B 5FUGB 1M18A 1P3OA 3MVDD 5GT3B 5DNNB 3AZMD 1M18B 2HIOB 3UTBB 4XUJC 3LELA 1JFIA 5F99A 3LELB 2VQRA 3LZ0A 3AZJD 1TZYA 3C1CA 3MGPA 1P3GD 3AZHC 2FFFB 3W96C 5B40D 5AVCD 5CP6C 3MNNA 3MNNB 3W98B 2L5AA 3AZKB 1P34A 3B0DB 4NE5A 3WTPB 5B33A 4X23D 5B33B 1A7WA 3NQUB 4R8PD 3LJAC 3B6FD 1B6WA 5JRGB 4ZUXC 1M18D 1P3OD 5DNND 2HIOD 5B0ZC 3LELD 1M19B 3REIC 4QLCC 3LZ0D 1TZYD 3KXBB 3C1CD 3WAAA 3WAAB 1S32A 3V9RB 1EQZA 2BYKA 1EQZB 1ZLAB 3MNND 5B31C 5CPKA 3AZKD 1KX4A 5GXQA 1KX4B 2PYOA 4G91C 3MGSA 3X1VA 3X1VB 5B2IC 5B33D 3MGQC 4H9QA 5BS7C 5C3IB 5AV6C 3H0MC 5JRGD 3AFAA 2F8NB 1P3KB 4WU9C 3WA9C 3X1UC 1M19D 1P34D 1AOIC 5B2JC 3MGRA 3WAAD 2CWEA 1S32D 5AVBA 4J8UB 1EQZD 2IO5B 3MVDC 5BNVB 3AZIA 3AZIB 5CPKD 1KX4D 5GXQD 1ID3C 4LD9A 2PYOD 3AZJC 3MGSD 3X1VD 5GT0A 4H9NA 1P3GC 4CSRA 5AV9B 1M1AA 1M1AB 2ZY4A 5AVCC 5B40C 4WJ3C 5AV8B 3AFAD 3AZHB 3W96B 2RVQD 2Y2NA 4X23C 4R8PC 3B6FC 3MGRD 3C1BA 3AV2B 1M18C 1P3OC 5DNNC 3AZID 1ULYA 2HIOC 4J8VA 2RIQA 4J8VB 3REJA 2G5HC 3LELC 3A6NA 3UTBC 3A6NB 5E5AB 3LZ0C 3LZ1A 1TZYC 1KX5B 5B0ZB 3C1CC 3VH5W 1BH9A 4QLCB 1M1AD 3MNNC 3KUYA 5AV8D 3AZKC 3EPHA 3WKJB 3B0DC 4KUDB 5AV5B 3X1SA 3X1SB 2ZY3A 3REHA 5B33C 3B0CT 2Y2LA 1HQ3A 3C1BD 3AV2D 5JRGC 5BO0B 4J8VD 3REJD 1M19C 3A6ND 5E5AD 2Y2MA 2F8NK 3AN2B 3WAAC 1S32C 1EQZC 5B2JB 3AZLA 1ZLAC 3AZLB 3KUYD 5KDMB 1KX4C 5GXQC 4KUDD 3MVDB 3X1VC 3AZMB 5JA4A 3X1SD 5JA4B 3A1KA 1HQ3D 4G92B 4Z2MH 5C3IC 2DF4C 5BNXB 1P3GB 2RVQC 1P3LA 4WU8A 1P3MA 3O62A 1BH8A 1P3IB 3AN2D 3MGRC 4X23B 4J8UC 2IO5C 3AZLD 4Z2MG 1H3OA 2FJ7A 3AZIC 4XZQA 3AZFB 1P3OB 2Y2JA 1JFIB 5F99B 5AV9C 4WV4B 3LZ0B 1M1AC 1TZYB 3C1CB 3MGPB 5AV8C 2W8SA 3KWQA 3IP4C 4WU8D 1P3MD 3O62D 3W99A 1P3ID 3W99B 1P3AA 1P34B 3NQJA 3AV2C 2JSSA 2Y2KA 3AZEA 2FJ7D 3AZEB 4WNNA 4J8VC 2Y2GA 3AZFD 3A6NC 4KGCA 5E5AC 3B6GA 1KX5C 5F99D 3UT9A 4UPKA 3MGPD 3KUYC 5B32G 3RELA 1S32B 3KWQD 2BYKB 5B0YA 3WKJC 5B0YB 5AV5C 4KUDC 1F66A 3KSYA 3X1SC 5CPKB 1WWIA 3W99D 5GXQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO B;  3MGS B;  1HQ3 C;  4NE3 A;  4CAY A;  4H9Q B;  1U35 A;  5DNM A;  3AZE D;  4H9O A;  3AV1 A;  3AFA B;  3AV1 B;  4KGC D;  3AN2 C;  3UT9 D;  3TU4 A;  3AZL C;  3MGR B;  4YM6 A;  4YM6 B;  3WTP E;  4J8W A;  5AVB B;  5B0Y D;  3AZM C;  5B1M A;  3VH5 A;  1R4V A;  5B32 A;  4LD9 B;  3REK A;  4G92 C;  5GT0 B;  1P3P A;  1P3P B;  4H9N B;  4CSR B;  5AY8 A;  4WU8 C;  3AV1 D;  3O62 C;  1P3I C;  3AZG A;  3AZG B;  3TU4 D;  2HUE B;  3UTA A;  4YM6 D;  4JJN A;  3R45 A;  4JJN B;  3R45 B;  3C1B B;  2CV5 A;  2FJ7 C;  2CV5 B;  4H9S A;  5AVB D;  3AZF C;  1KU5 A;  4Z5T A;  1Q9C A;  1KX3 A;  3REJ B;  4J8X A;  5F99 C;  5CPI A;  1P3F A;  1P3F B;  5B32 D;  4LD9 D;  4M6B A;  3REK D;  3LZ1 B;  5GT0 D;  3MGP C;  1P3P D;  1BH9 B;  3KWQ C;  5AY8 D;  3KUY B;  2LY8 A;  3W99 C;  3VH6 A;  1P34 C;  2NZD A;  5CP6 A;  3AZG D;  3AZN A;  3REH B;  2YFV A;  2YFV B;  1HQ3 B;  3UTA D;  4JJN D;  3AZE C;  2CV5 D;  2NQB A;  2NQB B;  3LJA A;  4E44 A;  2BYM A;  4Z5T D;  3W97 A;  1KX3 D;  2YFW A;  4J8X D;  5CPI D;  5G49 A;  1P3F D;  3UT9 C;  4H9R A;  3LZ1 D;  4H9R B;  5B0Y C;  4NFT A;  4AWL B;  4EO5 B;  5CPK C;  2NZD D;  2PYO C;  3MGS C;  3REH D;  3AZN D;  3B0B A;  5B2I A;  2NQB D;  3AFA C;  3LJA D;  3AV1 C;  5BS7 A;  1P3L B;  3W97 D;  4WU8 B;  4WZS B;  1P3M B;  3O62 B;  4WU9 A;  1BH8 B;  3TU4 C;  3WA9 A;  3X1U A;  4YM6 C;  5AVB C;  1AOI A;  1H3O B;  2FJ7 B;  4XZQ B;  1B67 A;  1TAF A;  1TAF B;  5B32 C;  4LD9 C;  3REK C;  5GT0 C;  1P3P C;  1ID3 A;  5GSU A;  5B2I D;  4Z66 A;  5AVC A;  3KWQ B;  1P3L D;  3AZG C;  2HUE C;  1P3A B;  4E45 A;  3WA9 D;  3UTA C;  4JJN C;  3C1B C;  3NQJ B;  2ARO A;  2CV5 C;  2ARO B;  4H9S C;  4XZQ D;  4WNN B;  4NE6 A;  3VH6 T;  5B24 A;  3REJ C;  4J8X C;  5CPI C;  1P3F C;  5GT3 A;  5DNN A;  4KGC B;  2HIO A;  3LZ1 C;  3UTB A;  3B6G B;  1BFM A;  2F8N H;  1ID3 D;  5GSU D;  3UT9 B;  4Z66 D;  3REL B;  2NZD C;  3W98 A;  1F66 B;  3REH C;  3AZK A;  3AZN C;  1P3A D;  3WTP A;  2F8N G;  4CAY B;  2ARO D;  3NQU A;  2NQB C;  1U35 B;  5DNM B;  4YS3 A;  4YS3 B;  4H9O B;  3W97 C;  5JRG A;  5B24 D;  5GT3 D;  3UTB D;  3B6G D;  1M19 A;  4HGA B;  3TU4 B;  3KXB A;  4ZBJ B;  4J8W B;  3V9R A;  4AWL C;  4EO5 C;  3REL D;  1ZLA A;  3W98 D;  1F66 D;  1WWS A;  5B1M B;  5CPJ A;  5CPJ B;  3WTP D;  5B32 B;  3REK B;  3X1T A;  5B1L A;  3X1T B;  5B1L B;  1U35 D;  5DNM D;  4YS3 D;  5AY8 B;  1P3L C;  1P3B A;  1P3B B;  1P3M C;  2F8N A;  1P3K A;  3AYW A;  3AYW B;  3KXB D;  3UTA B;  4J8W D;  4DRB A;  4XZQ C;  4J8U A;  3B0C W;  1ZLA D;  5BNV A;  5BT1 D;  4Z5T B;  1KX3 B;  5B1M D;  5CPJ D;  4J8X B;  5GSU C;  1N1J A;  5CPI B;  1N1J B;  4Z66 C;  4XUJ A;  5B1L D;  4XUJ B;  3X1T D;  5AV9 A;  5B31 G;  5AV8 A;  1P3B D;  3AZH A;  2F8N D;  3W96 A;  1P3K D;  1P3A C;  2NZD B;  5CP6 B;  3AZN B;  2ARO C;  3AYW D;  5CHL B;  3AV2 A;  4J8U D;  5B24 C;  3LJA B;  5GT3 C;  4KGC C;  2BYM B;  3B6G C;  3W97 B;  4ZUX A;  4ZUX B;  2YFW B;  5G49 B;  5E5A A;  1KX5 A;  5B0Z A;  4XUJ D;  3REI A;  5AV9 D;  3REI B;  4QLC A;  3REL C;  3W98 C;  1F66 C;  1F1E A;  3AZH D;  3W96 D;  3WKJ A;  4KUD A;  5AV5 A;  3WTP C;  5CP6 D;  4DRA A;  5B31 A;  5B31 B;  1U35 C;  4G91 B;  5DNM C;  5B2I B;  4YS3 C;  3MGQ A;  3MGQ B;  5BO0 A;  3VH5 T;  5AV6 A;  5AV6 B;  4ZUX D;  4HGA C;  4WU9 B;  3AN2 A;  1KX5 D;  4ZBJ C;  5B0Z D;  3KXB C;  3X1U B;  3WA9 B;  4J8W C;  3REI D;  4QLC D;  5B2J A;  1AOI B;  4KHA A;  4KHA B;  5BT1 C;  5KDM A;  5B1M C;  5CPJ C;  3WKJ D;  3MVD A;  5AV5 D;  3AZM A;  5B31 D;  3X1T C;  5B1L C;  1ID3 B;  3VH6 W;  5GSU B;  3AZJ A;  3AZJ B;  4Z66 B;  4UUZ A;  4UUZ B;  5AY8 C;  3MGQ D;  1P3G A;  5BNX A;  1P3B C;  5B40 A;  1P3K C;  5AVC B;  5B40 B;  5AV6 D;  4H9P A;  1HTA A;  4H9P B;  1P3I A;  4WU9 D;  3AYW C;  3X1U D;  4X23 A;  4R8P A;  1AOI D;  5B2J D;  4R8P B;  3B6F B;  3B6F A;  4Z5T C;  1KX3 C;  3AZF A;  5FUG A;  5B24 B;  5FUG B;  1M18 A;  1P3O A;  3MVD D;  5GT3 B;  5DNN B;  3AZM D;  1M18 B;  2HIO B;  3UTB B;  4XUJ C;  3LEL A;  1JFI A;  5F99 A;  3LEL B;  3LZ0 A;  3AZJ D;  1TZY A;  3C1C A;  3MGP A;  1P3G D;  3AZH C;  3W96 C;  5B40 D;  5AVC D;  5CP6 C;  3MNN A;  3MNN B;  3W98 B;  2L5A A;  3AZK B;  1P34 A;  3B0D B;  4NE5 A;  3WTP B;  5B33 A;  4X23 D;  5B33 B;  1A7W A;  3NQU B;  4R8P D;  3LJA C;  3B6F D;  1B6W A;  5JRG B;  4ZUX C;  1M18 D;  1P3O D;  5DNN D;  2HIO D;  5B0Z C;  3LEL D;  1M19 B;  3REI C;  4QLC C;  3LZ0 D;  1TZY D;  3KXB B;  3C1C D;  3WAA A;  3WAA B;  1S32 A;  3V9R B;  1EQZ A;  2BYK A;  1EQZ B;  1ZLA B;  3MNN D;  5B31 C;  5CPK A;  3AZK D;  1KX4 A;  5GXQ A;  1KX4 B;  2PYO A;  4G91 C;  3MGS A;  3X1V A;  3X1V B;  5B2I C;  5B33 D;  3MGQ C;  4H9Q A;  5BS7 C;  5C3I B;  5AV6 C;  3AFA A;  5JRG D;  2F8N B;  1P3K B;  4WU9 C;  3WA9 C;  3X1U C;  1M19 D;  1P34 D;  1AOI C;  5B2J C;  3MGR A;  3WAA D;  2CWE A;  1S32 D;  5AVB A;  4J8U B;  1EQZ D;  2IO5 B;  3MVD C;  5BNV B;  3AZI A;  3AZI B;  5CPK D;  1KX4 D;  5GXQ D;  1ID3 C;  4LD9 A;  2PYO D;  3AZJ C;  3MGS D;  3X1V D;  5GT0 A;  4H9N A;  1P3G C;  4CSR A;  5AV9 B;  1M1A A;  1M1A B;  5AVC C;  5B40 C;  5AV8 B;  3AFA D;  3AZH B;  3W96 B;  2RVQ D;  4X23 C;  4R8P C;  3B6F C;  3MGR D;  3C1B A;  3AV2 B;  1M18 C;  1P3O C;  5DNN C;  3AZI D;  1ULY A;  2HIO C;  4J8V A;  4J8V B;  3REJ A;  3UTB C;  3LEL C;  3A6N A;  3A6N B;  5E5A B;  3LZ0 C;  3LZ1 A;  1TZY C;  1KX5 B;  5B0Z B;  3C1C C;  3VH5 W;  1BH9 A;  4QLC B;  1M1A D;  3MNN C;  3KUY A;  5AV8 D;  3AZK C;  3WKJ B;  3B0D C;  4KUD B;  5AV5 B;  3X1S A;  3X1S B;  3REH A;  5B33 C;  3B0C T;  1HQ3 A;  3C1B D;  3AV2 D;  5JRG C;  5BO0 B;  4J8V D;  3REJ D;  1M19 C;  3A6N D;  5E5A D;  2F8N K;  3AN2 B;  3WAA C;  1S32 C;  1EQZ C;  5B2J B;  3AZL A;  1ZLA C;  3AZL B;  3KUY D;  5KDM B;  1KX4 C;  5GXQ C;  4KUD D;  3MVD B;  3X1V C;  3AZM B;  5JA4 A;  3X1S D;  5JA4 B;  1HQ3 D;  4G92 B;  4Z2M H;  5C3I C;  1P3G B;  5BNX B;  2RVQ C;  1P3L A;  4WU8 A;  1P3M A;  3O62 A;  1BH8 A;  1P3I B;  3AN2 D;  3MGR C;  4X23 B;  4J8U C;  2IO5 C;  3AZL D;  4Z2M G;  1H3O A;  2FJ7 A;  3AZI C;  4XZQ A;  3AZF B;  1P3O B;  1JFI B;  5F99 B;  5AV9 C;  4WV4 B;  3LZ0 B;  1M1A C;  1TZY B;  3C1C B;  3MGP B;  5AV8 C;  3KWQ A;  4WU8 D;  1P3M D;  3O62 D;  3W99 A;  1P3I D;  3W99 B;  1P3A A;  1P34 B;  3NQJ A;  3AV2 C;  2JSS A;  3AZE A;  2FJ7 D;  3AZE B;  4WNN A;  4J8V C;  3AZF D;  3A6N C;  4KGC A;  5E5A C;  3B6G A;  1KX5 C;  5F99 D;  3UT9 A;  3MGP D;  3KUY C;  5B32 G;  3REL A;  1S32 B;  3KWQ D;  2BYK B;  5B0Y A;  3WKJ C;  5B0Y B;  5AV5 C;  4KUD C;  1F66 A;  3KSY A;  3X1S C;  5CPK B;  1WWI A;  3W99 D;  5GXQ B; 
#chains in the Genus database with same CATH topology
 2PYO B;  3MGS B;  1HQ3 C;  4NE3 A;  4CAY A;  3KFU G;  4H9Q B;  1U35 A;  5DNM A;  3AZE D;  4H9O A;  3AV1 A;  3AFA B;  3AV1 B;  4KGC D;  3AN2 C;  3UT9 D;  3TU4 A;  3AZL C;  3MGR B;  4YM6 A;  4YM6 B;  3WTP E;  4J8W A;  3F6T A;  5AVB B;  5B0Y D;  3AZM C;  2Y2O A;  2ZY2 A;  5B1M A;  3VH5 A;  1R4V A;  5B32 A;  4LD9 B;  3REK A;  4G92 C;  5GT0 B;  1P3P A;  1P3P B;  4H9N B;  4CSR B;  5AY8 A;  4WU8 C;  3EPL A;  3AV1 D;  3O62 C;  1P3I C;  2XD5 A;  3AZG A;  3AZG B;  3TU4 D;  2HUE B;  3UTA A;  4YM6 D;  4JJN A;  1PZR A;  3R45 A;  3R45 B;  3C1B B;  4JJN B;  2CV5 A;  2CV5 B;  4H9S A;  5AVB D;  3AZF C;  1KU5 A;  4Z5T A;  1Q9C A;  1KX3 A;  3REJ B;  4J8X A;  5F99 C;  5CPI A;  1P3F A;  1P3F B;  5B32 D;  4LD9 D;  4M6B A;  3REK D;  3LZ1 B;  5GT0 D;  3MGP C;  1P3P D;  1BH9 B;  3KWQ C;  5AY8 D;  2XD1 A;  3KUY B;  2LY8 A;  3W99 C;  3VH6 A;  1P34 C;  2NZD A;  5CP6 A;  2BG1 A;  3AZG D;  3AZN A;  3REH B;  2YFV A;  2YFV B;  1HQ3 B;  3UTA D;  4JJN D;  3AZE C;  2CV5 D;  2NQB A;  2NQB B;  3LJA A;  4E44 A;  2BYM A;  4Z5T D;  3W97 A;  1KX3 D;  2YFW A;  4J8X D;  2JCH A;  5G49 A;  5CPI D;  1P3F D;  3UT9 C;  4H9R A;  3LZ1 D;  4H9R B;  5B0Y C;  4NFT A;  4AWL B;  4EO5 B;  5CPK C;  2NZD D;  2PYO C;  3MGS C;  3REH D;  3AZN D;  3B0B A;  5B2I A;  2NQB D;  3AFA C;  3LJA D;  3AV1 C;  5BS7 A;  1P3L B;  3W97 D;  4WU8 B;  4WZS B;  1P3M B;  1T3U A;  3O62 B;  4WU9 A;  1BH8 B;  3P5J B;  3TU4 C;  3WA9 A;  3X1U A;  4YM6 C;  2Y2Q A;  5AVB C;  1AOI A;  1H3O B;  2FJ7 B;  4XZQ B;  1B67 A;  1TAF A;  1TAF B;  5B32 C;  4LD9 C;  3REK C;  5GT0 C;  1P3P C;  1ID3 A;  5GSU A;  5B2I D;  4Z66 A;  3FDD A;  5AVC A;  3KWQ B;  1P3L D;  3AZG C;  2HUE C;  1P3A B;  4E45 A;  3WA9 D;  3UTA C;  4JJN C;  3H0L C;  3C1B C;  3NQJ B;  2ARO A;  2CV5 C;  2ARO B;  4H9S C;  1Z2C B;  4DQY B;  4XZQ D;  4WNN B;  4NE6 A;  3VH6 T;  5B24 A;  3REJ C;  4J8X C;  5CPI C;  1P3F C;  5GT3 A;  5DNN A;  2Y2P A;  4KGC B;  2HIO A;  2J8P A;  3LZ1 C;  3UTB A;  3B6G B;  1BFM A;  2F8N H;  1ID3 D;  5GSU D;  3UT9 B;  4Z66 D;  3REL B;  2NZD C;  3W98 A;  1F66 B;  3REH C;  3AZK A;  3AZN C;  1P3A D;  3WTP A;  2F8N G;  4CAY B;  2ARO D;  3NQU A;  2NQB C;  1U35 B;  5DNM B;  4YS3 A;  4YS3 B;  4H9O B;  3W97 C;  5JRG A;  5B24 D;  2Y2H A;  5GT3 D;  3UTB D;  3B6G D;  1M19 A;  4HGA B;  3TU4 B;  3KXB A;  4ZBJ B;  4J8W B;  3V9R A;  4AWL C;  4EO5 C;  3REL D;  1ZLA A;  3W98 D;  1F66 D;  1WWS A;  5B1M B;  5CPJ A;  2ZM5 A;  5CPJ B;  3WTP D;  5B32 B;  3REK B;  3X1T A;  5B1L A;  3X1T B;  5B1L B;  2F2A C;  3EPJ A;  1U35 D;  5DNM D;  4YS3 D;  5AY8 B;  1P3L C;  2Y2I A;  1P3B A;  1P3B B;  1P3M C;  2F8N A;  1P3K A;  1W2E A;  3AYW A;  3AYW B;  3KXB D;  2UWX A;  2ZY5 A;  4J8W D;  3UTA B;  4DRB A;  4XZQ C;  4J8U A;  3B0C W;  1ZLA D;  5BNV A;  5BT1 D;  4Z5T B;  1KX3 B;  5B1M D;  5CPJ D;  4J8X B;  5GSU C;  1N1J A;  5CPI B;  1N1J B;  4Z66 C;  4XUJ A;  5B1L D;  4XUJ B;  3X1T D;  2JE5 A;  5AV9 A;  3AL0 C;  5B31 G;  5AV8 A;  1P3B D;  3AZH A;  2F8N D;  3W96 A;  1P3K D;  1P3A C;  2NZD B;  5CP6 B;  3AZN B;  3EPK A;  2ARO C;  3AYW D;  5CHL B;  3AV2 A;  4J8U D;  5B24 C;  3LJA B;  5GT3 C;  4KGC C;  2BYM B;  3B6G C;  3W97 B;  4ZUX A;  4ZUX B;  2YFW B;  5G49 B;  5E5A A;  1KX5 A;  5B0Z A;  4XUJ D;  2FJ7 C;  3REI A;  5AV9 D;  3REI B;  4QLC A;  3REL C;  3W98 C;  1F66 C;  1F1E A;  3AZH D;  3W96 D;  3WKJ A;  4KUD A;  5AV5 A;  3WTP C;  5CP6 D;  4DRA A;  5B31 A;  5B31 B;  1U35 C;  2DQN C;  4G91 B;  5DNM C;  5B2I B;  4YS3 C;  3MGQ A;  3MGQ B;  5BO0 A;  3VH5 T;  5AV6 A;  5AV6 B;  3H0R C;  4ZUX D;  4HGA C;  4WU9 B;  3AN2 A;  1KX5 D;  4ZBJ C;  5B0Z D;  3KXB C;  3X1U B;  3WA9 B;  4J8W C;  3EG5 B;  3REI D;  4QLC D;  5B2J A;  1AOI B;  4KHA A;  4KHA B;  5BT1 C;  5KDM A;  5B1M C;  5CPJ C;  3WKJ D;  3MVD A;  5AV5 D;  3AZM A;  5B31 D;  3X1T C;  5B1L C;  1ID3 B;  3VH6 W;  5GSU B;  3AZJ A;  3AZJ B;  4Z66 B;  4UUZ A;  4UUZ B;  3A1I A;  5AY8 C;  3MGQ D;  1P3G A;  5BNX A;  1P3B C;  5B40 A;  1P3K C;  5AVC B;  5B40 B;  5AV6 D;  2G5I C;  4H9P A;  1HTA A;  4H9P B;  1P3I A;  4WU9 D;  3AYW C;  3X1U D;  4X23 A;  4R8P A;  1AOI D;  5B2J D;  4R8P B;  3B6F B;  3B6F A;  4Z5T C;  1KX3 C;  3AZF A;  5FUG A;  5B24 B;  5FUG B;  1M18 A;  1P3O A;  3MVD D;  5GT3 B;  5DNN B;  3AZM D;  1M18 B;  2HIO B;  3UTB B;  4XUJ C;  3LEL A;  1JFI A;  5F99 A;  3LEL B;  2VQR A;  3LZ0 A;  3AZJ D;  1TZY A;  3C1C A;  3MGP A;  1P3G D;  3AZH C;  2FFF B;  3W96 C;  5B40 D;  5AVC D;  5CP6 C;  3MNN A;  3MNN B;  3W98 B;  2L5A A;  3AZK B;  1P34 A;  3B0D B;  4NE5 A;  3WTP B;  5B33 A;  4X23 D;  5B33 B;  1A7W A;  3NQU B;  4R8P D;  3LJA C;  3B6F D;  1B6W A;  5JRG B;  4ZUX C;  1M18 D;  1P3O D;  5DNN D;  2HIO D;  5B0Z C;  3LEL D;  1M19 B;  3REI C;  4QLC C;  3LZ0 D;  1TZY D;  3KXB B;  3C1C D;  3WAA A;  3WAA B;  1S32 A;  3V9R B;  1EQZ A;  2BYK A;  1EQZ B;  1ZLA B;  3MNN D;  5B31 C;  5CPK A;  3AZK D;  1KX4 A;  5GXQ A;  1KX4 B;  2PYO A;  4G91 C;  3MGS A;  3X1V A;  3X1V B;  5B2I C;  5B33 D;  3MGQ C;  4H9Q A;  5BS7 C;  5C3I B;  5AV6 C;  3H0M C;  5JRG D;  3AFA A;  2F8N B;  1P3K B;  4WU9 C;  3WA9 C;  3X1U C;  1M19 D;  1P34 D;  1AOI C;  5B2J C;  3MGR A;  3WAA D;  2CWE A;  1S32 D;  5AVB A;  4J8U B;  1EQZ D;  2IO5 B;  3MVD C;  5BNV B;  3AZI A;  3AZI B;  5CPK D;  1KX4 D;  5GXQ D;  1ID3 C;  4LD9 A;  2PYO D;  3AZJ C;  3MGS D;  3X1V D;  5GT0 A;  4H9N A;  1P3G C;  4CSR A;  5AV9 B;  1M1A A;  1M1A B;  2ZY4 A;  5AVC C;  5B40 C;  4WJ3 C;  5AV8 B;  3AFA D;  3AZH B;  3W96 B;  2RVQ D;  2Y2N A;  4X23 C;  4R8P C;  3B6F C;  3MGR D;  3C1B A;  3AV2 B;  1M18 C;  1P3O C;  5DNN C;  3AZI D;  1ULY A;  2HIO C;  4J8V A;  2RIQ A;  4J8V B;  3REJ A;  2G5H C;  3LEL C;  3A6N A;  3UTB C;  3A6N B;  5E5A B;  3LZ0 C;  3LZ1 A;  1TZY C;  1KX5 B;  5B0Z B;  3C1C C;  3VH5 W;  1BH9 A;  4QLC B;  1M1A D;  3MNN C;  3KUY A;  5AV8 D;  3AZK C;  3EPH A;  3WKJ B;  3B0D C;  4KUD B;  5AV5 B;  3X1S A;  3X1S B;  2ZY3 A;  3REH A;  5B33 C;  3B0C T;  2Y2L A;  1HQ3 A;  3C1B D;  3AV2 D;  5JRG C;  5BO0 B;  4J8V D;  3REJ D;  1M19 C;  3A6N D;  5E5A D;  2Y2M A;  2F8N K;  3AN2 B;  3WAA C;  1S32 C;  1EQZ C;  5B2J B;  3AZL A;  1ZLA C;  3AZL B;  3KUY D;  5KDM B;  1KX4 C;  5GXQ C;  4KUD D;  3MVD B;  3X1V C;  3AZM B;  5JA4 A;  3X1S D;  5JA4 B;  3A1K A;  1HQ3 D;  4G92 B;  4Z2M H;  5C3I C;  2DF4 C;  5BNX B;  1P3G B;  2RVQ C;  1P3L A;  4WU8 A;  1P3M A;  3O62 A;  1BH8 A;  1P3I B;  3AN2 D;  3MGR C;  4X23 B;  4J8U C;  2IO5 C;  3AZL D;  4Z2M G;  1H3O A;  2FJ7 A;  3AZI C;  4XZQ A;  3AZF B;  1P3O B;  2Y2J A;  1JFI B;  5F99 B;  5AV9 C;  4WV4 B;  3LZ0 B;  1M1A C;  1TZY B;  3C1C B;  3MGP B;  5AV8 C;  2W8S A;  3KWQ A;  3IP4 C;  4WU8 D;  1P3M D;  3O62 D;  3W99 A;  1P3I D;  3W99 B;  1P3A A;  1P34 B;  3NQJ A;  3AV2 C;  2JSS A;  2Y2K A;  3AZE A;  2FJ7 D;  3AZE B;  4WNN A;  4J8V C;  2Y2G A;  3AZF D;  3A6N C;  4KGC A;  5E5A C;  3B6G A;  1KX5 C;  5F99 D;  3UT9 A;  4UPK A;  3MGP D;  3KUY C;  5B32 G;  3REL A;  1S32 B;  3KWQ D;  2BYK B;  5B0Y A;  3WKJ C;  5B0Y B;  5AV5 C;  4KUD C;  1F66 A;  3KSY A;  3X1S C;  5CPK B;  1WWI A;  3W99 D;  5GXQ B; 
#chains in the Genus database with same CATH homology
 2PYO B;  3MGS B;  1HQ3 C;  4NE3 A;  4CAY A;  3KFU G;  4H9Q B;  1U35 A;  5DNM A;  3AZE D;  4H9O A;  3AV1 A;  3AFA B;  3AV1 B;  4KGC D;  3AN2 C;  3UT9 D;  3TU4 A;  3AZL C;  3MGR B;  4YM6 A;  4YM6 B;  3WTP E;  4J8W A;  3F6T A;  5AVB B;  5B0Y D;  3AZM C;  2Y2O A;  2ZY2 A;  5B1M A;  3VH5 A;  1R4V A;  5B32 A;  4LD9 B;  3REK A;  4G92 C;  5GT0 B;  1P3P A;  1P3P B;  4H9N B;  4CSR B;  5AY8 A;  4WU8 C;  3EPL A;  3AV1 D;  3O62 C;  1P3I C;  2XD5 A;  3AZG A;  3AZG B;  3TU4 D;  2HUE B;  3UTA A;  4YM6 D;  4JJN A;  1PZR A;  3R45 A;  3R45 B;  3C1B B;  4JJN B;  2CV5 A;  2CV5 B;  4H9S A;  5AVB D;  3AZF C;  1KU5 A;  4Z5T A;  1Q9C A;  1KX3 A;  3REJ B;  4J8X A;  5F99 C;  5CPI A;  1P3F A;  1P3F B;  5B32 D;  4LD9 D;  4M6B A;  3REK D;  3LZ1 B;  5GT0 D;  3MGP C;  1P3P D;  1BH9 B;  3KWQ C;  5AY8 D;  2XD1 A;  3KUY B;  2LY8 A;  3W99 C;  3VH6 A;  1P34 C;  2NZD A;  5CP6 A;  2BG1 A;  3AZG D;  3AZN A;  3REH B;  2YFV A;  2YFV B;  1HQ3 B;  3UTA D;  4JJN D;  3AZE C;  2CV5 D;  2NQB A;  2NQB B;  3LJA A;  4E44 A;  2BYM A;  4Z5T D;  3W97 A;  1KX3 D;  2YFW A;  4J8X D;  2JCH A;  5G49 A;  5CPI D;  1P3F D;  3UT9 C;  4H9R A;  3LZ1 D;  4H9R B;  5B0Y C;  4NFT A;  4AWL B;  4EO5 B;  5CPK C;  2NZD D;  2PYO C;  3MGS C;  3REH D;  3AZN D;  3B0B A;  5B2I A;  2NQB D;  3AFA C;  3LJA D;  3AV1 C;  5BS7 A;  1P3L B;  3W97 D;  4WU8 B;  4WZS B;  1P3M B;  1T3U A;  3O62 B;  4WU9 A;  1BH8 B;  3P5J B;  3TU4 C;  3WA9 A;  3X1U A;  4YM6 C;  2Y2Q A;  5AVB C;  1AOI A;  1H3O B;  2FJ7 B;  4XZQ B;  1B67 A;  1TAF A;  1TAF B;  5B32 C;  4LD9 C;  3REK C;  5GT0 C;  1P3P C;  1ID3 A;  5GSU A;  5B2I D;  4Z66 A;  3FDD A;  5AVC A;  3KWQ B;  1P3L D;  3AZG C;  2HUE C;  1P3A B;  4E45 A;  3WA9 D;  3UTA C;  4JJN C;  3H0L C;  3C1B C;  3NQJ B;  2ARO A;  2CV5 C;  2ARO B;  4H9S C;  1Z2C B;  4DQY B;  4XZQ D;  4WNN B;  4NE6 A;  3VH6 T;  5B24 A;  3REJ C;  4J8X C;  5CPI C;  1P3F C;  5GT3 A;  5DNN A;  2Y2P A;  4KGC B;  2HIO A;  2J8P A;  3LZ1 C;  3UTB A;  3B6G B;  1BFM A;  2F8N H;  1ID3 D;  5GSU D;  3UT9 B;  4Z66 D;  3REL B;  2NZD C;  3W98 A;  1F66 B;  3REH C;  3AZK A;  3AZN C;  1P3A D;  3WTP A;  2F8N G;  4CAY B;  2ARO D;  3NQU A;  2NQB C;  1U35 B;  5DNM B;  4YS3 A;  4YS3 B;  4H9O B;  3W97 C;  5JRG A;  5B24 D;  2Y2H A;  5GT3 D;  3UTB D;  3B6G D;  1M19 A;  4HGA B;  3TU4 B;  3KXB A;  4ZBJ B;  4J8W B;  3V9R A;  4AWL C;  4EO5 C;  3REL D;  1ZLA A;  3W98 D;  1F66 D;  1WWS A;  5B1M B;  5CPJ A;  2ZM5 A;  5CPJ B;  3WTP D;  5B32 B;  3REK B;  3X1T A;  5B1L A;  3X1T B;  5B1L B;  2F2A C;  3EPJ A;  1U35 D;  5DNM D;  4YS3 D;  5AY8 B;  1P3L C;  2Y2I A;  1P3B A;  1P3B B;  1P3M C;  2F8N A;  1P3K A;  1W2E A;  3AYW A;  3AYW B;  3KXB D;  2UWX A;  2ZY5 A;  4J8W D;  3UTA B;  4DRB A;  4XZQ C;  4J8U A;  3B0C W;  1ZLA D;  5BNV A;  5BT1 D;  4Z5T B;  1KX3 B;  5B1M D;  5CPJ D;  4J8X B;  5GSU C;  1N1J A;  5CPI B;  1N1J B;  4Z66 C;  4XUJ A;  5B1L D;  4XUJ B;  3X1T D;  2JE5 A;  5AV9 A;  3AL0 C;  5B31 G;  5AV8 A;  1P3B D;  3AZH A;  2F8N D;  3W96 A;  1P3K D;  1P3A C;  2NZD B;  5CP6 B;  3AZN B;  3EPK A;  2ARO C;  3AYW D;  5CHL B;  3AV2 A;  4J8U D;  5B24 C;  3LJA B;  5GT3 C;  4KGC C;  2BYM B;  3B6G C;  3W97 B;  4ZUX A;  4ZUX B;  2YFW B;  5G49 B;  5E5A A;  1KX5 A;  5B0Z A;  4XUJ D;  2FJ7 C;  3REI A;  5AV9 D;  3REI B;  4QLC A;  3REL C;  3W98 C;  1F66 C;  1F1E A;  3AZH D;  3W96 D;  3WKJ A;  4KUD A;  5AV5 A;  3WTP C;  5CP6 D;  4DRA A;  5B31 A;  5B31 B;  1U35 C;  2DQN C;  4G91 B;  5DNM C;  5B2I B;  4YS3 C;  3MGQ A;  3MGQ B;  5BO0 A;  3VH5 T;  5AV6 A;  5AV6 B;  3H0R C;  4ZUX D;  4HGA C;  4WU9 B;  3AN2 A;  1KX5 D;  4ZBJ C;  5B0Z D;  3KXB C;  3X1U B;  3WA9 B;  4J8W C;  3EG5 B;  3REI D;  4QLC D;  5B2J A;  1AOI B;  4KHA A;  4KHA B;  5BT1 C;  5KDM A;  5B1M C;  5CPJ C;  3WKJ D;  3MVD A;  5AV5 D;  3AZM A;  5B31 D;  3X1T C;  5B1L C;  1ID3 B;  3VH6 W;  5GSU B;  3AZJ A;  3AZJ B;  4Z66 B;  4UUZ A;  4UUZ B;  3A1I A;  5AY8 C;  3MGQ D;  1P3G A;  5BNX A;  1P3B C;  5B40 A;  1P3K C;  5AVC B;  5B40 B;  5AV6 D;  2G5I C;  4H9P A;  1HTA A;  4H9P B;  1P3I A;  4WU9 D;  3AYW C;  3X1U D;  4X23 A;  4R8P A;  1AOI D;  5B2J D;  4R8P B;  3B6F B;  3B6F A;  4Z5T C;  1KX3 C;  3AZF A;  5FUG A;  5B24 B;  5FUG B;  1M18 A;  1P3O A;  3MVD D;  5GT3 B;  5DNN B;  3AZM D;  1M18 B;  2HIO B;  3UTB B;  4XUJ C;  3LEL A;  1JFI A;  5F99 A;  3LEL B;  2VQR A;  3LZ0 A;  3AZJ D;  1TZY A;  3C1C A;  3MGP A;  1P3G D;  3AZH C;  2FFF B;  3W96 C;  5B40 D;  5AVC D;  5CP6 C;  3MNN A;  3MNN B;  3W98 B;  2L5A A;  3AZK B;  1P34 A;  3B0D B;  4NE5 A;  3WTP B;  5B33 A;  4X23 D;  5B33 B;  1A7W A;  3NQU B;  4R8P D;  3LJA C;  3B6F D;  1B6W A;  5JRG B;  4ZUX C;  1M18 D;  1P3O D;  5DNN D;  2HIO D;  5B0Z C;  3LEL D;  1M19 B;  3REI C;  4QLC C;  3LZ0 D;  1TZY D;  3KXB B;  3C1C D;  3WAA A;  3WAA B;  1S32 A;  3V9R B;  1EQZ A;  2BYK A;  1EQZ B;  1ZLA B;  3MNN D;  5B31 C;  5CPK A;  3AZK D;  1KX4 A;  5GXQ A;  1KX4 B;  2PYO A;  4G91 C;  3MGS A;  3X1V A;  3X1V B;  5B2I C;  5B33 D;  3MGQ C;  4H9Q A;  5BS7 C;  5C3I B;  5AV6 C;  3H0M C;  5JRG D;  3AFA A;  2F8N B;  1P3K B;  4WU9 C;  3WA9 C;  3X1U C;  1M19 D;  1P34 D;  1AOI C;  5B2J C;  3MGR A;  3WAA D;  2CWE A;  1S32 D;  5AVB A;  4J8U B;  1EQZ D;  2IO5 B;  3MVD C;  5BNV B;  3AZI A;  3AZI B;  5CPK D;  1KX4 D;  5GXQ D;  1ID3 C;  4LD9 A;  2PYO D;  3AZJ C;  3MGS D;  3X1V D;  5GT0 A;  4H9N A;  1P3G C;  4CSR A;  5AV9 B;  1M1A A;  1M1A B;  2ZY4 A;  5AVC C;  5B40 C;  4WJ3 C;  5AV8 B;  3AFA D;  3AZH B;  3W96 B;  2RVQ D;  2Y2N A;  4X23 C;  4R8P C;  3B6F C;  3MGR D;  3C1B A;  3AV2 B;  1M18 C;  1P3O C;  5DNN C;  3AZI D;  1ULY A;  2HIO C;  4J8V A;  2RIQ A;  4J8V B;  3REJ A;  2G5H C;  3LEL C;  3A6N A;  3UTB C;  3A6N B;  5E5A B;  3LZ0 C;  3LZ1 A;  1TZY C;  1KX5 B;  5B0Z B;  3C1C C;  3VH5 W;  1BH9 A;  4QLC B;  1M1A D;  3MNN C;  3KUY A;  5AV8 D;  3AZK C;  3EPH A;  3WKJ B;  3B0D C;  4KUD B;  5AV5 B;  3X1S A;  3X1S B;  2ZY3 A;  3REH A;  5B33 C;  3B0C T;  2Y2L A;  1HQ3 A;  3C1B D;  3AV2 D;  5JRG C;  5BO0 B;  4J8V D;  3REJ D;  1M19 C;  3A6N D;  5E5A D;  2Y2M A;  2F8N K;  3AN2 B;  3WAA C;  1S32 C;  1EQZ C;  5B2J B;  3AZL A;  1ZLA C;  3AZL B;  3KUY D;  5KDM B;  1KX4 C;  5GXQ C;  4KUD D;  3MVD B;  3X1V C;  3AZM B;  5JA4 A;  3X1S D;  5JA4 B;  3A1K A;  1HQ3 D;  4G92 B;  4Z2M H;  5C3I C;  2DF4 C;  5BNX B;  1P3G B;  2RVQ C;  1P3L A;  4WU8 A;  1P3M A;  3O62 A;  1BH8 A;  1P3I B;  3AN2 D;  3MGR C;  4X23 B;  4J8U C;  2IO5 C;  3AZL D;  4Z2M G;  1H3O A;  2FJ7 A;  3AZI C;  4XZQ A;  3AZF B;  1P3O B;  2Y2J A;  1JFI B;  5F99 B;  5AV9 C;  4WV4 B;  3LZ0 B;  1M1A C;  1TZY B;  3C1C B;  3MGP B;  5AV8 C;  2W8S A;  3KWQ A;  3IP4 C;  4WU8 D;  1P3M D;  3O62 D;  3W99 A;  1P3I D;  3W99 B;  1P3A A;  1P34 B;  3NQJ A;  3AV2 C;  2JSS A;  2Y2K A;  3AZE A;  2FJ7 D;  3AZE B;  4WNN A;  4J8V C;  2Y2G A;  3AZF D;  3A6N C;  4KGC A;  5E5A C;  3B6G A;  1KX5 C;  5F99 D;  3UT9 A;  4UPK A;  3MGP D;  3KUY C;  5B32 G;  3REL A;  1S32 B;  3KWQ D;  2BYK B;  5B0Y A;  3WKJ C;  5B0Y B;  5AV5 C;  4KUD C;  1F66 A;  3KSY A;  3X1S C;  5CPK B;  1WWI A;  3W99 D;  5GXQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...