4WJ3C

Crystal structure of the asparagine transamidosome from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
96
structure length
96
Chain Sequence
MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQRLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Structure of the Pseudomonas aeruginosa transamidosome reveals unique aspects of bacterial tRNA-dependent asparagine biosynthesis
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 15
structure length 96
sequence length 96
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wj3C01
3AL0C 2G5IC 2F2AC 3H0MC 3IP4C 2DF4C 3KFUG 2DQNC 3A1IA 3A1KA 3H0LC 4WJ3C 2G5HC 3H0RC
chains in the Genus database with same CATH superfamily
1P3IB 1Q9CA 3AZED 4LD9D 4R8PC 5JRGA 1P3GA 2NZDC 3AV1A 4ZUXA 2CWEA 1M1AA 4E44A 3MVDA 3MGSC 1JFIB 3AZGA 5AVBA 4YM6C 1P34B 3W97D 5BS7C 3W98B 5E5AD 3W99A 3B6FA 3KUYC 1P3MB 1P3KD 1M19D 3H0LC 4Z5TB 5AV5C 3WA9C 3WAAC 2NQBC 5B33D 3A6NC 1U35D 5B1MD 5C3IC 3KXBB 5GT3C 4NE6A 3AZKA 1P3KA 2JSSA 1KX4C 4CAYA 5AVCC 3TU4A 3WTPA 4R8PB 3VH5A 2UWXA 3X1UD 1S32D 3AZMC 1HQ3D 2ZY2A 5B32A 5B1MA 3KWQD 1R4VA 3MGSB 5BO0B 4H9SA 2BYMB 1ID3D 5B32G 1S32A 5B1LD 5B31G 3LZ0A 4WU9D 4H9PA 3KWQA 3MGRC 3AZLC 5AV5B 5CHLB 3WAAB 4J8VC 2NQBB 3R45B 3A6NB 1ID3A 5B31C 5C3IB 4WZSB 5GT3B 5CP6C 3X1VA 3WKJC 5B0ZD 4UPKA 1ZLAD 1KX4B 3AZGB 1P3FC 4KGCD 3RELC 5AVBB 4H9QA 3VH6T 4XZQD 4H9RB 5DNNB 3AZMB 3W99B 2Y2GA 5GT0A 3AN2D 5BNXA 2JCHA 2FJ7D 3VH6W 5CPKD 3LJAC 4XUJA 3AYWD 3MGRB 1B67A 2Y2MA 4G92C 3AZLB 4QLCA 3C1CC 5CPKA 3AZID 3AV2A 1KX3C 2CV5A 5AV9D 4UUZA 3X1SD 4J8VB 1AOIA 3AZJC 3AYWA 5DNMC 5B31B 5B40D 5CP6B 3LELD 3WKJB 2Y2HA 3UTBC 3EPKA 4X23D 1P3OB 1P3FB 3RELB 4NE3A 3B0BA 3AZIA 3LZ1C 3AFAA 1P3ID 1M18A 3C1BA 5CPIA 2YFVB 5B2JD 4KHAA 4J8WC 4J8XC 1EQZC 3B6GA 3LJAB 1H3OB 2HIOD 5BT1D 2PYOD 3REKC 3X1VB 3W98D 2HUEC 4HGAC 5B2JA 3MNNA 3C1CB 3B0DC 4EO5C 5GXQC 2BG1A 5FUGB 2ZY4A 1KX3B 1N1JB 2HIOA 5CPJA 3AZFD 3AZJB 1P34C 5DNMB 5B24C 1P3BC 2PYOA 1TZYA 1P3MC 3WTPE 3KXBD 3MGPD 3UTBB 1F66A 5GSUA 3UT9C 4XUJB 5JA4A 3LZ1B 4YS3D 2NZDD 3AZFA 2F8ND 1P3AC 4J8WB 4J8XB 3AV2B 4CSRA 1EQZB 2Y2PA 2CV5B 5G49B 1AOIB 3X1TC 3O62A 4YS3A 4WU8A 4YM6D 4M6BA 5AY8A 2NZDA 3REKB 4JJND 1P3PC 2AROC 2F8NA 2HUEB 4HGAB 1P3LD 3KUYD 5F99A 2RIQA 3B0DB 5GXQB 4EO5B 3MGQA 3AFAB 3REHD 5AV8C 4Z66D 3C1BB 2G5IC 3V9RA 4WNNB 3AZEA 3WAAD 3WA9D 3W96D 4LD9A 3NQJB 2JE5A 5B24B 1P3BB 2NQBD 4AWLC 3A6ND 4JJNA 3UTAC 1P3LA 5GT3D 3REIC 3AZHC 3UT9B 1P3GC 5JRGC 1KX4D 2L5AA 3REHA 5AVCD 4ZUXC 3AV1C 3W96A 4Z66A 3VH5W 3W97A 1M1AC 5E5AA 1P3AB 3AZND 4J8UD 1M19A 3MVDC 4G91C 3AZGC 5CPJB 5AVBC 4ZBJC 3X1TB 5AVCA 3W99C 5DNNC 5B33A 1U35A 1TZYB 3B6FC 1P3PB 2AROB 4KUDD 3AZNA 4H9NA 4J8UA 3MGRD 3REJD 3AZLD 2Y2JA 5AV8B 4Z2MH 2BYKA 5B2ID 3X1UA 4J8VD 4AWLB 1HQ3A 4H9OA 5B0YD 3AZKC 1P3KC 3UTAB 4CSRB 5CP6D 3REIB 3WKJD 4KUDA 3AZHB 3TU4C 3WTPC 3REJA 1P3GB 5JRGB 5KDMA 3AV1B 4ZUXB 4Z2MG 2DF4C 5B32C 5B1MC 5B2IA 5B1LA 1M1AB 1BH8A 2YFWA 5B0YA 5F99B 4WU9A 3MVDB 1KX5D 4G91B 1P3OC 1KU5A 4H9SC 4LD9B 4ZBJB 1S32C 3B6FB 3LZ0C 3KWQC 3EPLA 5B0ZA 1ZLAA 4NFTA 5AV6D 1F1EA 3C1CD 1KX5A 4KGCA 1ID3C 1WWIA 4XZQA 3EPJA 2RVQD 3AZKB 3F6TA 3X1VC 1P3KB 3AL0C 5DNMD 3AN2A 2Y2IA 4CAYB 3TU4B 2FJ7A 3WTPB 1BH9A 1W2EA 5AV6A 5B32B 5B1MB 5GT0C 4WJ3C 2VQRA 4J8XD 4XUJC 1EQZD 3X1UB 1S32B 5AV9A 2DQNC 3X1SA 3LZ0B 4H9PB 3KWQB 5B40A 4QLCC 3LELA 3REKD 3VH6A 3AV2C 4X23A 2CV5C 5GXQD 3NQUA 1AOIC 1ID3B 3AYWC 5B1LB 1WWSA 1P3IA 2XD1A 1P34D 4WU9B 1T3UA 1P3MD 4E45A 3EG5B 3AZIC 4H9QB 3AFAC 4Z5TD 3UT9D 1M18C 3C1BC 5CPIC 1JFIA 5GT0B 5BNXB 2W8SA 3W98A 3B6GC 4Z5TA 3B0CW 3X1TD 4R8PD 5B2JC 4QLCB 3MNNC 1P3PD 3KXBA 3MGPA 5CPKB 4UUZB 2HIOC 5CPJC 3A1IA 3A1KA 3MGSD 2F8NK 3AYWB 2F8NH 5AV8D 4R8PA 2PYOC 1TZYC 1F66C 5GSUC 3AZIB 3REID 5AV5D 1M18B 1P3GD 3MGSA 5CPIB 3FDDA 3AV1D 2F8NG 5BO0A 2BYMA 4YM6A 4KHAB 5BS7A 1M1AD 3VH5T 3EPHA 3KUYA 3B6GB 3MVDD 3AZGD 5AV5A 1TAFA 4YS3C 3O62C 4WU8C 5AVBD 3WA9A 5AY8C 4DRBA 3WAAA 5B2JB 3KSYA 3W99D 3R45A 5DNND 5F99C 3MNNB 3A6NA 3AZMD 2NQBA 3MGQC 3B6FD 5GT3A 2IO5B 2HIOB 3AZEC 4LD9C 1KX4A 2ZY3A 4DRAA 2PYOB 4JJNC 1BFMA 4H9RA 5DNNA 3AZMA 2XD5A 3AZKD 1P3LC 1F66B 5GSUB 2Y2QA 5JA4B 4NE5A 3REHC 3TU4D 3WTPD 3W96C 4Z66C 3AZFB 2ZM5A 3W97C 5E5AC 5B32D 5B31D 1M19C 3MGPB 3MGRA 3AZLA 1P3OD 1P3FD 3O62B 3RELD 4WU8B 4YS3B 2NZDB 5AY8B 5B33C 1U35C 2F8NB 4J8VA 3LZ0D 3AZNC 3MGQB 5B31A 4J8UC 5CP6A 3WKJA 3IP4C 3AZEB 3V9RB 1P3OA 3X1UC 1P3FA 3LJAD 3H0MC 3RELA 4YM6B 1HQ3C 4JJNB 1P3LB 3KUYB 4KUDC 3X1VD 2YFVA 3REJC 3REHB 1TAFB 4Z66B 3WA9B 3W96B 1KX3D 3AZHA 5B2IC 3W97B 5B1LC 3LJAA 1H3OA 5E5AB 5B0YC 4DQYB 5GT0D 3AZJD 4WU9C 2J8PA 1M19B 4WV4B 5BNVA 3UTBD 3C1CA 2F2AC 5AVCB 4XUJD 5FUGA 5B33B 3LZ1D 1U35B 1KX3A 2Y2LA 1N1JA 3AZJA 3AZNB 4H9NB 5DNMA 5B0ZC 4J8UB 1ZLAC 4QLCD 1KX5C 1A7WA 4KGCC 2Y2OA 4J8WD 2BYKB 3UTBA 3AV2D 2CV5D 4XZQC 1B6WA 1HQ3B 4H9OB 3LZ1A 1AOID 1Z2CB 3AN2C 4KUDB 2FJ7C 3REJB 1HTAA 5CPKC 2G5HC 5AV6C 5KDMB 4J8WA 4J8XA 1EQZA 3AFAD 5B2IB 1BH8B 5G49A 1M18D 2YFWB 3C1BD 2RVQC 5B0YB 5CPID 5B24D 1P3BD 3REKA 3KFUG 3B6GD 5AV9C 5GXQA 3X1SC 2LY8A 2FFFB 5B40C 4WNNA 3LELC 1P34A 3B0CT 3NQJA 3P5JB 5B0ZB 5B24A 1P3AD 1P3BA 4X23C 3MNND 1P3MA 1KX5B 1ZLAB 4KGCB 3UT9A 4XZQB 1P3IC 5CPJD 3AN2B 2Y2NA 1TZYD 2AROD 5BNVB 2FJ7B 1F66D 4G92B 1BH9B 1P3AA 5AV6B 5GSUD 2IO5C 1PZRA 5BT1C 3X1TA 3W98C 1P3PA 2AROA 3H0RC 3UTAD 1ULYA 3AZHD 5AV9B 4Z5TC 3X1SB 5JRGD 3AZFC 3O62D 5AV8A 4ZUXD 4WU8D 5AY8D 5B40B 3LELB 3KXBC 3MGPC 5F99D 4X23B 3MGQD 2Y2KA 3UTAA 3NQUB 3REIA 2ZY5A
chains in the Genus database with same CATH topology
1P3IB 1Q9CA 3AZED 4LD9D 4R8PC 5JRGA 1P3GA 2NZDC 3AV1A 4ZUXA 2CWEA 1M1AA 4E44A 3MVDA 3MGSC 1JFIB 3AZGA 5AVBA 4YM6C 1P34B 3W97D 5BS7C 3W98B 5E5AD 3W99A 3B6FA 3KUYC 1P3MB 1P3KD 1M19D 3H0LC 4Z5TB 5AV5C 3WA9C 3WAAC 2NQBC 5B33D 3A6NC 1U35D 5B1MD 5C3IC 3KXBB 5GT3C 4NE6A 3AZKA 1P3KA 2JSSA 1KX4C 4CAYA 5AVCC 3TU4A 3WTPA 4R8PB 3VH5A 2UWXA 3X1UD 1S32D 3AZMC 1HQ3D 2ZY2A 5B32A 5B1MA 3KWQD 1R4VA 3MGSB 5BO0B 4H9SA 2BYMB 1ID3D 5B32G 1S32A 5B1LD 5B31G 3LZ0A 4WU9D 4H9PA 3KWQA 3MGRC 3AZLC 5AV5B 5CHLB 3WAAB 4J8VC 2NQBB 3R45B 3A6NB 1ID3A 5B31C 5C3IB 4WZSB 5GT3B 5CP6C 3X1VA 3WKJC 5B0ZD 4UPKA 1ZLAD 1KX4B 3AZGB 1P3FC 4KGCD 3RELC 5AVBB 4H9QA 3VH6T 4XZQD 4H9RB 5DNNB 3AZMB 3W99B 2Y2GA 5GT0A 3AN2D 5BNXA 2JCHA 2FJ7D 3VH6W 5CPKD 3LJAC 4XUJA 3AYWD 3MGRB 1B67A 2Y2MA 4G92C 3AZLB 4QLCA 3C1CC 5CPKA 3AZID 3AV2A 1KX3C 2CV5A 5AV9D 4UUZA 3X1SD 4J8VB 1AOIA 3AZJC 3AYWA 5DNMC 5B31B 5B40D 5CP6B 3LELD 3WKJB 2Y2HA 3UTBC 3EPKA 4X23D 1P3OB 1P3FB 3RELB 4NE3A 3B0BA 3AZIA 3LZ1C 3AFAA 1P3ID 1M18A 3C1BA 5CPIA 2YFVB 5B2JD 4KHAA 4J8WC 4J8XC 1EQZC 3B6GA 3LJAB 1H3OB 2HIOD 5BT1D 2PYOD 3REKC 3X1VB 3W98D 2HUEC 4HGAC 5B2JA 3MNNA 3C1CB 3B0DC 4EO5C 5GXQC 2BG1A 5FUGB 2ZY4A 1KX3B 1N1JB 2HIOA 5CPJA 3AZFD 3AZJB 1P34C 5DNMB 5B24C 1P3BC 2PYOA 1TZYA 1P3MC 3WTPE 3KXBD 3MGPD 3UTBB 1F66A 5GSUA 3UT9C 4XUJB 5JA4A 3LZ1B 4YS3D 2NZDD 3AZFA 2F8ND 1P3AC 4J8WB 4J8XB 3AV2B 4CSRA 1EQZB 2Y2PA 2CV5B 5G49B 1AOIB 3X1TC 3O62A 4YS3A 4WU8A 4YM6D 4M6BA 5AY8A 2NZDA 3REKB 4JJND 1P3PC 2AROC 2F8NA 2HUEB 4HGAB 1P3LD 3KUYD 5F99A 2RIQA 3B0DB 5GXQB 4EO5B 3MGQA 3AFAB 3REHD 5AV8C 4Z66D 3C1BB 2G5IC 3V9RA 4WNNB 3AZEA 3WAAD 3WA9D 3W96D 4LD9A 3NQJB 2JE5A 5B24B 1P3BB 2NQBD 4AWLC 3A6ND 4JJNA 3UTAC 1P3LA 5GT3D 3REIC 3AZHC 3UT9B 1P3GC 5JRGC 1KX4D 2L5AA 3REHA 5AVCD 4ZUXC 3AV1C 3W96A 4Z66A 3VH5W 3W97A 1M1AC 5E5AA 1P3AB 3AZND 4J8UD 1M19A 3MVDC 4G91C 3AZGC 5CPJB 5AVBC 4ZBJC 3X1TB 5AVCA 3W99C 5DNNC 5B33A 1U35A 1TZYB 3B6FC 1P3PB 2AROB 4KUDD 3AZNA 4H9NA 4J8UA 3MGRD 3REJD 3AZLD 2Y2JA 5AV8B 4Z2MH 2BYKA 5B2ID 3X1UA 4J8VD 4AWLB 1HQ3A 4H9OA 5B0YD 3AZKC 1P3KC 3UTAB 4CSRB 5CP6D 3REIB 3WKJD 4KUDA 3AZHB 3TU4C 3WTPC 3REJA 1P3GB 5JRGB 5KDMA 3AV1B 4ZUXB 4Z2MG 2DF4C 5B32C 5B1MC 5B2IA 5B1LA 1M1AB 1BH8A 2YFWA 5B0YA 5F99B 4WU9A 3MVDB 1KX5D 4G91B 1P3OC 1KU5A 4H9SC 4LD9B 4ZBJB 1S32C 3B6FB 3LZ0C 3KWQC 3EPLA 5B0ZA 1ZLAA 4NFTA 5AV6D 1F1EA 3C1CD 1KX5A 4KGCA 1ID3C 1WWIA 4XZQA 3EPJA 2RVQD 3AZKB 3F6TA 3X1VC 1P3KB 3AL0C 5DNMD 3AN2A 2Y2IA 4CAYB 3TU4B 2FJ7A 3WTPB 1BH9A 1W2EA 5AV6A 5B32B 5B1MB 5GT0C 4WJ3C 2VQRA 4J8XD 4XUJC 1EQZD 3X1UB 1S32B 5AV9A 2DQNC 3X1SA 3LZ0B 4H9PB 3KWQB 5B40A 4QLCC 3LELA 3REKD 3VH6A 3AV2C 4X23A 2CV5C 5GXQD 3NQUA 1AOIC 1ID3B 3AYWC 5B1LB 1WWSA 1P3IA 2XD1A 1P34D 4WU9B 1T3UA 1P3MD 4E45A 3EG5B 3AZIC 4H9QB 3AFAC 4Z5TD 3UT9D 1M18C 3C1BC 5CPIC 1JFIA 5GT0B 5BNXB 2W8SA 3W98A 3B6GC 4Z5TA 3B0CW 3X1TD 4R8PD 5B2JC 4QLCB 3MNNC 1P3PD 3KXBA 3MGPA 5CPKB 4UUZB 2HIOC 5CPJC 3A1IA 3A1KA 3MGSD 2F8NK 3AYWB 2F8NH 5AV8D 4R8PA 2PYOC 1TZYC 1F66C 5GSUC 3AZIB 3REID 5AV5D 1M18B 1P3GD 3MGSA 5CPIB 3FDDA 3AV1D 2F8NG 5BO0A 2BYMA 4YM6A 4KHAB 5BS7A 1M1AD 3VH5T 3EPHA 3KUYA 3B6GB 3MVDD 3AZGD 5AV5A 1TAFA 4YS3C 3O62C 4WU8C 5AVBD 3WA9A 5AY8C 4DRBA 3WAAA 5B2JB 3KSYA 3W99D 3R45A 5DNND 5F99C 3MNNB 3A6NA 3AZMD 2NQBA 3MGQC 3B6FD 5GT3A 2IO5B 2HIOB 3AZEC 4LD9C 1KX4A 2ZY3A 4DRAA 2PYOB 4JJNC 1BFMA 4H9RA 5DNNA 3AZMA 2XD5A 3AZKD 1P3LC 1F66B 5GSUB 2Y2QA 5JA4B 4NE5A 3REHC 3TU4D 3WTPD 3W96C 4Z66C 3AZFB 2ZM5A 3W97C 5E5AC 5B32D 5B31D 1M19C 3MGPB 3MGRA 3AZLA 1P3OD 1P3FD 3O62B 3RELD 4WU8B 4YS3B 2NZDB 5AY8B 5B33C 1U35C 2F8NB 4J8VA 3LZ0D 3AZNC 3MGQB 5B31A 4J8UC 5CP6A 3WKJA 3IP4C 3AZEB 3V9RB 1P3OA 3X1UC 1P3FA 3LJAD 3H0MC 3RELA 4YM6B 1HQ3C 4JJNB 1P3LB 3KUYB 4KUDC 3X1VD 2YFVA 3REJC 3REHB 1TAFB 4Z66B 3WA9B 3W96B 1KX3D 3AZHA 5B2IC 3W97B 5B1LC 3LJAA 1H3OA 5E5AB 5B0YC 4DQYB 5GT0D 3AZJD 4WU9C 2J8PA 1M19B 4WV4B 5BNVA 3UTBD 3C1CA 2F2AC 5AVCB 4XUJD 5FUGA 5B33B 3LZ1D 1U35B 1KX3A 2Y2LA 1N1JA 3AZJA 3AZNB 4H9NB 5DNMA 5B0ZC 4J8UB 1ZLAC 4QLCD 1KX5C 1A7WA 4KGCC 2Y2OA 4J8WD 2BYKB 3UTBA 3AV2D 2CV5D 4XZQC 1B6WA 1HQ3B 4H9OB 3LZ1A 1AOID 1Z2CB 3AN2C 4KUDB 2FJ7C 3REJB 1HTAA 5CPKC 2G5HC 5AV6C 5KDMB 4J8WA 4J8XA 1EQZA 3AFAD 5B2IB 1BH8B 5G49A 1M18D 2YFWB 3C1BD 2RVQC 5B0YB 5CPID 5B24D 1P3BD 3REKA 3KFUG 3B6GD 5AV9C 5GXQA 3X1SC 2LY8A 2FFFB 5B40C 4WNNA 3LELC 1P34A 3B0CT 3NQJA 3P5JB 5B0ZB 5B24A 1P3AD 1P3BA 4X23C 3MNND 1P3MA 1KX5B 1ZLAB 4KGCB 3UT9A 4XZQB 1P3IC 5CPJD 3AN2B 2Y2NA 1TZYD 2AROD 5BNVB 2FJ7B 1F66D 4G92B 1BH9B 1P3AA 5AV6B 5GSUD 2IO5C 1PZRA 5BT1C 3X1TA 3W98C 1P3PA 2AROA 3H0RC 3UTAD 1ULYA 3AZHD 5AV9B 4Z5TC 3X1SB 5JRGD 3AZFC 3O62D 5AV8A 4ZUXD 4WU8D 5AY8D 5B40B 3LELB 3KXBC 3MGPC 5F99D 4X23B 3MGQD 2Y2KA 3UTAA 3NQUB 3REIA 2ZY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL0 C;  2G5I C;  2F2A C;  3H0M C;  3IP4 C;  2DF4 C;  3KFU G;  2DQN C;  3A1I A;  3A1K A;  3H0L C;  4WJ3 C;  2G5H C;  3H0R C; 
#chains in the Genus database with same CATH topology
 1P3I B;  1Q9C A;  3AZE D;  4LD9 D;  4R8P C;  5JRG A;  1P3G A;  2NZD C;  3AV1 A;  4ZUX A;  2CWE A;  1M1A A;  4E44 A;  3MVD A;  3MGS C;  1JFI B;  3AZG A;  5AVB A;  4YM6 C;  1P34 B;  3W97 D;  5BS7 C;  3W98 B;  5E5A D;  3W99 A;  3B6F A;  3KUY C;  1P3M B;  1P3K D;  1M19 D;  3H0L C;  4Z5T B;  5AV5 C;  3WA9 C;  3WAA C;  2NQB C;  5B33 D;  3A6N C;  1U35 D;  5B1M D;  5C3I C;  3KXB B;  5GT3 C;  4NE6 A;  3AZK A;  1P3K A;  2JSS A;  1KX4 C;  4CAY A;  5AVC C;  3TU4 A;  3WTP A;  4R8P B;  3VH5 A;  2UWX A;  3X1U D;  1S32 D;  3AZM C;  1HQ3 D;  2ZY2 A;  5B32 A;  5B1M A;  3KWQ D;  1R4V A;  3MGS B;  5BO0 B;  4H9S A;  2BYM B;  1ID3 D;  5B32 G;  1S32 A;  5B1L D;  5B31 G;  3LZ0 A;  4WU9 D;  4H9P A;  3KWQ A;  3MGR C;  3AZL C;  5AV5 B;  5CHL B;  3WAA B;  4J8V C;  2NQB B;  3R45 B;  3A6N B;  1ID3 A;  5B31 C;  5C3I B;  4WZS B;  5GT3 B;  5CP6 C;  3X1V A;  3WKJ C;  5B0Z D;  4UPK A;  1ZLA D;  1KX4 B;  3AZG B;  1P3F C;  4KGC D;  3REL C;  5AVB B;  4H9Q A;  3VH6 T;  4XZQ D;  4H9R B;  5DNN B;  3AZM B;  3W99 B;  2Y2G A;  5GT0 A;  3AN2 D;  5BNX A;  2JCH A;  2FJ7 D;  3VH6 W;  5CPK D;  3LJA C;  4XUJ A;  3AYW D;  3MGR B;  1B67 A;  2Y2M A;  4G92 C;  3AZL B;  4QLC A;  3C1C C;  5CPK A;  3AZI D;  3AV2 A;  1KX3 C;  2CV5 A;  5AV9 D;  4UUZ A;  3X1S D;  4J8V B;  1AOI A;  3AZJ C;  3AYW A;  5DNM C;  5B31 B;  5B40 D;  5CP6 B;  3LEL D;  3WKJ B;  2Y2H A;  3UTB C;  3EPK A;  4X23 D;  1P3O B;  1P3F B;  3REL B;  4NE3 A;  3B0B A;  3AZI A;  3LZ1 C;  3AFA A;  1P3I D;  1M18 A;  3C1B A;  5CPI A;  2YFV B;  5B2J D;  4KHA A;  4J8W C;  4J8X C;  1EQZ C;  3B6G A;  3LJA B;  1H3O B;  2HIO D;  5BT1 D;  2PYO D;  3REK C;  3X1V B;  3W98 D;  2HUE C;  4HGA C;  5B2J A;  3MNN A;  3C1C B;  3B0D C;  4EO5 C;  5GXQ C;  2BG1 A;  5FUG B;  2ZY4 A;  1KX3 B;  1N1J B;  2HIO A;  5CPJ A;  3AZF D;  3AZJ B;  1P34 C;  5DNM B;  5B24 C;  1P3B C;  2PYO A;  1TZY A;  1P3M C;  3WTP E;  3KXB D;  3MGP D;  3UTB B;  1F66 A;  5GSU A;  3UT9 C;  4XUJ B;  5JA4 A;  3LZ1 B;  4YS3 D;  2NZD D;  3AZF A;  2F8N D;  1P3A C;  4J8W B;  4J8X B;  3AV2 B;  4CSR A;  1EQZ B;  2Y2P A;  2CV5 B;  5G49 B;  1AOI B;  3X1T C;  3O62 A;  4YS3 A;  4WU8 A;  4YM6 D;  4M6B A;  5AY8 A;  2NZD A;  3REK B;  4JJN D;  1P3P C;  2ARO C;  2F8N A;  2HUE B;  4HGA B;  1P3L D;  3KUY D;  5F99 A;  2RIQ A;  3B0D B;  5GXQ B;  4EO5 B;  3MGQ A;  3AFA B;  3REH D;  5AV8 C;  4Z66 D;  3C1B B;  2G5I C;  3V9R A;  4WNN B;  3AZE A;  3WAA D;  3WA9 D;  3W96 D;  4LD9 A;  3NQJ B;  2JE5 A;  5B24 B;  1P3B B;  2NQB D;  4AWL C;  3A6N D;  4JJN A;  3UTA C;  1P3L A;  5GT3 D;  3REI C;  3AZH C;  3UT9 B;  1P3G C;  5JRG C;  1KX4 D;  2L5A A;  3REH A;  5AVC D;  4ZUX C;  3AV1 C;  3W96 A;  4Z66 A;  3VH5 W;  3W97 A;  1M1A C;  5E5A A;  1P3A B;  3AZN D;  4J8U D;  1M19 A;  3MVD C;  4G91 C;  3AZG C;  5CPJ B;  5AVB C;  4ZBJ C;  3X1T B;  5AVC A;  3W99 C;  5DNN C;  5B33 A;  1U35 A;  1TZY B;  3B6F C;  1P3P B;  2ARO B;  4KUD D;  3AZN A;  4H9N A;  4J8U A;  3MGR D;  3REJ D;  3AZL D;  2Y2J A;  5AV8 B;  4Z2M H;  2BYK A;  5B2I D;  3X1U A;  4J8V D;  4AWL B;  1HQ3 A;  4H9O A;  5B0Y D;  3AZK C;  1P3K C;  3UTA B;  4CSR B;  5CP6 D;  3REI B;  3WKJ D;  4KUD A;  3AZH B;  3TU4 C;  3WTP C;  3REJ A;  1P3G B;  5JRG B;  5KDM A;  3AV1 B;  4ZUX B;  4Z2M G;  2DF4 C;  5B32 C;  5B1M C;  5B2I A;  5B1L A;  1M1A B;  1BH8 A;  2YFW A;  5B0Y A;  5F99 B;  4WU9 A;  3MVD B;  1KX5 D;  4G91 B;  1P3O C;  1KU5 A;  4H9S C;  4LD9 B;  4ZBJ B;  1S32 C;  3B6F B;  3LZ0 C;  3KWQ C;  3EPL A;  5B0Z A;  1ZLA A;  4NFT A;  5AV6 D;  1F1E A;  3C1C D;  1KX5 A;  4KGC A;  1ID3 C;  1WWI A;  4XZQ A;  3EPJ A;  2RVQ D;  3AZK B;  3F6T A;  3X1V C;  1P3K B;  3AL0 C;  5DNM D;  3AN2 A;  2Y2I A;  4CAY B;  3TU4 B;  2FJ7 A;  3WTP B;  1BH9 A;  1W2E A;  5AV6 A;  5B32 B;  5B1M B;  5GT0 C;  4WJ3 C;  2VQR A;  4J8X D;  4XUJ C;  1EQZ D;  3X1U B;  1S32 B;  5AV9 A;  2DQN C;  3X1S A;  3LZ0 B;  4H9P B;  3KWQ B;  5B40 A;  4QLC C;  3LEL A;  3REK D;  3VH6 A;  3AV2 C;  4X23 A;  2CV5 C;  5GXQ D;  3NQU A;  1AOI C;  1ID3 B;  3AYW C;  5B1L B;  1WWS A;  1P3I A;  2XD1 A;  1P34 D;  4WU9 B;  1T3U A;  1P3M D;  4E45 A;  3EG5 B;  3AZI C;  4H9Q B;  3AFA C;  4Z5T D;  3UT9 D;  1M18 C;  3C1B C;  5CPI C;  1JFI A;  5GT0 B;  5BNX B;  2W8S A;  3W98 A;  3B6G C;  4Z5T A;  3B0C W;  3X1T D;  4R8P D;  5B2J C;  4QLC B;  3MNN C;  1P3P D;  3KXB A;  3MGP A;  5CPK B;  4UUZ B;  2HIO C;  5CPJ C;  3A1I A;  3A1K A;  3MGS D;  2F8N K;  3AYW B;  2F8N H;  5AV8 D;  4R8P A;  2PYO C;  1TZY C;  1F66 C;  5GSU C;  3AZI B;  3REI D;  5AV5 D;  1M18 B;  1P3G D;  3MGS A;  5CPI B;  3FDD A;  3AV1 D;  2F8N G;  5BO0 A;  2BYM A;  4YM6 A;  4KHA B;  5BS7 A;  1M1A D;  3VH5 T;  3EPH A;  3KUY A;  3B6G B;  3MVD D;  3AZG D;  5AV5 A;  1TAF A;  4YS3 C;  3O62 C;  4WU8 C;  5AVB D;  3WA9 A;  5AY8 C;  4DRB A;  3WAA A;  5B2J B;  3KSY A;  3W99 D;  3R45 A;  5DNN D;  5F99 C;  3MNN B;  3A6N A;  3AZM D;  2NQB A;  3MGQ C;  3B6F D;  5GT3 A;  2IO5 B;  2HIO B;  3AZE C;  4LD9 C;  1KX4 A;  2ZY3 A;  4DRA A;  2PYO B;  4JJN C;  1BFM A;  4H9R A;  5DNN A;  3AZM A;  2XD5 A;  3AZK D;  1P3L C;  1F66 B;  5GSU B;  2Y2Q A;  5JA4 B;  4NE5 A;  3REH C;  3TU4 D;  3WTP D;  3W96 C;  4Z66 C;  3AZF B;  2ZM5 A;  3W97 C;  5E5A C;  5B32 D;  5B31 D;  1M19 C;  3MGP B;  3MGR A;  3AZL A;  1P3O D;  1P3F D;  3O62 B;  3REL D;  4WU8 B;  4YS3 B;  2NZD B;  5AY8 B;  5B33 C;  1U35 C;  2F8N B;  4J8V A;  3LZ0 D;  3AZN C;  3MGQ B;  5B31 A;  4J8U C;  5CP6 A;  3WKJ A;  3IP4 C;  3AZE B;  3V9R B;  1P3O A;  3X1U C;  1P3F A;  3LJA D;  3H0M C;  3REL A;  4YM6 B;  1HQ3 C;  4JJN B;  1P3L B;  3KUY B;  4KUD C;  3X1V D;  2YFV A;  3REJ C;  3REH B;  1TAF B;  4Z66 B;  3WA9 B;  3W96 B;  1KX3 D;  3AZH A;  5B2I C;  3W97 B;  5B1L C;  3LJA A;  1H3O A;  5E5A B;  5B0Y C;  4DQY B;  5GT0 D;  3AZJ D;  4WU9 C;  2J8P A;  1M19 B;  4WV4 B;  5BNV A;  3UTB D;  3C1C A;  2F2A C;  5AVC B;  4XUJ D;  5FUG A;  5B33 B;  3LZ1 D;  1U35 B;  1KX3 A;  2Y2L A;  1N1J A;  3AZJ A;  3AZN B;  4H9N B;  5DNM A;  5B0Z C;  4J8U B;  1ZLA C;  4QLC D;  1KX5 C;  1A7W A;  4KGC C;  2Y2O A;  4J8W D;  2BYK B;  3UTB A;  3AV2 D;  2CV5 D;  4XZQ C;  1B6W A;  1HQ3 B;  4H9O B;  3LZ1 A;  1AOI D;  1Z2C B;  3AN2 C;  4KUD B;  2FJ7 C;  3REJ B;  1HTA A;  5CPK C;  2G5H C;  5AV6 C;  5KDM B;  4J8W A;  4J8X A;  1EQZ A;  3AFA D;  5B2I B;  1BH8 B;  5G49 A;  1M18 D;  2YFW B;  3C1B D;  2RVQ C;  5B0Y B;  5CPI D;  5B24 D;  1P3B D;  3REK A;  3KFU G;  3B6G D;  5AV9 C;  5GXQ A;  3X1S C;  2LY8 A;  2FFF B;  5B40 C;  4WNN A;  3LEL C;  1P34 A;  3B0C T;  3NQJ A;  3P5J B;  5B0Z B;  5B24 A;  1P3A D;  1P3B A;  4X23 C;  3MNN D;  1P3M A;  1KX5 B;  1ZLA B;  4KGC B;  3UT9 A;  4XZQ B;  1P3I C;  5CPJ D;  3AN2 B;  2Y2N A;  1TZY D;  2ARO D;  5BNV B;  2FJ7 B;  1F66 D;  4G92 B;  1BH9 B;  1P3A A;  5AV6 B;  5GSU D;  2IO5 C;  1PZR A;  5BT1 C;  3X1T A;  3W98 C;  1P3P A;  2ARO A;  3H0R C;  3UTA D;  1ULY A;  3AZH D;  5AV9 B;  4Z5T C;  3X1S B;  5JRG D;  3AZF C;  3O62 D;  5AV8 A;  4ZUX D;  4WU8 D;  5AY8 D;  5B40 B;  3LEL B;  3KXB C;  3MGP C;  5F99 D;  4X23 B;  3MGQ D;  2Y2K A;  3UTA A;  3NQU B;  3REI A;  2ZY5 A; 
#chains in the Genus database with same CATH homology
 1P3I B;  1Q9C A;  3AZE D;  4LD9 D;  4R8P C;  5JRG A;  1P3G A;  2NZD C;  3AV1 A;  4ZUX A;  2CWE A;  1M1A A;  4E44 A;  3MVD A;  3MGS C;  1JFI B;  3AZG A;  5AVB A;  4YM6 C;  1P34 B;  3W97 D;  5BS7 C;  3W98 B;  5E5A D;  3W99 A;  3B6F A;  3KUY C;  1P3M B;  1P3K D;  1M19 D;  3H0L C;  4Z5T B;  5AV5 C;  3WA9 C;  3WAA C;  2NQB C;  5B33 D;  3A6N C;  1U35 D;  5B1M D;  5C3I C;  3KXB B;  5GT3 C;  4NE6 A;  3AZK A;  1P3K A;  2JSS A;  1KX4 C;  4CAY A;  5AVC C;  3TU4 A;  3WTP A;  4R8P B;  3VH5 A;  2UWX A;  3X1U D;  1S32 D;  3AZM C;  1HQ3 D;  2ZY2 A;  5B32 A;  5B1M A;  3KWQ D;  1R4V A;  3MGS B;  5BO0 B;  4H9S A;  2BYM B;  1ID3 D;  5B32 G;  1S32 A;  5B1L D;  5B31 G;  3LZ0 A;  4WU9 D;  4H9P A;  3KWQ A;  3MGR C;  3AZL C;  5AV5 B;  5CHL B;  3WAA B;  4J8V C;  2NQB B;  3R45 B;  3A6N B;  1ID3 A;  5B31 C;  5C3I B;  4WZS B;  5GT3 B;  5CP6 C;  3X1V A;  3WKJ C;  5B0Z D;  4UPK A;  1ZLA D;  1KX4 B;  3AZG B;  1P3F C;  4KGC D;  3REL C;  5AVB B;  4H9Q A;  3VH6 T;  4XZQ D;  4H9R B;  5DNN B;  3AZM B;  3W99 B;  2Y2G A;  5GT0 A;  3AN2 D;  5BNX A;  2JCH A;  2FJ7 D;  3VH6 W;  5CPK D;  3LJA C;  4XUJ A;  3AYW D;  3MGR B;  1B67 A;  2Y2M A;  4G92 C;  3AZL B;  4QLC A;  3C1C C;  5CPK A;  3AZI D;  3AV2 A;  1KX3 C;  2CV5 A;  5AV9 D;  4UUZ A;  3X1S D;  4J8V B;  1AOI A;  3AZJ C;  3AYW A;  5DNM C;  5B31 B;  5B40 D;  5CP6 B;  3LEL D;  3WKJ B;  2Y2H A;  3UTB C;  3EPK A;  4X23 D;  1P3O B;  1P3F B;  3REL B;  4NE3 A;  3B0B A;  3AZI A;  3LZ1 C;  3AFA A;  1P3I D;  1M18 A;  3C1B A;  5CPI A;  2YFV B;  5B2J D;  4KHA A;  4J8W C;  4J8X C;  1EQZ C;  3B6G A;  3LJA B;  1H3O B;  2HIO D;  5BT1 D;  2PYO D;  3REK C;  3X1V B;  3W98 D;  2HUE C;  4HGA C;  5B2J A;  3MNN A;  3C1C B;  3B0D C;  4EO5 C;  5GXQ C;  2BG1 A;  5FUG B;  2ZY4 A;  1KX3 B;  1N1J B;  2HIO A;  5CPJ A;  3AZF D;  3AZJ B;  1P34 C;  5DNM B;  5B24 C;  1P3B C;  2PYO A;  1TZY A;  1P3M C;  3WTP E;  3KXB D;  3MGP D;  3UTB B;  1F66 A;  5GSU A;  3UT9 C;  4XUJ B;  5JA4 A;  3LZ1 B;  4YS3 D;  2NZD D;  3AZF A;  2F8N D;  1P3A C;  4J8W B;  4J8X B;  3AV2 B;  4CSR A;  1EQZ B;  2Y2P A;  2CV5 B;  5G49 B;  1AOI B;  3X1T C;  3O62 A;  4YS3 A;  4WU8 A;  4YM6 D;  4M6B A;  5AY8 A;  2NZD A;  3REK B;  4JJN D;  1P3P C;  2ARO C;  2F8N A;  2HUE B;  4HGA B;  1P3L D;  3KUY D;  5F99 A;  2RIQ A;  3B0D B;  5GXQ B;  4EO5 B;  3MGQ A;  3AFA B;  3REH D;  5AV8 C;  4Z66 D;  3C1B B;  2G5I C;  3V9R A;  4WNN B;  3AZE A;  3WAA D;  3WA9 D;  3W96 D;  4LD9 A;  3NQJ B;  2JE5 A;  5B24 B;  1P3B B;  2NQB D;  4AWL C;  3A6N D;  4JJN A;  3UTA C;  1P3L A;  5GT3 D;  3REI C;  3AZH C;  3UT9 B;  1P3G C;  5JRG C;  1KX4 D;  2L5A A;  3REH A;  5AVC D;  4ZUX C;  3AV1 C;  3W96 A;  4Z66 A;  3VH5 W;  3W97 A;  1M1A C;  5E5A A;  1P3A B;  3AZN D;  4J8U D;  1M19 A;  3MVD C;  4G91 C;  3AZG C;  5CPJ B;  5AVB C;  4ZBJ C;  3X1T B;  5AVC A;  3W99 C;  5DNN C;  5B33 A;  1U35 A;  1TZY B;  3B6F C;  1P3P B;  2ARO B;  4KUD D;  3AZN A;  4H9N A;  4J8U A;  3MGR D;  3REJ D;  3AZL D;  2Y2J A;  5AV8 B;  4Z2M H;  2BYK A;  5B2I D;  3X1U A;  4J8V D;  4AWL B;  1HQ3 A;  4H9O A;  5B0Y D;  3AZK C;  1P3K C;  3UTA B;  4CSR B;  5CP6 D;  3REI B;  3WKJ D;  4KUD A;  3AZH B;  3TU4 C;  3WTP C;  3REJ A;  1P3G B;  5JRG B;  5KDM A;  3AV1 B;  4ZUX B;  4Z2M G;  2DF4 C;  5B32 C;  5B1M C;  5B2I A;  5B1L A;  1M1A B;  1BH8 A;  2YFW A;  5B0Y A;  5F99 B;  4WU9 A;  3MVD B;  1KX5 D;  4G91 B;  1P3O C;  1KU5 A;  4H9S C;  4LD9 B;  4ZBJ B;  1S32 C;  3B6F B;  3LZ0 C;  3KWQ C;  3EPL A;  5B0Z A;  1ZLA A;  4NFT A;  5AV6 D;  1F1E A;  3C1C D;  1KX5 A;  4KGC A;  1ID3 C;  1WWI A;  4XZQ A;  3EPJ A;  2RVQ D;  3AZK B;  3F6T A;  3X1V C;  1P3K B;  3AL0 C;  5DNM D;  3AN2 A;  2Y2I A;  4CAY B;  3TU4 B;  2FJ7 A;  3WTP B;  1BH9 A;  1W2E A;  5AV6 A;  5B32 B;  5B1M B;  5GT0 C;  4WJ3 C;  2VQR A;  4J8X D;  4XUJ C;  1EQZ D;  3X1U B;  1S32 B;  5AV9 A;  2DQN C;  3X1S A;  3LZ0 B;  4H9P B;  3KWQ B;  5B40 A;  4QLC C;  3LEL A;  3REK D;  3VH6 A;  3AV2 C;  4X23 A;  2CV5 C;  5GXQ D;  3NQU A;  1AOI C;  1ID3 B;  3AYW C;  5B1L B;  1WWS A;  1P3I A;  2XD1 A;  1P34 D;  4WU9 B;  1T3U A;  1P3M D;  4E45 A;  3EG5 B;  3AZI C;  4H9Q B;  3AFA C;  4Z5T D;  3UT9 D;  1M18 C;  3C1B C;  5CPI C;  1JFI A;  5GT0 B;  5BNX B;  2W8S A;  3W98 A;  3B6G C;  4Z5T A;  3B0C W;  3X1T D;  4R8P D;  5B2J C;  4QLC B;  3MNN C;  1P3P D;  3KXB A;  3MGP A;  5CPK B;  4UUZ B;  2HIO C;  5CPJ C;  3A1I A;  3A1K A;  3MGS D;  2F8N K;  3AYW B;  2F8N H;  5AV8 D;  4R8P A;  2PYO C;  1TZY C;  1F66 C;  5GSU C;  3AZI B;  3REI D;  5AV5 D;  1M18 B;  1P3G D;  3MGS A;  5CPI B;  3FDD A;  3AV1 D;  2F8N G;  5BO0 A;  2BYM A;  4YM6 A;  4KHA B;  5BS7 A;  1M1A D;  3VH5 T;  3EPH A;  3KUY A;  3B6G B;  3MVD D;  3AZG D;  5AV5 A;  1TAF A;  4YS3 C;  3O62 C;  4WU8 C;  5AVB D;  3WA9 A;  5AY8 C;  4DRB A;  3WAA A;  5B2J B;  3KSY A;  3W99 D;  3R45 A;  5DNN D;  5F99 C;  3MNN B;  3A6N A;  3AZM D;  2NQB A;  3MGQ C;  3B6F D;  5GT3 A;  2IO5 B;  2HIO B;  3AZE C;  4LD9 C;  1KX4 A;  2ZY3 A;  4DRA A;  2PYO B;  4JJN C;  1BFM A;  4H9R A;  5DNN A;  3AZM A;  2XD5 A;  3AZK D;  1P3L C;  1F66 B;  5GSU B;  2Y2Q A;  5JA4 B;  4NE5 A;  3REH C;  3TU4 D;  3WTP D;  3W96 C;  4Z66 C;  3AZF B;  2ZM5 A;  3W97 C;  5E5A C;  5B32 D;  5B31 D;  1M19 C;  3MGP B;  3MGR A;  3AZL A;  1P3O D;  1P3F D;  3O62 B;  3REL D;  4WU8 B;  4YS3 B;  2NZD B;  5AY8 B;  5B33 C;  1U35 C;  2F8N B;  4J8V A;  3LZ0 D;  3AZN C;  3MGQ B;  5B31 A;  4J8U C;  5CP6 A;  3WKJ A;  3IP4 C;  3AZE B;  3V9R B;  1P3O A;  3X1U C;  1P3F A;  3LJA D;  3H0M C;  3REL A;  4YM6 B;  1HQ3 C;  4JJN B;  1P3L B;  3KUY B;  4KUD C;  3X1V D;  2YFV A;  3REJ C;  3REH B;  1TAF B;  4Z66 B;  3WA9 B;  3W96 B;  1KX3 D;  3AZH A;  5B2I C;  3W97 B;  5B1L C;  3LJA A;  1H3O A;  5E5A B;  5B0Y C;  4DQY B;  5GT0 D;  3AZJ D;  4WU9 C;  2J8P A;  1M19 B;  4WV4 B;  5BNV A;  3UTB D;  3C1C A;  2F2A C;  5AVC B;  4XUJ D;  5FUG A;  5B33 B;  3LZ1 D;  1U35 B;  1KX3 A;  2Y2L A;  1N1J A;  3AZJ A;  3AZN B;  4H9N B;  5DNM A;  5B0Z C;  4J8U B;  1ZLA C;  4QLC D;  1KX5 C;  1A7W A;  4KGC C;  2Y2O A;  4J8W D;  2BYK B;  3UTB A;  3AV2 D;  2CV5 D;  4XZQ C;  1B6W A;  1HQ3 B;  4H9O B;  3LZ1 A;  1AOI D;  1Z2C B;  3AN2 C;  4KUD B;  2FJ7 C;  3REJ B;  1HTA A;  5CPK C;  2G5H C;  5AV6 C;  5KDM B;  4J8W A;  4J8X A;  1EQZ A;  3AFA D;  5B2I B;  1BH8 B;  5G49 A;  1M18 D;  2YFW B;  3C1B D;  2RVQ C;  5B0Y B;  5CPI D;  5B24 D;  1P3B D;  3REK A;  3KFU G;  3B6G D;  5AV9 C;  5GXQ A;  3X1S C;  2LY8 A;  2FFF B;  5B40 C;  4WNN A;  3LEL C;  1P34 A;  3B0C T;  3NQJ A;  3P5J B;  5B0Z B;  5B24 A;  1P3A D;  1P3B A;  4X23 C;  3MNN D;  1P3M A;  1KX5 B;  1ZLA B;  4KGC B;  3UT9 A;  4XZQ B;  1P3I C;  5CPJ D;  3AN2 B;  2Y2N A;  1TZY D;  2ARO D;  5BNV B;  2FJ7 B;  1F66 D;  4G92 B;  1BH9 B;  1P3A A;  5AV6 B;  5GSU D;  2IO5 C;  1PZR A;  5BT1 C;  3X1T A;  3W98 C;  1P3P A;  2ARO A;  3H0R C;  3UTA D;  1ULY A;  3AZH D;  5AV9 B;  4Z5T C;  3X1S B;  5JRG D;  3AZF C;  3O62 D;  5AV8 A;  4ZUX D;  4WU8 D;  5AY8 D;  5B40 B;  3LEL B;  3KXB C;  3MGP C;  5F99 D;  4X23 B;  3MGQ D;  2Y2K A;  3UTA A;  3NQU B;  3REI A;  2ZY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...