5BS7A

Structure of histone h3/h4 in complex with spt2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Histone H3.2
publication title Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2.
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bs7A00
5B40A 3B0CW 1P3ID 1S32D 1P34D 3C1CA 3W96C 3MVDA 4J8WC 3C1BB 2PYOB 3AFAD 3X1TA 1ZLAA 5AV6B 4E45A 1KX4A 5AV9D 3WKJB 3VH6A 4ZUXB 5CPJC 3REKA 5CPID 1KX3D 2NQBB 3X1SB 1ID3B 2CV5C 4E44A 5DNNB 3AV2C 3VH5A 4WU8D 4KUDB 4Z5TA 5AV6A 4G92C 5AV8A 4QLCC 1P3KD 3RELD 5B1MB 1M19B 1R4VA 4ZUXA 4HGAC 5E5AC 4Z2MG 2NQBA 3X1SA 1ID3A 1EQZB 2LY8A 3LELC 3AYWC 5DNMC 4R8PB 3KWQD 3AN2B 4KUDA 3UTAC 5GSUD 3KXBB 5GT0C 5B1MA 1M19A 2F8NK 3AZFB 2YFVB 5AVCC 2BYMB 5B0YA 3AZJC 4ZBJB 4R8PA 1AOIC 3KXBA 4J8XD 3MGPC 5C3IC 3AZLB 5CPJD 3W98B 3LZ0A 5GXQB 1P3OB 4H9PA 2HIOB 2HUEC 3WTPB 1P3GB 1F66C 2CV5D 3MNNC 4DRBA 4AWLB 4JJNB 5F99B 3UT9B 3AV2D 3TU4B 1Q9CA 4G91C 4QLCD 1P3AD 1BH9B 3B6FB 3W98A 5E5AD 5GXQA 5GT3B 1P3BC 2HIOA 3LELD 3AZNB 3AYWD 3REIC 4JJNA 5DNMD 3AZEC 5KDMB 4YM6B 5BNVA 3UTAD 3TU4A 4YS3B 4NFTA 5GT0D 5G49B 3B6GB 5BS7C 2F8ND 1BH9A 3B6FA 5CPKB 3AZHC 3MGQC 4CAYB 3AZJD 4XUJC 5AV5D 1AOID 4H9RB 1N1JB 5KDMA 4YM6A 4YS3A 5G49A 3MGPD 3B6GA 1M1AB 1P3IC 5B1LB 1F66D 5CPKA 1KU5A 3WAAB 1TZYC 2AROC 5B24D 4H9RA 5AV9C 3AZKC 1N1JA 4EO5C 3AFAB 3KUYB 3LJAC 3MGSB 1BFMA 1M1AA 1P3BD 5B1LA 3LZ1A 3A6NB 1KX3B 5CPIB 3WAAA 1P3MC 1KX5A 4KHAB 5BNXB 5B31C 1B6WA 2F8NG 4WU8B 1P3KC 3KUYA 3MGSA 2FJ7B 4WNNB 4XZQD 3AZHD 3MGQD 1HQ3C 3RELB 4LD9B 3A6NA 4XUJD 4KHAA 2CWEA 5BNXA 3AZIB 5GSUC 3KWQB 3WA9C 1P3FB 3AV1B 2FJ7A 5B2IC 4WNNA 5B2JA 5B33C 5B32A 3W97B 5BT1D 4LD9A 3AZGD 4X23B 1TZYD 1P3PA 3W96B 2AROD 4J8WB 3REJB 3NQUB 4NE5A 3AZKD 3AZIA 4J8XC 3X1TC 1ZLAC 3LJAD 1KX4C 1P3FA 3AV1A 3W97A 3REKC 1P3MD 4X23A 3C1BA 1H3OB 2PYOA 2CV5B 3W96A 5B31D 4J8WA 3REJA 1P3AC 3B0CT 3WKJA 4Z5TC 5AV6C 3MGRB 3NQJB 5AV8C 4WU9B 1HQ3D 4ZUXC 5E5AB 5DNNA 4J8UB 4H9OB 2L5AA 1H3OA 5JA4B 3AYWB 5AVBB 1P3LC 4KUDC 4J8VB 3WA9D 3MGRA 3NQJA 5B2ID 4H9SA 5B33D 4Z66D 4WU9A 4KGCB 5B40D 5B1MC 1M19C 1EQZA 3C1CD 5E5AA 4J8UA 3MVDD 5BO0B 4H9OA 5AV5C 5AVCB 3AN2A 5B0YC 3AYWA 3X1TD 5AVBA 3X1VB 1ZLAD 1KX4D 4J8VA 3KXBC 5JRGB 3AZFA 5C3IB 2YFVA 3O62C 3REKD 3LZ0C 3REHB 4KGCA 1U35B 2BYMA 2HUEB 2RVQD 1F66B 5B31G 3MNNB 5BO0A 5B24C 5AVCA 4ZBJC 5B0ZC 4Z5TD 3X1VA 5AV6D 3AZLA 1ULYA 5AV8D 1P3OA 5JRGA 3WTPA 1P3GA 4ZUXD 3W98C 3X1UB 5GXQC 3REHA 1U35A 5F99A 3UT9A 2NQBD 3X1SD 1ID3D 4AWLC 3MNNA 2NZDC 4JJNC 3REIB 4NE3A 1P3LD 3AZEB 4KUDD 3TU4C 3VH5W 4XZQC 5GT3A 3B6FC 5B1MD 5CP6B 1M19D 1M18B 4CSRB 3X1UA 3AZNA 3AZHB 5B0YD 3AZMB 3REIA 4R8PD 3W99B 4YM6C 3AZEA 4YS3C 3KXBD 3B6GC 2IO5C 3UTBB 5BT1C 3O62D 3AZGC 1B67A 3LZ0D 1S32B 4CAYA 1P3IB 5CP6A 1P34B 1M18A 4CSRA 5CPKC 3AZMA 2AROB 5B0ZD 5AV9B 3W99A 3UTBA 3W98D 1P3IA 5GXQD 1S32A 2HIOD 4M6BA 3LZ1C 1P34A 1KX5C 3V9RB 2NZDD 4JJND 3AFAA 3TU4D 5AV9A 1P3KB 3KUYC 3MGSC 1TAFB 4NE6A 3B6FD 1KX3A 5CPIA 5AY8C 1F1EA 1HQ3B 4Z2MH 4DRAA 4WU8A 1WWSA 4UUZB 4YM6D 5GSUB 4YS3D 4Z66C 3B6GD 1P3KA 3RELA 5B40C 1TAFA 2FJ7C 3B0DC 5B2JC 3C1CC 5B33B 5B32C 3MVDC 5CPKD 4LD9C 4WZSB 1P3PC 3KWQA 4UUZA 5GSUA 1HTAA 4J8XB 3X1TB 5CPJB 1M1AD 1P3FC 3AV1C 2RVQC 5B1LD 3LZ1D 3W97C 3WAAD 1KX5D 3AV2B 4X23C 3C1BC 2PYOC 3NQUA 3REJC 4G92B 1P3AB 4QLCB 3WKJC 4J8XA 4Z5TB 3KUYD 3MGSD 5CPJA 4HGAB 5AV8B 2NQBC 5AY8D 3UTBD 3X1SC 1WWIA 1ID3C 3A6ND 2CV5A 3LELB 5DNNC 3AV2A 5DNMB 1A7WA 3UTAB 5GT0B 1P3AA 4QLCA 1P3LB 2F8NB 3MGRC 2FJ7D 5B2JD 4H9SC 5B32D 4WU9C 4LD9D 1EQZC 3LELA 5JA4A 4J8UC 3AZJB 1P3PD 4R8PC 5DNMA 5AV5B 1AOIB 3AN2C 5B0YB 3UTAA 3AZID 5AVBC 5GT0A 3MGPB 1P3LA 2F8NA 4J8VC 1P3FD 3AV1D 3AZFC 3W97D 3O62B 4KGCC 3LZ0B 4H9PB 4X23D 3C1BD 2PYOD 3AZJA 3W96D 5AV5A 5B24B 4J8WD 3REJD 1AOIA 4G91B 3WKJD 5B0ZB 3X1VC 3MGPA 3AZLC 3VH6W 1P3OC 5JRGC 2HIOC 1P3BB 3WTPC 1P3GC 1F66A 3O62A 3REHC 5DNND 1U35C 5F99C 3UT9C 4H9NB 3B0BA 4WV4B 2NZDB 5B24A 5B0ZA 2F8NH 5BNVB 3MGRD 4XZQB 5B32G 2BYKB 5GT3C 3MGQB 1P3BA 4WU9D 1EQZD 3X1UC 3AZNC 4J8UD 4XUJB 4H9NA 3AN2D 2NZDA 3VH6T 5AVBD 5BS7A 4J8VD 4XZQA 3AZFD 2BYKA 2IO5B 3MGQA 3AZHA 3WTPE 4KGCD 3AZGB 1TZYB 5CP6C 1M18C 3VH5T 4XUJA 1BH8B 5AVCD 3AZKB 4EO5B 5CHLB 3AZMC 2YFWB 3LJAB 3X1VD 1M1AC 3W99C 3AZLD 1P3OD 5JRGD 5B1LC 4H9QB 3WTPD 3UTBC 1P3GD 3WAAC 1P3MB 3REHD 3AZGA 1S32C 1TZYA 5F99D 3UT9D 1U35D 1P34C 3LZ1B 5B31B 3MNND 2AROA 5FUGB 1KX5B 2JSSA 1BH8A 3AFAC 3AZKA 3R45B 2YFWA 3LJAA 1JFIB 5GT3D 3A6NC 4H9QA 1KX3C 5CPIC 3V9RA 3X1UD 3AZND 5AY8B 1P3MA 5B31A 5FUGA 3REID 4WU8C 3R45A 3WA9B 3AZED 5B2IB 1JFIA 4Z66B 3RELC 1HQ3A 5B40B 3KSYA 3B0DB 5CP6D 5B2JB 3C1CB 5B32B 3MVDB 1M18D 5AY8A 1P3PB 3AZIC 3AZMD 1ZLAB 1KX4B 3KWQC 3W99D 3WA9A 5B2IA 5B33A 4Z66A 3REKB
chains in the Genus database with same CATH superfamily
5B40A 3B0CW 1P3ID 1S32D 1P34D 3C1CA 3W96C 3MVDA 4J8WC 3C1BB 2PYOB 3AFAD 3X1TA 1ZLAA 5AV6B 4E45A 1KX4A 5AV9D 3WKJB 3VH6A 4ZUXB 5CPJC 3REKA 5CPID 1KX3D 2NQBB 3X1SB 1ID3B 2CV5C 4E44A 5DNNB 1PZRA 3AV2C 3VH5A 3KFUG 4WU8D 4KUDB 4Z5TA 5AV6A 4G92C 5AV8A 4QLCC 1P3KD 2RIQA 3RELD 2Y2IA 5B1MB 1M19B 2G5HC 1R4VA 4ZUXA 4HGAC 5E5AC 4Z2MG 2NQBA 3X1SA 1ID3A 1EQZB 2LY8A 3LELC 3AYWC 5DNMC 4R8PB 3KWQD 3AN2B 4KUDA 3UTAC 5GSUD 3KXBB 5GT0C 3H0RC 5B1MA 2ZY3A 1M19A 2F8NK 3AZFB 2YFVB 5AVCC 2BYMB 5B0YA 3AZJC 4ZBJB 4R8PA 1AOIC 3KXBA 2J8PA 4J8XD 3MGPC 5C3IC 3AZLB 5CPJD 3W98B 3LZ0A 5GXQB 1P3OB 4H9PA 2HIOB 2HUEC 3WTPB 1P3GB 1F66C 2CV5D 3MNNC 4DRBA 4AWLB 4JJNB 5F99B 3UT9B 3AV2D 2Y2OA 3TU4B 1Q9CA 4G91C 4QLCD 1P3AD 1BH9B 3B6FB 3W98A 5E5AD 5GXQA 5GT3B 1P3BC 2HIOA 3LELD 3AZNB 3AYWD 3REIC 4JJNA 5DNMD 4WJ3C 3AZEC 5KDMB 4YM6B 5BNVA 3UTAD 3TU4A 4YS3B 4NFTA 5GT0D 5G49B 3B6GB 5BS7C 2F8ND 3EG5B 1BH9A 2ZY5A 3B6FA 5CPKB 3AZHC 3MGQC 4CAYB 3AZJD 4XUJC 5AV5D 1AOID 4H9RB 1N1JB 5KDMA 4YM6A 4YS3A 3EPLA 5G49A 3MGPD 3B6GA 4UPKA 1M1AB 1P3IC 3FDDA 3H0MC 5B1LB 1F66D 5CPKA 1KU5A 3WAAB 1T3UA 1TZYC 2AROC 5B24D 4H9RA 5AV9C 2XD1A 3AZKC 1N1JA 4EO5C 3AFAB 3KUYB 3LJAC 3MGSB 1BFMA 1M1AA 2DF4C 1P3BD 5B1LA 3LZ1A 3A6NB 1KX3B 5CPIB 3WAAA 1P3MC 1KX5A 4KHAB 2UWXA 5BNXB 5B31C 1B6WA 3AL0C 2F8NG 4WU8B 1P3KC 2Y2HA 3KUYA 3MGSA 2FJ7B 4WNNB 4XZQD 3AZHD 3MGQD 1HQ3C 3RELB 4LD9B 3A6NA 4XUJD 4KHAA 2CWEA 5BNXA 3AZIB 5GSUC 3KWQB 3EPKA 3WA9C 1P3FB 3AV1B 2FJ7A 5B2IC 4WNNA 5B2JA 5B33C 5B32A 3W97B 2Y2LA 5BT1D 4LD9A 3AZGD 4X23B 1TZYD 1P3PA 3W96B 2AROD 4J8WB 3REJB 3NQUB 4NE5A 4DQYB 3AZIA 3AZKD 4J8XC 3X1TC 1ZLAC 3LJAD 1KX4C 1P3FA 3AV1A 1Z2CB 3W97A 3REKC 1P3MD 4X23A 3C1BA 1H3OB 2PYOA 2CV5B 3W96A 5B31D 4J8WA 3REJA 1P3AC 3B0CT 3WKJA 4Z5TC 3EPHA 5AV6C 2Y2QA 3MGRB 3NQJB 5AV8C 4WU9B 1HQ3D 4ZUXC 5E5AB 5DNNA 4J8UB 4H9OB 2L5AA 1H3OA 3F6TA 5JA4B 3AYWB 5AVBB 1P3LC 4KUDC 4J8VB 3WA9D 3MGRA 3NQJA 5B2ID 4H9SA 5B33D 4Z66D 4WU9A 4KGCB 5B40D 5B1MC 1M19C 1EQZA 3C1CD 5E5AA 4J8UA 3MVDD 5BO0B 4H9OA 5AV5C 5AVCB 3AN2A 5B0YC 3AYWA 3X1TD 5AVBA 3X1VB 1ZLAD 1KX4D 4J8VA 3KXBC 5JRGB 3AZFA 5C3IB 2YFVA 3O62C 3REKD 3LZ0C 3REHB 4KGCA 1U35B 2BYMA 2HUEB 2RVQD 1F66B 5B31G 3MNNB 5BO0A 5B24C 5AVCA 4ZBJC 5B0ZC 4Z5TD 3X1VA 5AV6D 3AZLA 1ULYA 5AV8D 1P3OA 5JRGA 2Y2JA 3WTPA 1P3GA 4ZUXD 3W98C 3X1UB 5GXQC 3A1KA 3REHA 1U35A 5F99A 3UT9A 2NQBD 3X1SD 1ID3D 3IP4C 4AWLC 2ZY4A 3MNNA 2NZDC 4JJNC 3REIB 4NE3A 1P3LD 2DQNC 3AZEB 4KUDD 3TU4C 3VH5W 4XZQC 5GT3A 3B6FC 5B1MD 5CP6B 1M19D 1M18B 4CSRB 3X1UA 3AZNA 3AZHB 5B0YD 3AZMB 3REIA 4R8PD 3W99B 4YM6C 3AZEA 2ZY2A 4YS3C 3KXBD 3EPJA 3B6GC 2IO5C 3UTBB 5BT1C 3O62D 3AZGC 1B67A 3LZ0D 1S32B 4CAYA 1P3IB 5CP6A 1P34B 1M18A 4CSRA 5CPKC 3AZMA 2AROB 5B0ZD 5AV9B 3W99A 2Y2MA 3UTBA 3W98D 1P3IA 5GXQD 1S32A 2HIOD 4M6BA 3LZ1C 1P34A 1KX5C 3V9RB 2NZDD 4JJND 3AFAA 3TU4D 5AV9A 1P3KB 3KUYC 3MGSC 1TAFB 4NE6A 3B6FD 1KX3A 5CPIA 5AY8C 1F1EA 1HQ3B 4Z2MH 4DRAA 4WU8A 1WWSA 4UUZB 4YM6D 5GSUB 4YS3D 3H0LC 4Z66C 3B6GD 1P3KA 3RELA 5B40C 1TAFA 2FJ7C 3B0DC 5B2JC 3C1CC 5B33B 5B32C 3MVDC 5CPKD 4LD9C 4WZSB 1P3PC 3KWQA 4UUZA 5GSUA 1HTAA 4J8XB 2VQRA 3X1TB 5CPJB 1M1AD 1P3FC 3AV1C 2RVQC 5B1LD 3LZ1D 3W97C 2XD5A 3WAAD 1W2EA 1KX5D 3AV2B 4X23C 3C1BC 2PYOC 3NQUA 3REJC 4G92B 1P3AB 4QLCB 3WKJC 4J8XA 4Z5TB 3KUYD 3MGSD 2W8SA 5CPJA 4HGAB 5AV8B 2NQBC 3A1IA 5AY8D 3UTBD 3X1SC 1WWIA 1ID3C 3A6ND 2CV5A 3LELB 5DNNC 3AV2A 5DNMB 1A7WA 3UTAB 5GT0B 1P3AA 4QLCA 1P3LB 2F8NB 2Y2KA 3MGRC 2FJ7D 5B2JD 4H9SC 5B32D 4WU9C 4LD9D 1EQZC 2FFFB 3LELA 5JA4A 4J8UC 3AZJB 1P3PD 2G5IC 4R8PC 5DNMA 5AV5B 1AOIB 3AN2C 5B0YB 3UTAA 3AZID 5AVBC 5GT0A 3MGPB 1P3LA 2F8NA 4J8VC 1P3FD 3AV1D 3AZFC 3W97D 3O62B 4KGCC 3LZ0B 4H9PB 4X23D 3C1BD 2Y2PA 2PYOD 3AZJA 3W96D 5AV5A 5B24B 4J8WD 3REJD 1AOIA 4G91B 3WKJD 5B0ZB 3X1VC 3MGPA 2Y2NA 3AZLC 3VH6W 1P3OC 5JRGC 2HIOC 1P3BB 3P5JB 3WTPC 1P3GC 1F66A 3O62A 3REHC 5DNND 1U35C 5F99C 3UT9C 4H9NB 3B0BA 4WV4B 2NZDB 2JCHA 5B24A 2ZM5A 5B0ZA 2F8NH 5BNVB 3MGRD 4XZQB 5B32G 2BYKB 5GT3C 3MGQB 1P3BA 4WU9D 1EQZD 2JE5A 3X1UC 4J8UD 3AZNC 4XUJB 4H9NA 3AN2D 2NZDA 2Y2GA 3VH6T 5AVBD 5BS7A 4J8VD 4XZQA 3AZFD 2BYKA 2IO5B 3MGQA 3AZHA 2BG1A 3WTPE 3AZGB 4KGCD 1TZYB 5CP6C 1M18C 3VH5T 4XUJA 1BH8B 5AVCD 3AZKB 4EO5B 5CHLB 3AZMC 2YFWB 3LJAB 3X1VD 1M1AC 3W99C 3AZLD 1P3OD 5JRGD 5B1LC 4H9QB 3WTPD 3UTBC 1P3GD 3WAAC 1P3MB 3REHD 3AZGA 1S32C 1TZYA 5F99D 3UT9D 1U35D 1P34C 3LZ1B 5B31B 3MNND 2AROA 5FUGB 1KX5B 2JSSA 1BH8A 3AFAC 3AZKA 3R45B 2YFWA 3LJAA 1JFIB 5GT3D 3A6NC 4H9QA 1KX3C 5CPIC 3V9RA 3X1UD 3AZND 5AY8B 1P3MA 5B31A 5FUGA 3REID 4WU8C 3R45A 3WA9B 3AZED 5B2IB 1JFIA 4Z66B 3RELC 1HQ3A 5B40B 3KSYA 3B0DB 5CP6D 5B2JB 3C1CB 5B32B 3MVDB 1M18D 5AY8A 1P3PB 3AZIC 3AZMD 1ZLAB 1KX4B 3KWQC 2F2AC 3W99D 3WA9A 5B2IA 5B33A 4Z66A 3REKB
chains in the Genus database with same CATH topology
5B40A 3B0CW 1P3ID 1S32D 1P34D 3C1CA 3W96C 3MVDA 4J8WC 3C1BB 2PYOB 3AFAD 3X1TA 1ZLAA 5AV6B 4E45A 1KX4A 5AV9D 3WKJB 3VH6A 4ZUXB 5CPJC 3REKA 5CPID 1KX3D 2NQBB 3X1SB 1ID3B 2CV5C 4E44A 5DNNB 1PZRA 3AV2C 3VH5A 3KFUG 4WU8D 4KUDB 4Z5TA 5AV6A 4G92C 5AV8A 4QLCC 1P3KD 2RIQA 3RELD 2Y2IA 5B1MB 1M19B 2G5HC 1R4VA 4ZUXA 4HGAC 5E5AC 4Z2MG 2NQBA 3X1SA 1ID3A 1EQZB 2LY8A 3LELC 3AYWC 5DNMC 4R8PB 3KWQD 3AN2B 4KUDA 3UTAC 5GSUD 3KXBB 5GT0C 3H0RC 5B1MA 2ZY3A 1M19A 2F8NK 3AZFB 2YFVB 5AVCC 2BYMB 5B0YA 3AZJC 4ZBJB 4R8PA 1AOIC 3KXBA 2J8PA 4J8XD 3MGPC 5C3IC 3AZLB 5CPJD 3W98B 3LZ0A 5GXQB 1P3OB 4H9PA 2HIOB 2HUEC 3WTPB 1P3GB 1F66C 2CV5D 3MNNC 4DRBA 4AWLB 4JJNB 5F99B 3UT9B 3AV2D 2Y2OA 3TU4B 1Q9CA 4G91C 4QLCD 1P3AD 1BH9B 3B6FB 3W98A 5E5AD 5GXQA 5GT3B 1P3BC 2HIOA 3LELD 3AZNB 3AYWD 3REIC 4JJNA 5DNMD 4WJ3C 3AZEC 5KDMB 4YM6B 5BNVA 3UTAD 3TU4A 4YS3B 4NFTA 5GT0D 5G49B 3B6GB 5BS7C 2F8ND 3EG5B 1BH9A 2ZY5A 3B6FA 5CPKB 3AZHC 3MGQC 4CAYB 3AZJD 4XUJC 5AV5D 1AOID 4H9RB 1N1JB 5KDMA 4YM6A 4YS3A 3EPLA 5G49A 3MGPD 3B6GA 4UPKA 1M1AB 1P3IC 3FDDA 3H0MC 5B1LB 1F66D 5CPKA 1KU5A 3WAAB 1T3UA 1TZYC 2AROC 5B24D 4H9RA 5AV9C 2XD1A 3AZKC 1N1JA 4EO5C 3AFAB 3KUYB 3LJAC 3MGSB 1BFMA 1M1AA 2DF4C 1P3BD 5B1LA 3LZ1A 3A6NB 1KX3B 5CPIB 3WAAA 1P3MC 1KX5A 4KHAB 2UWXA 5BNXB 5B31C 1B6WA 3AL0C 2F8NG 4WU8B 1P3KC 2Y2HA 3KUYA 3MGSA 2FJ7B 4WNNB 4XZQD 3AZHD 3MGQD 1HQ3C 3RELB 4LD9B 3A6NA 4XUJD 4KHAA 2CWEA 5BNXA 3AZIB 5GSUC 3KWQB 3EPKA 3WA9C 1P3FB 3AV1B 2FJ7A 5B2IC 4WNNA 5B2JA 5B33C 5B32A 3W97B 2Y2LA 5BT1D 4LD9A 3AZGD 4X23B 1TZYD 1P3PA 3W96B 2AROD 4J8WB 3REJB 3NQUB 4NE5A 4DQYB 3AZIA 3AZKD 4J8XC 3X1TC 1ZLAC 3LJAD 1KX4C 1P3FA 3AV1A 1Z2CB 3W97A 3REKC 1P3MD 4X23A 3C1BA 1H3OB 2PYOA 2CV5B 3W96A 5B31D 4J8WA 3REJA 1P3AC 3B0CT 3WKJA 4Z5TC 3EPHA 5AV6C 2Y2QA 3MGRB 3NQJB 5AV8C 4WU9B 1HQ3D 4ZUXC 5E5AB 5DNNA 4J8UB 4H9OB 2L5AA 1H3OA 3F6TA 5JA4B 3AYWB 5AVBB 1P3LC 4KUDC 4J8VB 3WA9D 3MGRA 3NQJA 5B2ID 4H9SA 5B33D 4Z66D 4WU9A 4KGCB 5B40D 5B1MC 1M19C 1EQZA 3C1CD 5E5AA 4J8UA 3MVDD 5BO0B 4H9OA 5AV5C 5AVCB 3AN2A 5B0YC 3AYWA 3X1TD 5AVBA 3X1VB 1ZLAD 1KX4D 4J8VA 3KXBC 5JRGB 3AZFA 5C3IB 2YFVA 3O62C 3REKD 3LZ0C 3REHB 4KGCA 1U35B 2BYMA 2HUEB 2RVQD 1F66B 5B31G 3MNNB 5BO0A 5B24C 5AVCA 4ZBJC 5B0ZC 4Z5TD 3X1VA 5AV6D 3AZLA 1ULYA 5AV8D 1P3OA 5JRGA 2Y2JA 3WTPA 1P3GA 4ZUXD 3W98C 3X1UB 5GXQC 3A1KA 3REHA 1U35A 5F99A 3UT9A 2NQBD 3X1SD 1ID3D 3IP4C 4AWLC 2ZY4A 3MNNA 2NZDC 4JJNC 3REIB 4NE3A 1P3LD 2DQNC 3AZEB 4KUDD 3TU4C 3VH5W 4XZQC 5GT3A 3B6FC 5B1MD 5CP6B 1M19D 1M18B 4CSRB 3X1UA 3AZNA 3AZHB 5B0YD 3AZMB 3REIA 4R8PD 3W99B 4YM6C 3AZEA 2ZY2A 4YS3C 3KXBD 3EPJA 3B6GC 2IO5C 3UTBB 5BT1C 3O62D 3AZGC 1B67A 3LZ0D 1S32B 4CAYA 1P3IB 5CP6A 1P34B 1M18A 4CSRA 5CPKC 3AZMA 2AROB 5B0ZD 5AV9B 3W99A 2Y2MA 3UTBA 3W98D 1P3IA 5GXQD 1S32A 2HIOD 4M6BA 3LZ1C 1P34A 1KX5C 3V9RB 2NZDD 4JJND 3AFAA 3TU4D 5AV9A 1P3KB 3KUYC 3MGSC 1TAFB 4NE6A 3B6FD 1KX3A 5CPIA 5AY8C 1F1EA 1HQ3B 4Z2MH 4DRAA 4WU8A 1WWSA 4UUZB 4YM6D 5GSUB 4YS3D 3H0LC 4Z66C 3B6GD 1P3KA 3RELA 5B40C 1TAFA 2FJ7C 3B0DC 5B2JC 3C1CC 5B33B 5B32C 3MVDC 5CPKD 4LD9C 4WZSB 1P3PC 3KWQA 4UUZA 5GSUA 1HTAA 4J8XB 2VQRA 3X1TB 5CPJB 1M1AD 1P3FC 3AV1C 2RVQC 5B1LD 3LZ1D 3W97C 2XD5A 3WAAD 1W2EA 1KX5D 3AV2B 4X23C 3C1BC 2PYOC 3NQUA 3REJC 4G92B 1P3AB 4QLCB 3WKJC 4J8XA 4Z5TB 3KUYD 3MGSD 2W8SA 5CPJA 4HGAB 5AV8B 2NQBC 3A1IA 5AY8D 3UTBD 3X1SC 1WWIA 1ID3C 3A6ND 2CV5A 3LELB 5DNNC 3AV2A 5DNMB 1A7WA 3UTAB 5GT0B 1P3AA 4QLCA 1P3LB 2F8NB 2Y2KA 3MGRC 2FJ7D 5B2JD 4H9SC 5B32D 4WU9C 4LD9D 1EQZC 2FFFB 3LELA 5JA4A 4J8UC 3AZJB 1P3PD 2G5IC 4R8PC 5DNMA 5AV5B 1AOIB 3AN2C 5B0YB 3UTAA 3AZID 5AVBC 5GT0A 3MGPB 1P3LA 2F8NA 4J8VC 1P3FD 3AV1D 3AZFC 3W97D 3O62B 4KGCC 3LZ0B 4H9PB 4X23D 3C1BD 2Y2PA 2PYOD 3AZJA 3W96D 5AV5A 5B24B 4J8WD 3REJD 1AOIA 4G91B 3WKJD 5B0ZB 3X1VC 3MGPA 2Y2NA 3AZLC 3VH6W 1P3OC 5JRGC 2HIOC 1P3BB 3P5JB 3WTPC 1P3GC 1F66A 3O62A 3REHC 5DNND 1U35C 5F99C 3UT9C 4H9NB 3B0BA 4WV4B 2NZDB 2JCHA 5B24A 2ZM5A 5B0ZA 2F8NH 5BNVB 3MGRD 4XZQB 5B32G 2BYKB 5GT3C 3MGQB 1P3BA 4WU9D 1EQZD 2JE5A 3X1UC 4J8UD 3AZNC 4XUJB 4H9NA 3AN2D 2NZDA 2Y2GA 3VH6T 5AVBD 5BS7A 4J8VD 4XZQA 3AZFD 2BYKA 2IO5B 3MGQA 3AZHA 2BG1A 3WTPE 3AZGB 4KGCD 1TZYB 5CP6C 1M18C 3VH5T 4XUJA 1BH8B 5AVCD 3AZKB 4EO5B 5CHLB 3AZMC 2YFWB 3LJAB 3X1VD 1M1AC 3W99C 3AZLD 1P3OD 5JRGD 5B1LC 4H9QB 3WTPD 3UTBC 1P3GD 3WAAC 1P3MB 3REHD 3AZGA 1S32C 1TZYA 5F99D 3UT9D 1U35D 1P34C 3LZ1B 5B31B 3MNND 2AROA 5FUGB 1KX5B 2JSSA 1BH8A 3AFAC 3AZKA 3R45B 2YFWA 3LJAA 1JFIB 5GT3D 3A6NC 4H9QA 1KX3C 5CPIC 3V9RA 3X1UD 3AZND 5AY8B 1P3MA 5B31A 5FUGA 3REID 4WU8C 3R45A 3WA9B 3AZED 5B2IB 1JFIA 4Z66B 3RELC 1HQ3A 5B40B 3KSYA 3B0DB 5CP6D 5B2JB 3C1CB 5B32B 3MVDB 1M18D 5AY8A 1P3PB 3AZIC 3AZMD 1ZLAB 1KX4B 3KWQC 2F2AC 3W99D 3WA9A 5B2IA 5B33A 4Z66A 3REKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 A;  3B0C W;  1P3I D;  1S32 D;  1P34 D;  3C1C A;  3W96 C;  3MVD A;  4J8W C;  3C1B B;  2PYO B;  3AFA D;  3X1T A;  1ZLA A;  5AV6 B;  4E45 A;  1KX4 A;  5AV9 D;  3WKJ B;  3VH6 A;  4ZUX B;  5CPJ C;  3REK A;  5CPI D;  1KX3 D;  2NQB B;  3X1S B;  1ID3 B;  2CV5 C;  4E44 A;  5DNN B;  3AV2 C;  3VH5 A;  4WU8 D;  4KUD B;  4Z5T A;  5AV6 A;  4G92 C;  5AV8 A;  4QLC C;  1P3K D;  3REL D;  5B1M B;  1M19 B;  1R4V A;  4ZUX A;  4HGA C;  5E5A C;  4Z2M G;  2NQB A;  3X1S A;  1ID3 A;  1EQZ B;  2LY8 A;  3LEL C;  3AYW C;  5DNM C;  4R8P B;  3KWQ D;  3AN2 B;  4KUD A;  3UTA C;  5GSU D;  3KXB B;  5GT0 C;  5B1M A;  1M19 A;  2F8N K;  3AZF B;  2YFV B;  5AVC C;  2BYM B;  5B0Y A;  3AZJ C;  4ZBJ B;  4R8P A;  1AOI C;  3KXB A;  4J8X D;  3MGP C;  5C3I C;  3AZL B;  5CPJ D;  3W98 B;  3LZ0 A;  5GXQ B;  1P3O B;  4H9P A;  2HIO B;  2HUE C;  3WTP B;  1P3G B;  1F66 C;  2CV5 D;  3MNN C;  4DRB A;  4AWL B;  4JJN B;  5F99 B;  3UT9 B;  3AV2 D;  3TU4 B;  1Q9C A;  4G91 C;  4QLC D;  1P3A D;  1BH9 B;  3B6F B;  3W98 A;  5E5A D;  5GXQ A;  5GT3 B;  1P3B C;  2HIO A;  3LEL D;  3AZN B;  3AYW D;  3REI C;  4JJN A;  5DNM D;  3AZE C;  5KDM B;  4YM6 B;  5BNV A;  3UTA D;  3TU4 A;  4YS3 B;  4NFT A;  5GT0 D;  5G49 B;  3B6G B;  5BS7 C;  2F8N D;  1BH9 A;  3B6F A;  5CPK B;  3AZH C;  3MGQ C;  4CAY B;  3AZJ D;  4XUJ C;  5AV5 D;  1AOI D;  4H9R B;  1N1J B;  5KDM A;  4YM6 A;  4YS3 A;  5G49 A;  3MGP D;  3B6G A;  1M1A B;  1P3I C;  5B1L B;  1F66 D;  5CPK A;  1KU5 A;  3WAA B;  1TZY C;  2ARO C;  5B24 D;  4H9R A;  5AV9 C;  3AZK C;  1N1J A;  4EO5 C;  3AFA B;  3KUY B;  3LJA C;  3MGS B;  1BFM A;  1M1A A;  1P3B D;  5B1L A;  3LZ1 A;  3A6N B;  1KX3 B;  5CPI B;  3WAA A;  1P3M C;  1KX5 A;  4KHA B;  5BNX B;  5B31 C;  1B6W A;  2F8N G;  4WU8 B;  1P3K C;  3KUY A;  3MGS A;  2FJ7 B;  4WNN B;  4XZQ D;  3AZH D;  3MGQ D;  1HQ3 C;  3REL B;  4LD9 B;  3A6N A;  4XUJ D;  4KHA A;  2CWE A;  5BNX A;  3AZI B;  5GSU C;  3KWQ B;  3WA9 C;  1P3F B;  3AV1 B;  2FJ7 A;  5B2I C;  4WNN A;  5B2J A;  5B33 C;  5B32 A;  3W97 B;  5BT1 D;  4LD9 A;  3AZG D;  4X23 B;  1TZY D;  1P3P A;  3W96 B;  2ARO D;  4J8W B;  3REJ B;  3NQU B;  4NE5 A;  3AZK D;  3AZI A;  4J8X C;  3X1T C;  1ZLA C;  3LJA D;  1KX4 C;  1P3F A;  3AV1 A;  3W97 A;  3REK C;  1P3M D;  4X23 A;  3C1B A;  1H3O B;  2PYO A;  2CV5 B;  3W96 A;  5B31 D;  4J8W A;  3REJ A;  1P3A C;  3B0C T;  3WKJ A;  4Z5T C;  5AV6 C;  3MGR B;  3NQJ B;  5AV8 C;  4WU9 B;  1HQ3 D;  4ZUX C;  5E5A B;  5DNN A;  4J8U B;  4H9O B;  2L5A A;  1H3O A;  5JA4 B;  3AYW B;  5AVB B;  1P3L C;  4KUD C;  4J8V B;  3WA9 D;  3MGR A;  3NQJ A;  5B2I D;  4H9S A;  5B33 D;  4Z66 D;  4WU9 A;  4KGC B;  5B40 D;  5B1M C;  1M19 C;  1EQZ A;  3C1C D;  5E5A A;  4J8U A;  3MVD D;  5BO0 B;  4H9O A;  5AV5 C;  5AVC B;  3AN2 A;  5B0Y C;  3AYW A;  3X1T D;  5AVB A;  3X1V B;  1ZLA D;  1KX4 D;  4J8V A;  3KXB C;  5JRG B;  3AZF A;  5C3I B;  2YFV A;  3O62 C;  3REK D;  3LZ0 C;  3REH B;  4KGC A;  1U35 B;  2BYM A;  2HUE B;  2RVQ D;  1F66 B;  5B31 G;  3MNN B;  5BO0 A;  5B24 C;  5AVC A;  4ZBJ C;  5B0Z C;  4Z5T D;  3X1V A;  5AV6 D;  3AZL A;  1ULY A;  5AV8 D;  1P3O A;  5JRG A;  3WTP A;  1P3G A;  4ZUX D;  3W98 C;  3X1U B;  5GXQ C;  3REH A;  1U35 A;  5F99 A;  3UT9 A;  2NQB D;  3X1S D;  1ID3 D;  4AWL C;  3MNN A;  2NZD C;  4JJN C;  3REI B;  4NE3 A;  1P3L D;  3AZE B;  4KUD D;  3TU4 C;  3VH5 W;  4XZQ C;  5GT3 A;  3B6F C;  5B1M D;  5CP6 B;  1M19 D;  1M18 B;  4CSR B;  3X1U A;  3AZN A;  3AZH B;  5B0Y D;  3AZM B;  3REI A;  4R8P D;  3W99 B;  4YM6 C;  3AZE A;  4YS3 C;  3KXB D;  3B6G C;  2IO5 C;  3UTB B;  5BT1 C;  3O62 D;  3AZG C;  1B67 A;  3LZ0 D;  1S32 B;  4CAY A;  1P3I B;  5CP6 A;  1P34 B;  1M18 A;  4CSR A;  5CPK C;  3AZM A;  2ARO B;  5B0Z D;  5AV9 B;  3W99 A;  3UTB A;  3W98 D;  1P3I A;  5GXQ D;  1S32 A;  2HIO D;  4M6B A;  3LZ1 C;  1P34 A;  1KX5 C;  3V9R B;  2NZD D;  4JJN D;  3AFA A;  3TU4 D;  5AV9 A;  1P3K B;  3KUY C;  3MGS C;  1TAF B;  4NE6 A;  3B6F D;  1KX3 A;  5CPI A;  5AY8 C;  1F1E A;  1HQ3 B;  4Z2M H;  4DRA A;  4WU8 A;  1WWS A;  4UUZ B;  4YM6 D;  5GSU B;  4YS3 D;  4Z66 C;  3B6G D;  1P3K A;  3REL A;  5B40 C;  1TAF A;  2FJ7 C;  3B0D C;  5B2J C;  3C1C C;  5B33 B;  5B32 C;  3MVD C;  5CPK D;  4LD9 C;  4WZS B;  1P3P C;  3KWQ A;  4UUZ A;  5GSU A;  1HTA A;  4J8X B;  3X1T B;  5CPJ B;  1M1A D;  1P3F C;  3AV1 C;  2RVQ C;  5B1L D;  3LZ1 D;  3W97 C;  3WAA D;  1KX5 D;  3AV2 B;  4X23 C;  3C1B C;  2PYO C;  3NQU A;  3REJ C;  4G92 B;  1P3A B;  4QLC B;  3WKJ C;  4J8X A;  4Z5T B;  3KUY D;  3MGS D;  5CPJ A;  4HGA B;  5AV8 B;  2NQB C;  5AY8 D;  3UTB D;  3X1S C;  1WWI A;  1ID3 C;  3A6N D;  2CV5 A;  3LEL B;  5DNN C;  3AV2 A;  5DNM B;  1A7W A;  3UTA B;  5GT0 B;  1P3A A;  4QLC A;  1P3L B;  2F8N B;  3MGR C;  2FJ7 D;  5B2J D;  4H9S C;  5B32 D;  4WU9 C;  4LD9 D;  1EQZ C;  3LEL A;  5JA4 A;  4J8U C;  3AZJ B;  1P3P D;  4R8P C;  5DNM A;  5AV5 B;  1AOI B;  3AN2 C;  5B0Y B;  3UTA A;  3AZI D;  5AVB C;  5GT0 A;  3MGP B;  1P3L A;  2F8N A;  4J8V C;  1P3F D;  3AV1 D;  3AZF C;  3W97 D;  3O62 B;  4KGC C;  3LZ0 B;  4H9P B;  4X23 D;  3C1B D;  2PYO D;  3AZJ A;  3W96 D;  5AV5 A;  5B24 B;  4J8W D;  3REJ D;  1AOI A;  4G91 B;  3WKJ D;  5B0Z B;  3X1V C;  3MGP A;  3AZL C;  3VH6 W;  1P3O C;  5JRG C;  2HIO C;  1P3B B;  3WTP C;  1P3G C;  1F66 A;  3O62 A;  3REH C;  5DNN D;  1U35 C;  5F99 C;  3UT9 C;  4H9N B;  3B0B A;  4WV4 B;  2NZD B;  5B24 A;  5B0Z A;  2F8N H;  5BNV B;  3MGR D;  4XZQ B;  5B32 G;  2BYK B;  5GT3 C;  3MGQ B;  1P3B A;  4WU9 D;  1EQZ D;  3X1U C;  3AZN C;  4J8U D;  4XUJ B;  4H9N A;  3AN2 D;  2NZD A;  3VH6 T;  5AVB D;  5BS7 A;  4J8V D;  4XZQ A;  3AZF D;  2BYK A;  2IO5 B;  3MGQ A;  3AZH A;  3WTP E;  4KGC D;  3AZG B;  1TZY B;  5CP6 C;  1M18 C;  3VH5 T;  4XUJ A;  1BH8 B;  5AVC D;  3AZK B;  4EO5 B;  5CHL B;  3AZM C;  2YFW B;  3LJA B;  3X1V D;  1M1A C;  3W99 C;  3AZL D;  1P3O D;  5JRG D;  5B1L C;  4H9Q B;  3WTP D;  3UTB C;  1P3G D;  3WAA C;  1P3M B;  3REH D;  3AZG A;  1S32 C;  1TZY A;  5F99 D;  3UT9 D;  1U35 D;  1P34 C;  3LZ1 B;  5B31 B;  3MNN D;  2ARO A;  5FUG B;  1KX5 B;  2JSS A;  1BH8 A;  3AFA C;  3AZK A;  3R45 B;  2YFW A;  3LJA A;  1JFI B;  5GT3 D;  3A6N C;  4H9Q A;  1KX3 C;  5CPI C;  3V9R A;  3X1U D;  3AZN D;  5AY8 B;  1P3M A;  5B31 A;  5FUG A;  3REI D;  4WU8 C;  3R45 A;  3WA9 B;  3AZE D;  5B2I B;  1JFI A;  4Z66 B;  3REL C;  1HQ3 A;  5B40 B;  3KSY A;  3B0D B;  5CP6 D;  5B2J B;  3C1C B;  5B32 B;  3MVD B;  1M18 D;  5AY8 A;  1P3P B;  3AZI C;  3AZM D;  1ZLA B;  1KX4 B;  3KWQ C;  3W99 D;  3WA9 A;  5B2I A;  5B33 A;  4Z66 A;  3REK B; 
#chains in the Genus database with same CATH topology
 5B40 A;  3B0C W;  1P3I D;  1S32 D;  1P34 D;  3C1C A;  3W96 C;  3MVD A;  4J8W C;  3C1B B;  2PYO B;  3AFA D;  3X1T A;  1ZLA A;  5AV6 B;  4E45 A;  1KX4 A;  5AV9 D;  3WKJ B;  3VH6 A;  4ZUX B;  5CPJ C;  3REK A;  5CPI D;  1KX3 D;  2NQB B;  3X1S B;  1ID3 B;  2CV5 C;  4E44 A;  5DNN B;  1PZR A;  3AV2 C;  3VH5 A;  3KFU G;  4WU8 D;  4KUD B;  4Z5T A;  5AV6 A;  4G92 C;  5AV8 A;  4QLC C;  1P3K D;  2RIQ A;  3REL D;  2Y2I A;  5B1M B;  1M19 B;  2G5H C;  1R4V A;  4ZUX A;  4HGA C;  5E5A C;  4Z2M G;  2NQB A;  3X1S A;  1ID3 A;  1EQZ B;  2LY8 A;  3LEL C;  3AYW C;  5DNM C;  4R8P B;  3KWQ D;  3AN2 B;  4KUD A;  3UTA C;  5GSU D;  3KXB B;  5GT0 C;  3H0R C;  5B1M A;  2ZY3 A;  1M19 A;  2F8N K;  3AZF B;  2YFV B;  5AVC C;  2BYM B;  5B0Y A;  3AZJ C;  4ZBJ B;  4R8P A;  1AOI C;  3KXB A;  2J8P A;  4J8X D;  3MGP C;  5C3I C;  3AZL B;  5CPJ D;  3W98 B;  3LZ0 A;  5GXQ B;  1P3O B;  4H9P A;  2HIO B;  2HUE C;  3WTP B;  1P3G B;  1F66 C;  2CV5 D;  3MNN C;  4DRB A;  4AWL B;  4JJN B;  5F99 B;  3UT9 B;  3AV2 D;  2Y2O A;  3TU4 B;  1Q9C A;  4G91 C;  4QLC D;  1P3A D;  1BH9 B;  3B6F B;  3W98 A;  5E5A D;  5GXQ A;  5GT3 B;  1P3B C;  2HIO A;  3LEL D;  3AZN B;  3AYW D;  3REI C;  4JJN A;  5DNM D;  4WJ3 C;  3AZE C;  5KDM B;  4YM6 B;  5BNV A;  3UTA D;  3TU4 A;  4YS3 B;  4NFT A;  5GT0 D;  5G49 B;  3B6G B;  5BS7 C;  2F8N D;  3EG5 B;  1BH9 A;  2ZY5 A;  3B6F A;  5CPK B;  3AZH C;  3MGQ C;  4CAY B;  3AZJ D;  4XUJ C;  5AV5 D;  1AOI D;  4H9R B;  1N1J B;  5KDM A;  4YM6 A;  4YS3 A;  3EPL A;  5G49 A;  3MGP D;  3B6G A;  4UPK A;  1M1A B;  1P3I C;  3FDD A;  3H0M C;  5B1L B;  1F66 D;  5CPK A;  1KU5 A;  3WAA B;  1T3U A;  1TZY C;  2ARO C;  5B24 D;  4H9R A;  5AV9 C;  2XD1 A;  3AZK C;  1N1J A;  4EO5 C;  3AFA B;  3KUY B;  3LJA C;  3MGS B;  1BFM A;  1M1A A;  2DF4 C;  1P3B D;  5B1L A;  3LZ1 A;  3A6N B;  1KX3 B;  5CPI B;  3WAA A;  1P3M C;  1KX5 A;  4KHA B;  2UWX A;  5BNX B;  5B31 C;  1B6W A;  3AL0 C;  2F8N G;  4WU8 B;  1P3K C;  2Y2H A;  3KUY A;  3MGS A;  2FJ7 B;  4WNN B;  4XZQ D;  3AZH D;  3MGQ D;  1HQ3 C;  3REL B;  4LD9 B;  3A6N A;  4XUJ D;  4KHA A;  2CWE A;  5BNX A;  3AZI B;  5GSU C;  3KWQ B;  3EPK A;  3WA9 C;  1P3F B;  3AV1 B;  2FJ7 A;  5B2I C;  4WNN A;  5B2J A;  5B33 C;  5B32 A;  3W97 B;  2Y2L A;  5BT1 D;  4LD9 A;  3AZG D;  4X23 B;  1TZY D;  1P3P A;  3W96 B;  2ARO D;  4J8W B;  3REJ B;  3NQU B;  4NE5 A;  4DQY B;  3AZI A;  3AZK D;  4J8X C;  3X1T C;  1ZLA C;  3LJA D;  1KX4 C;  1P3F A;  3AV1 A;  1Z2C B;  3W97 A;  3REK C;  1P3M D;  4X23 A;  3C1B A;  1H3O B;  2PYO A;  2CV5 B;  3W96 A;  5B31 D;  4J8W A;  3REJ A;  1P3A C;  3B0C T;  3WKJ A;  4Z5T C;  3EPH A;  5AV6 C;  2Y2Q A;  3MGR B;  3NQJ B;  5AV8 C;  4WU9 B;  1HQ3 D;  4ZUX C;  5E5A B;  5DNN A;  4J8U B;  4H9O B;  2L5A A;  1H3O A;  3F6T A;  5JA4 B;  3AYW B;  5AVB B;  1P3L C;  4KUD C;  4J8V B;  3WA9 D;  3MGR A;  3NQJ A;  5B2I D;  4H9S A;  5B33 D;  4Z66 D;  4WU9 A;  4KGC B;  5B40 D;  5B1M C;  1M19 C;  1EQZ A;  3C1C D;  5E5A A;  4J8U A;  3MVD D;  5BO0 B;  4H9O A;  5AV5 C;  5AVC B;  3AN2 A;  5B0Y C;  3AYW A;  3X1T D;  5AVB A;  3X1V B;  1ZLA D;  1KX4 D;  4J8V A;  3KXB C;  5JRG B;  3AZF A;  5C3I B;  2YFV A;  3O62 C;  3REK D;  3LZ0 C;  3REH B;  4KGC A;  1U35 B;  2BYM A;  2HUE B;  2RVQ D;  1F66 B;  5B31 G;  3MNN B;  5BO0 A;  5B24 C;  5AVC A;  4ZBJ C;  5B0Z C;  4Z5T D;  3X1V A;  5AV6 D;  3AZL A;  1ULY A;  5AV8 D;  1P3O A;  5JRG A;  2Y2J A;  3WTP A;  1P3G A;  4ZUX D;  3W98 C;  3X1U B;  5GXQ C;  3A1K A;  3REH A;  1U35 A;  5F99 A;  3UT9 A;  2NQB D;  3X1S D;  1ID3 D;  3IP4 C;  4AWL C;  2ZY4 A;  3MNN A;  2NZD C;  4JJN C;  3REI B;  4NE3 A;  1P3L D;  2DQN C;  3AZE B;  4KUD D;  3TU4 C;  3VH5 W;  4XZQ C;  5GT3 A;  3B6F C;  5B1M D;  5CP6 B;  1M19 D;  1M18 B;  4CSR B;  3X1U A;  3AZN A;  3AZH B;  5B0Y D;  3AZM B;  3REI A;  4R8P D;  3W99 B;  4YM6 C;  3AZE A;  2ZY2 A;  4YS3 C;  3KXB D;  3EPJ A;  3B6G C;  2IO5 C;  3UTB B;  5BT1 C;  3O62 D;  3AZG C;  1B67 A;  3LZ0 D;  1S32 B;  4CAY A;  1P3I B;  5CP6 A;  1P34 B;  1M18 A;  4CSR A;  5CPK C;  3AZM A;  2ARO B;  5B0Z D;  5AV9 B;  3W99 A;  2Y2M A;  3UTB A;  3W98 D;  1P3I A;  5GXQ D;  1S32 A;  2HIO D;  4M6B A;  3LZ1 C;  1P34 A;  1KX5 C;  3V9R B;  2NZD D;  4JJN D;  3AFA A;  3TU4 D;  5AV9 A;  1P3K B;  3KUY C;  3MGS C;  1TAF B;  4NE6 A;  3B6F D;  1KX3 A;  5CPI A;  5AY8 C;  1F1E A;  1HQ3 B;  4Z2M H;  4DRA A;  4WU8 A;  1WWS A;  4UUZ B;  4YM6 D;  5GSU B;  4YS3 D;  3H0L C;  4Z66 C;  3B6G D;  1P3K A;  3REL A;  5B40 C;  1TAF A;  2FJ7 C;  3B0D C;  5B2J C;  3C1C C;  5B33 B;  5B32 C;  3MVD C;  5CPK D;  4LD9 C;  4WZS B;  1P3P C;  3KWQ A;  4UUZ A;  5GSU A;  1HTA A;  4J8X B;  2VQR A;  3X1T B;  5CPJ B;  1M1A D;  1P3F C;  3AV1 C;  2RVQ C;  5B1L D;  3LZ1 D;  3W97 C;  2XD5 A;  3WAA D;  1W2E A;  1KX5 D;  3AV2 B;  4X23 C;  3C1B C;  2PYO C;  3NQU A;  3REJ C;  4G92 B;  1P3A B;  4QLC B;  3WKJ C;  4J8X A;  4Z5T B;  3KUY D;  3MGS D;  2W8S A;  5CPJ A;  4HGA B;  5AV8 B;  2NQB C;  3A1I A;  5AY8 D;  3UTB D;  3X1S C;  1WWI A;  1ID3 C;  3A6N D;  2CV5 A;  3LEL B;  5DNN C;  3AV2 A;  5DNM B;  1A7W A;  3UTA B;  5GT0 B;  1P3A A;  4QLC A;  1P3L B;  2F8N B;  2Y2K A;  3MGR C;  2FJ7 D;  5B2J D;  4H9S C;  5B32 D;  4WU9 C;  4LD9 D;  1EQZ C;  2FFF B;  3LEL A;  5JA4 A;  4J8U C;  3AZJ B;  1P3P D;  2G5I C;  4R8P C;  5DNM A;  5AV5 B;  1AOI B;  3AN2 C;  5B0Y B;  3UTA A;  3AZI D;  5AVB C;  5GT0 A;  3MGP B;  1P3L A;  2F8N A;  4J8V C;  1P3F D;  3AV1 D;  3AZF C;  3W97 D;  3O62 B;  4KGC C;  3LZ0 B;  4H9P B;  4X23 D;  3C1B D;  2Y2P A;  2PYO D;  3AZJ A;  3W96 D;  5AV5 A;  5B24 B;  4J8W D;  3REJ D;  1AOI A;  4G91 B;  3WKJ D;  5B0Z B;  3X1V C;  3MGP A;  2Y2N A;  3AZL C;  3VH6 W;  1P3O C;  5JRG C;  2HIO C;  1P3B B;  3P5J B;  3WTP C;  1P3G C;  1F66 A;  3O62 A;  3REH C;  5DNN D;  1U35 C;  5F99 C;  3UT9 C;  4H9N B;  3B0B A;  4WV4 B;  2NZD B;  2JCH A;  5B24 A;  2ZM5 A;  5B0Z A;  2F8N H;  5BNV B;  3MGR D;  4XZQ B;  5B32 G;  2BYK B;  5GT3 C;  3MGQ B;  1P3B A;  4WU9 D;  1EQZ D;  2JE5 A;  3X1U C;  4J8U D;  3AZN C;  4XUJ B;  4H9N A;  3AN2 D;  2NZD A;  2Y2G A;  3VH6 T;  5AVB D;  5BS7 A;  4J8V D;  4XZQ A;  3AZF D;  2BYK A;  2IO5 B;  3MGQ A;  3AZH A;  2BG1 A;  3WTP E;  3AZG B;  4KGC D;  1TZY B;  5CP6 C;  1M18 C;  3VH5 T;  4XUJ A;  1BH8 B;  5AVC D;  3AZK B;  4EO5 B;  5CHL B;  3AZM C;  2YFW B;  3LJA B;  3X1V D;  1M1A C;  3W99 C;  3AZL D;  1P3O D;  5JRG D;  5B1L C;  4H9Q B;  3WTP D;  3UTB C;  1P3G D;  3WAA C;  1P3M B;  3REH D;  3AZG A;  1S32 C;  1TZY A;  5F99 D;  3UT9 D;  1U35 D;  1P34 C;  3LZ1 B;  5B31 B;  3MNN D;  2ARO A;  5FUG B;  1KX5 B;  2JSS A;  1BH8 A;  3AFA C;  3AZK A;  3R45 B;  2YFW A;  3LJA A;  1JFI B;  5GT3 D;  3A6N C;  4H9Q A;  1KX3 C;  5CPI C;  3V9R A;  3X1U D;  3AZN D;  5AY8 B;  1P3M A;  5B31 A;  5FUG A;  3REI D;  4WU8 C;  3R45 A;  3WA9 B;  3AZE D;  5B2I B;  1JFI A;  4Z66 B;  3REL C;  1HQ3 A;  5B40 B;  3KSY A;  3B0D B;  5CP6 D;  5B2J B;  3C1C B;  5B32 B;  3MVD B;  1M18 D;  5AY8 A;  1P3P B;  3AZI C;  3AZM D;  1ZLA B;  1KX4 B;  3KWQ C;  2F2A C;  3W99 D;  3WA9 A;  5B2I A;  5B33 A;  4Z66 A;  3REK B; 
#chains in the Genus database with same CATH homology
 5B40 A;  3B0C W;  1P3I D;  1S32 D;  1P34 D;  3C1C A;  3W96 C;  3MVD A;  4J8W C;  3C1B B;  2PYO B;  3AFA D;  3X1T A;  1ZLA A;  5AV6 B;  4E45 A;  1KX4 A;  5AV9 D;  3WKJ B;  3VH6 A;  4ZUX B;  5CPJ C;  3REK A;  5CPI D;  1KX3 D;  2NQB B;  3X1S B;  1ID3 B;  2CV5 C;  4E44 A;  5DNN B;  1PZR A;  3AV2 C;  3VH5 A;  3KFU G;  4WU8 D;  4KUD B;  4Z5T A;  5AV6 A;  4G92 C;  5AV8 A;  4QLC C;  1P3K D;  2RIQ A;  3REL D;  2Y2I A;  5B1M B;  1M19 B;  2G5H C;  1R4V A;  4ZUX A;  4HGA C;  5E5A C;  4Z2M G;  2NQB A;  3X1S A;  1ID3 A;  1EQZ B;  2LY8 A;  3LEL C;  3AYW C;  5DNM C;  4R8P B;  3KWQ D;  3AN2 B;  4KUD A;  3UTA C;  5GSU D;  3KXB B;  5GT0 C;  3H0R C;  5B1M A;  2ZY3 A;  1M19 A;  2F8N K;  3AZF B;  2YFV B;  5AVC C;  2BYM B;  5B0Y A;  3AZJ C;  4ZBJ B;  4R8P A;  1AOI C;  3KXB A;  2J8P A;  4J8X D;  3MGP C;  5C3I C;  3AZL B;  5CPJ D;  3W98 B;  3LZ0 A;  5GXQ B;  1P3O B;  4H9P A;  2HIO B;  2HUE C;  3WTP B;  1P3G B;  1F66 C;  2CV5 D;  3MNN C;  4DRB A;  4AWL B;  4JJN B;  5F99 B;  3UT9 B;  3AV2 D;  2Y2O A;  3TU4 B;  1Q9C A;  4G91 C;  4QLC D;  1P3A D;  1BH9 B;  3B6F B;  3W98 A;  5E5A D;  5GXQ A;  5GT3 B;  1P3B C;  2HIO A;  3LEL D;  3AZN B;  3AYW D;  3REI C;  4JJN A;  5DNM D;  4WJ3 C;  3AZE C;  5KDM B;  4YM6 B;  5BNV A;  3UTA D;  3TU4 A;  4YS3 B;  4NFT A;  5GT0 D;  5G49 B;  3B6G B;  5BS7 C;  2F8N D;  3EG5 B;  1BH9 A;  2ZY5 A;  3B6F A;  5CPK B;  3AZH C;  3MGQ C;  4CAY B;  3AZJ D;  4XUJ C;  5AV5 D;  1AOI D;  4H9R B;  1N1J B;  5KDM A;  4YM6 A;  4YS3 A;  3EPL A;  5G49 A;  3MGP D;  3B6G A;  4UPK A;  1M1A B;  1P3I C;  3FDD A;  3H0M C;  5B1L B;  1F66 D;  5CPK A;  1KU5 A;  3WAA B;  1T3U A;  1TZY C;  2ARO C;  5B24 D;  4H9R A;  5AV9 C;  2XD1 A;  3AZK C;  1N1J A;  4EO5 C;  3AFA B;  3KUY B;  3LJA C;  3MGS B;  1BFM A;  1M1A A;  2DF4 C;  1P3B D;  5B1L A;  3LZ1 A;  3A6N B;  1KX3 B;  5CPI B;  3WAA A;  1P3M C;  1KX5 A;  4KHA B;  2UWX A;  5BNX B;  5B31 C;  1B6W A;  3AL0 C;  2F8N G;  4WU8 B;  1P3K C;  2Y2H A;  3KUY A;  3MGS A;  2FJ7 B;  4WNN B;  4XZQ D;  3AZH D;  3MGQ D;  1HQ3 C;  3REL B;  4LD9 B;  3A6N A;  4XUJ D;  4KHA A;  2CWE A;  5BNX A;  3AZI B;  5GSU C;  3KWQ B;  3EPK A;  3WA9 C;  1P3F B;  3AV1 B;  2FJ7 A;  5B2I C;  4WNN A;  5B2J A;  5B33 C;  5B32 A;  3W97 B;  2Y2L A;  5BT1 D;  4LD9 A;  3AZG D;  4X23 B;  1TZY D;  1P3P A;  3W96 B;  2ARO D;  4J8W B;  3REJ B;  3NQU B;  4NE5 A;  4DQY B;  3AZI A;  3AZK D;  4J8X C;  3X1T C;  1ZLA C;  3LJA D;  1KX4 C;  1P3F A;  3AV1 A;  1Z2C B;  3W97 A;  3REK C;  1P3M D;  4X23 A;  3C1B A;  1H3O B;  2PYO A;  2CV5 B;  3W96 A;  5B31 D;  4J8W A;  3REJ A;  1P3A C;  3B0C T;  3WKJ A;  4Z5T C;  3EPH A;  5AV6 C;  2Y2Q A;  3MGR B;  3NQJ B;  5AV8 C;  4WU9 B;  1HQ3 D;  4ZUX C;  5E5A B;  5DNN A;  4J8U B;  4H9O B;  2L5A A;  1H3O A;  3F6T A;  5JA4 B;  3AYW B;  5AVB B;  1P3L C;  4KUD C;  4J8V B;  3WA9 D;  3MGR A;  3NQJ A;  5B2I D;  4H9S A;  5B33 D;  4Z66 D;  4WU9 A;  4KGC B;  5B40 D;  5B1M C;  1M19 C;  1EQZ A;  3C1C D;  5E5A A;  4J8U A;  3MVD D;  5BO0 B;  4H9O A;  5AV5 C;  5AVC B;  3AN2 A;  5B0Y C;  3AYW A;  3X1T D;  5AVB A;  3X1V B;  1ZLA D;  1KX4 D;  4J8V A;  3KXB C;  5JRG B;  3AZF A;  5C3I B;  2YFV A;  3O62 C;  3REK D;  3LZ0 C;  3REH B;  4KGC A;  1U35 B;  2BYM A;  2HUE B;  2RVQ D;  1F66 B;  5B31 G;  3MNN B;  5BO0 A;  5B24 C;  5AVC A;  4ZBJ C;  5B0Z C;  4Z5T D;  3X1V A;  5AV6 D;  3AZL A;  1ULY A;  5AV8 D;  1P3O A;  5JRG A;  2Y2J A;  3WTP A;  1P3G A;  4ZUX D;  3W98 C;  3X1U B;  5GXQ C;  3A1K A;  3REH A;  1U35 A;  5F99 A;  3UT9 A;  2NQB D;  3X1S D;  1ID3 D;  3IP4 C;  4AWL C;  2ZY4 A;  3MNN A;  2NZD C;  4JJN C;  3REI B;  4NE3 A;  1P3L D;  2DQN C;  3AZE B;  4KUD D;  3TU4 C;  3VH5 W;  4XZQ C;  5GT3 A;  3B6F C;  5B1M D;  5CP6 B;  1M19 D;  1M18 B;  4CSR B;  3X1U A;  3AZN A;  3AZH B;  5B0Y D;  3AZM B;  3REI A;  4R8P D;  3W99 B;  4YM6 C;  3AZE A;  2ZY2 A;  4YS3 C;  3KXB D;  3EPJ A;  3B6G C;  2IO5 C;  3UTB B;  5BT1 C;  3O62 D;  3AZG C;  1B67 A;  3LZ0 D;  1S32 B;  4CAY A;  1P3I B;  5CP6 A;  1P34 B;  1M18 A;  4CSR A;  5CPK C;  3AZM A;  2ARO B;  5B0Z D;  5AV9 B;  3W99 A;  2Y2M A;  3UTB A;  3W98 D;  1P3I A;  5GXQ D;  1S32 A;  2HIO D;  4M6B A;  3LZ1 C;  1P34 A;  1KX5 C;  3V9R B;  2NZD D;  4JJN D;  3AFA A;  3TU4 D;  5AV9 A;  1P3K B;  3KUY C;  3MGS C;  1TAF B;  4NE6 A;  3B6F D;  1KX3 A;  5CPI A;  5AY8 C;  1F1E A;  1HQ3 B;  4Z2M H;  4DRA A;  4WU8 A;  1WWS A;  4UUZ B;  4YM6 D;  5GSU B;  4YS3 D;  3H0L C;  4Z66 C;  3B6G D;  1P3K A;  3REL A;  5B40 C;  1TAF A;  2FJ7 C;  3B0D C;  5B2J C;  3C1C C;  5B33 B;  5B32 C;  3MVD C;  5CPK D;  4LD9 C;  4WZS B;  1P3P C;  3KWQ A;  4UUZ A;  5GSU A;  1HTA A;  4J8X B;  2VQR A;  3X1T B;  5CPJ B;  1M1A D;  1P3F C;  3AV1 C;  2RVQ C;  5B1L D;  3LZ1 D;  3W97 C;  2XD5 A;  3WAA D;  1W2E A;  1KX5 D;  3AV2 B;  4X23 C;  3C1B C;  2PYO C;  3NQU A;  3REJ C;  4G92 B;  1P3A B;  4QLC B;  3WKJ C;  4J8X A;  4Z5T B;  3KUY D;  3MGS D;  2W8S A;  5CPJ A;  4HGA B;  5AV8 B;  2NQB C;  3A1I A;  5AY8 D;  3UTB D;  3X1S C;  1WWI A;  1ID3 C;  3A6N D;  2CV5 A;  3LEL B;  5DNN C;  3AV2 A;  5DNM B;  1A7W A;  3UTA B;  5GT0 B;  1P3A A;  4QLC A;  1P3L B;  2F8N B;  2Y2K A;  3MGR C;  2FJ7 D;  5B2J D;  4H9S C;  5B32 D;  4WU9 C;  4LD9 D;  1EQZ C;  2FFF B;  3LEL A;  5JA4 A;  4J8U C;  3AZJ B;  1P3P D;  2G5I C;  4R8P C;  5DNM A;  5AV5 B;  1AOI B;  3AN2 C;  5B0Y B;  3UTA A;  3AZI D;  5AVB C;  5GT0 A;  3MGP B;  1P3L A;  2F8N A;  4J8V C;  1P3F D;  3AV1 D;  3AZF C;  3W97 D;  3O62 B;  4KGC C;  3LZ0 B;  4H9P B;  4X23 D;  3C1B D;  2Y2P A;  2PYO D;  3AZJ A;  3W96 D;  5AV5 A;  5B24 B;  4J8W D;  3REJ D;  1AOI A;  4G91 B;  3WKJ D;  5B0Z B;  3X1V C;  3MGP A;  2Y2N A;  3AZL C;  3VH6 W;  1P3O C;  5JRG C;  2HIO C;  1P3B B;  3P5J B;  3WTP C;  1P3G C;  1F66 A;  3O62 A;  3REH C;  5DNN D;  1U35 C;  5F99 C;  3UT9 C;  4H9N B;  3B0B A;  4WV4 B;  2NZD B;  2JCH A;  5B24 A;  2ZM5 A;  5B0Z A;  2F8N H;  5BNV B;  3MGR D;  4XZQ B;  5B32 G;  2BYK B;  5GT3 C;  3MGQ B;  1P3B A;  4WU9 D;  1EQZ D;  2JE5 A;  3X1U C;  4J8U D;  3AZN C;  4XUJ B;  4H9N A;  3AN2 D;  2NZD A;  2Y2G A;  3VH6 T;  5AVB D;  5BS7 A;  4J8V D;  4XZQ A;  3AZF D;  2BYK A;  2IO5 B;  3MGQ A;  3AZH A;  2BG1 A;  3WTP E;  3AZG B;  4KGC D;  1TZY B;  5CP6 C;  1M18 C;  3VH5 T;  4XUJ A;  1BH8 B;  5AVC D;  3AZK B;  4EO5 B;  5CHL B;  3AZM C;  2YFW B;  3LJA B;  3X1V D;  1M1A C;  3W99 C;  3AZL D;  1P3O D;  5JRG D;  5B1L C;  4H9Q B;  3WTP D;  3UTB C;  1P3G D;  3WAA C;  1P3M B;  3REH D;  3AZG A;  1S32 C;  1TZY A;  5F99 D;  3UT9 D;  1U35 D;  1P34 C;  3LZ1 B;  5B31 B;  3MNN D;  2ARO A;  5FUG B;  1KX5 B;  2JSS A;  1BH8 A;  3AFA C;  3AZK A;  3R45 B;  2YFW A;  3LJA A;  1JFI B;  5GT3 D;  3A6N C;  4H9Q A;  1KX3 C;  5CPI C;  3V9R A;  3X1U D;  3AZN D;  5AY8 B;  1P3M A;  5B31 A;  5FUG A;  3REI D;  4WU8 C;  3R45 A;  3WA9 B;  3AZE D;  5B2I B;  1JFI A;  4Z66 B;  3REL C;  1HQ3 A;  5B40 B;  3KSY A;  3B0D B;  5CP6 D;  5B2J B;  3C1C B;  5B32 B;  3MVD B;  1M18 D;  5AY8 A;  1P3P B;  3AZI C;  3AZM D;  1ZLA B;  1KX4 B;  3KWQ C;  2F2A C;  3W99 D;  3WA9 A;  5B2I A;  5B33 A;  4Z66 A;  3REK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...