5BS7C

Structure of histone h3/h4 in complex with spt2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
69
structure length
69
Chain Sequence
QGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Histone H3.2
publication title Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2.
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bs7C00
4X23C 4AWLC 1F66A 5AVCC 1P3BD 2FJ7C 4LD9B 5B2JB 3MVDD 1AOIA 1M1AB 1ZLAA 2NQBA 5GXQA 4J8XD 3REHD 4H9PB 3B6FC 1U35D 3VH6T 4WU8C 1P3AB 4G91C 2HIOB 4Z2MH 3MGQC 4LD9A 5B2JA 1M1AA 4J8WD 5B0ZA 4H9PA 4HGAC 2HIOA 4Z66D 3MNND 4H9SC 4ZBJC 5GSUD 4Z5TA 1A7WA 3X1TD 3AZND 5CPID 5B0YD 5CP6B 3MGRD 3W97D 3WAAC 3AZJC 5JRGC 1HQ3C 4NFTA 3AZGB 3AZHB 5CP6A 1P3LD 5AV8B 4J8VC 1F66C 4G92C 1AOIC 4DRAA 4J8UA 1ZLAC 2NQBC 1P3PB 3AZHA 5GXQC 3UTBD 1KX5C 5AV8A 4YS3B 4H9OB 3O62D 1P34C 5B2JC 1R4VA 3REKB 3AZMD 3V9RB 4ZUXD 3AYWA 5B0ZC 1P3FA 3AZLD 4YS3A 2HIOC 4H9OA 5B1MB 4R8PD 3W96A 1P3KB 3TU4D 3REKA 4Z5TC 3RELB 3V9RA 1TZYA 4XZQB 4UUZB 4NE5A 3AFAB 5B1MA 1P3KA 3UT9D 3AV1B 4H9QB 3RELA 3AN2A 2JSSA 4QLCD 2NZDA 4XZQA 1S32D 5AY8D 5CP6C 3AFAA 3AV1A 4H9QA 1P3IB 3WTPE 3B0DC 4J8UC 3WKJC 4H9NB 5AV8C 3W98B 3AV2B 1P3IA 2CV5D 4XUJD 3B6GC 3AZED 3WTPB 3AYWC 2YFWA 5F99D 1P3FC 3REID 3W98A 1HTAA 4X23B 3MGSD 4YS3C 4AWLB 3AV2A 3W96C 3LZ0A 5CPJB 4EO5C 3REKC 5CHLB 3WTPA 3B6FB 1TZYC 5CPKD 5B1LD 3LZ1B 1P3KC 5CPJA 3RELC 3AN2C 3X1UD 5KDMB 2HUEC 3B6FA 2NZDC 3LZ1A 5BT1D 3UTAD 4YM6D 1P3OB 4KUDD 2YFVB 5AVBD 3REJD 5DNND 3MGPD 5B32D 5GT3B 5KDMA 1H3OA 1P3OA 1P3MD 3X1SA 1P3BB 3WAAB 3AZJB 4H9SA 3MVDB 1HQ3B 1KX3C 4WU9D 5GT3A 1KX4D 4J8XB 5AV9A 1U35B 3W98C 4J8VB 1P3BA 1EQZB 3AZJA 4G92B 4NE6A 3MVDA 3AZFD 3LZ0C 3C1BD 3AZID 2RVQC 1M19D 3KWQD 3WTPC 4J8XA 3REHA 1U35A 1KX5B 4J8VA 1EQZA 4Z66B 3MNNB 5CPJC 1P34B 5GSUB 4CAYA 4J8WA 3AZNB 1BFMA 5JA4A 5B0ZB 1KX5A 3LZ1C 3A6NC 4Z66A 3W97B 3MNNA 2F8NK 1P34A 3X1VB 5B2IC 5GSUA 3KXBD 4Z5TB 3AZNA 3X1TA 5CPIA 2AROD 5DNMB 3MGRA 1P3LB 5AV5D 1P3OC 3W97A 3X1SC 3X1VA 4JJND 5GT3C 1ID3C 1BH9B 5DNMA 3UTBB 5JRGD 5AV9C 5AV6C 1P3LA 1JFIA 1B6WA 1P3BC 3MVDC 5E5AB 1M18D 3B0DB 4J8UB 1BH9A 4J8XC 3REHC 3UTBA 3WKJB 3LELD 1U35C 4NE3A 1AOID 4R8PB 1EQZC 5E5AA 3VH5W 5GXQD 3AZMA 3B6GB 4ZUXA 4J8WC 3AYWB 3WKJA 2F8NH 2IO5C 4LD9D 1M1AD 1P3FB 4R8PA 1KU5A 4Z66C 5B40D 3MNNC 3W96B 5GSUC 4EO5B 3B6GA 1P3AD 3AZNC 3X1TC 5CPIC 2HIOD 5B0YC 5G49A 1TZYB 3WA9D 3MGRC 3C1CD 3W97C 3X1VC 4Z2MG 3AN2B 4KGCD 5DNMC 2HUEB 5AY8A 2NZDB 3AZKD 1P3LC 4XUJB 4E44A 3AZEB 2F8NB 1TAFB 3KUYD 5B33D 3UTBC 5BNXA 5F99B 3REIB 3B0CW 3AZGD 3O62C 2CV5A 4XUJA 5E5AC 3AZHD 5BS7A 3AZEA 1KX3B 2F8NA 1TAFA 3AZMC 4ZUXC 5F99A 5CPKB 5B1LB 2YFWB 3REIA 3MGSA 4R8PC 1P3PD 3LZ0B 1KX3A 5B31D 5CPKA 5B1LA 4CSRA 2F8NG 4KUDB 3UT9C 5AVBB 3REJB 5B1MD 1S32C 5AY8C 3UTAA 1P3MB 3A6NB 3RELD 4KUDA 5AVBA 5B2IB 3REJA 4XZQD 5DNNA 4WU9B 5B32A 3AFAD 3LJAD 1H3OB 3AV1D 1P3MA 3A6NA 1Q9CA 5B24B 3X1SB 5B2IA 2CV5C 4XUJC 4WU9A 3R45B 5BS7C 1M19B 3AZEC 1ID3B 2BYMB 1P3ID 5GT0B 5AV6B 5AV9B 5F99C 3REIC 5B24A 3MGSC 3AZFA 2PYOD 1M19A 3R45A 3KWQA 1ID3A 2BYMA 3W98D 3AV2D 5GT0A 3REHB 5AV6A 5CPKC 5B1LC 1P3GD 4WZSB 3KXBB 5AV6D 3W99D 2L5AA 4CAYB 3X1UC 4X23D 4J8WB 5AVCD 2FJ7D 2IO5B 5BT1C 5JA4B 4YM6C 3UTAC 4KUDC 3VH5A 5AVBC 3KXBA 3B6FD 3REJC 5DNNC 5B32C 3X1TB 4WU8D 5CPIB 3MGQD 5AV5A 5B0YB 1P3MC 3MGRB 4JJNA 4WU9C 1P3OD 3B0CT 5B0YA 1JFIB 5B24C 5GT3D 3AZFC 3AZIC 1M19C 1M18A 3KWQC 3WAAD 3LELA 3AZJD 4WNNB 5GT0C 1HQ3D 3O62B 5B40B 1F1EA 3AZMB 2BYKB 4ZUXB 4J8VD 1F66D 1EQZD 4WNNA 4M6BA 3WA9B 3B0BA 3AZLB 3C1CB 3O62A 1ZLAD 5B40A 2NQBD 3TU4B 3KXBC 1KX5D 1P3AA 4DRBA 2BYKA 4KGCB 5BNVB 2AROC 3NQUB 3WA9A 1P34D 3AZKB 5C3IC 5B2JD 5AV5C 5G49B 3AZLA 3C1CA 4E45A 3UT9B 4JJNC 3TU4A 5B0ZD 4QLCB 4KGCA 3KUYB 5BNVA 3NQUA 3VH6A 5B33B 3AZKA 3X1VD 1S32B 5AY8B 4Z5TD 3UT9A 5DNMD 4QLCA 1M18C 3KUYA 4KHAB 5B33A 3LELC 1S32A 5BNXB 1N1JB 3AZGA 3KSYA 2CV5B 5CP6D 4KHAA 5B31B 4LD9C 5E5AD 1N1JA 1M1AC 3MGSB 4J8UD 1P3PA 5B40C 3WKJD 1P3AC 5AV8D 5B31A 3WA9C 3AZLC 3C1CC 4CSRB 3B6GD 3AYWD 3TU4C 1P3FD 3LJAB 3X1UB 4KGCC 4YS3D 3VH6W 3AZKC 3W96D 3UTAB 4YM6B 3REKD 4WV4B 5B31G 4UUZA 1TZYD 5DNNB 3MGPB 4QLCC 5B32B 3X1UA 3LJAA 3KUYC 5B33C 1P3KD 4YM6A 3AZGC 2LY8A 3AN2D 2PYOB 3AZHC 2NZDD 3NQJB 3MGPA 1B67A 1KX4B 1BH8B 1P3GB 2F8ND 1ULYA 1P3PC 2PYOA 5FUGB 3AZFB 3C1BB 3NQJA 3AZIB 4H9NA 3W99B 1KX4A 3KWQB 5AVCB 5B31C 1BH8A 2FJ7B 1P3GA 1WWIA 1KX3D 3VH5T 5B32G 5FUGA 3C1BA 3AZIA 3W99A 4WU8B 4X23A 5B1MC 4G91B 5BO0B 1WWSA 5AVCA 3MGQB 2FJ7A 3LZ0D 2RVQD 4H9RB 3WTPD 4XZQC 4WU8A 3AFAC 4HGAB 5BO0A 3LJAC 3MGQA 2CWEA 2AROB 3AV1C 5CPJD 5C3IB 4ZBJB 5AV5B 4H9RA 4JJNB 3LZ1D 3MGPC 3A6ND 2AROA 1P3IC 2YFVA 5JRGB 5B2ID 2PYOC 1M18B 1KX4C 5B24D 3AV2C 3X1SD 1F66B 3WAAA 5JRGA 3LELB 1HQ3A 1P3GC 1AOIB 1ZLAB 1ID3D 2NQBB 3C1BC 5GXQB 5GT0D 3W99C 5AV9D
chains in the Genus database with same CATH superfamily
4X23C 4AWLC 1F66A 5AVCC 3FDDA 3H0LC 1P3BD 2ZY2A 2FJ7C 4LD9B 5B2JB 3MVDD 1AOIA 1M1AB 1ZLAA 2Y2PA 2NQBA 1PZRA 5GXQA 4J8XD 3REHD 4H9PB 3B6FC 1U35D 3VH6T 4WU8C 1P3AB 3IP4C 2HIOB 4G91C 4Z2MH 3MGQC 3EPJA 4LD9A 5B2JA 1M1AA 4J8WD 5B0ZA 4H9PA 4HGAC 2HIOA 4Z66D 2DF4C 3MNND 4H9SC 4ZBJC 5GSUD 4Z5TA 1A7WA 3X1TD 3AZND 5CPID 5B0YD 5CP6B 3MGRD 3W97D 3WAAC 3AZJC 5JRGC 1HQ3C 4NFTA 3AZGB 3AZHB 5CP6A 1P3LD 5AV8B 4J8VC 1F66C 4G92C 1AOIC 4DRAA 4J8UA 1ZLAC 2NQBC 1P3PB 3AZHA 5GXQC 3UTBD 2RIQA 1KX5C 5AV8A 4YS3B 4H9OB 3O62D 3EPLA 1P34C 5B2JC 1R4VA 2JE5A 3REKB 3AZMD 3V9RB 4ZUXD 3AYWA 5B0ZC 1P3FA 3AZLD 4YS3A 2HIOC 4H9OA 5B1MB 4R8PD 3W96A 1P3KB 3TU4D 3REKA 4Z5TC 3RELB 3V9RA 1TZYA 4XZQB 2DQNC 4UUZB 4DQYB 4NE5A 3AFAB 5B1MA 1P3KA 3UT9D 3AV1B 2BG1A 4H9QB 3RELA 3AN2A 2JSSA 4QLCD 2NZDA 4XZQA 1S32D 5AY8D 5CP6C 3AFAA 3AV1A 4H9QA 1P3IB 3WTPE 1W2EA 3B0DC 4J8UC 3AL0C 3WKJC 4H9NB 5AV8C 3W98B 3AV2B 1P3IA 2CV5D 4XUJD 3B6GC 3AZED 3WTPB 3AYWC 2YFWA 5F99D 1P3FC 3REID 3W98A 1HTAA 4X23B 3MGSD 4YS3C 2Y2KA 4AWLB 3AV2A 2Y2LA 3W96C 3LZ0A 5CPJB 4EO5C 3REKC 5CHLB 3WTPA 2F2AC 3B6FB 1TZYC 5CPKD 5B1LD 3LZ1B 1P3KC 5CPJA 3RELC 3AN2C 3X1UD 2VQRA 5KDMB 2HUEC 3B6FA 2NZDC 3LZ1A 5BT1D 3UTAD 4YM6D 1P3OB 4KUDD 2YFVB 5AVBD 3REJD 5DNND 3MGPD 5B32D 5GT3B 5KDMA 1H3OA 1P3OA 1P3MD 3EG5B 3X1SA 1P3BB 3WAAB 3AZJB 2Y2MA 4H9SA 3MVDB 1HQ3B 1KX3C 4WU9D 5GT3A 1KX4D 4J8XB 5AV9A 1U35B 3W98C 4J8VB 1P3BA 1EQZB 3AZJA 4G92B 4NE6A 3MVDA 3AZFD 3LZ0C 3C1BD 3AZID 2RVQC 1M19D 3KWQD 3WTPC 4J8XA 3REHA 1U35A 1KX5B 4J8VA 1EQZA 4Z66B 3MNNB 5CPJC 1P34B 5GSUB 4CAYA 4J8WA 3AZNB 1BFMA 5JA4A 5B0ZB 1KX5A 2ZM5A 3LZ1C 3A6NC 4Z66A 3W97B 3MNNA 2F8NK 1P34A 3X1VB 5B2IC 5GSUA 3KXBD 4Z5TB 3AZNA 3X1TA 5CPIA 2AROD 5DNMB 3MGRA 1P3LB 5AV5D 1P3OC 3W97A 3X1SC 3X1VA 4JJND 5GT3C 1ID3C 1BH9B 5DNMA 3UTBB 5JRGD 5AV9C 5AV6C 1P3LA 1JFIA 1B6WA 1P3BC 3MVDC 5E5AB 1M18D 3B0DB 4J8UB 1BH9A 4J8XC 3REHC 3UTBA 3WKJB 3LELD 1U35C 4NE3A 1AOID 4R8PB 1EQZC 5E5AA 2ZY4A 3VH5W 5GXQD 3AZMA 2W8SA 4ZUXA 3B6GB 4J8WC 3F6TA 3AYWB 3WKJA 2F8NH 2IO5C 4LD9D 1M1AD 1P3FB 4R8PA 1KU5A 4Z66C 5B40D 3MNNC 3W96B 5GSUC 4EO5B 3B6GA 1P3AD 3AZNC 3X1TC 5CPIC 2HIOD 5B0YC 5G49A 1TZYB 3WA9D 3MGRC 3C1CD 3W97C 3X1VC 4Z2MG 3AN2B 4KGCD 5DNMC 2HUEB 5AY8A 2NZDB 3AZKD 1P3LC 4XUJB 4E44A 3AZEB 2F8NB 1TAFB 3EPHA 3KUYD 5B33D 3UTBC 5BNXA 5F99B 3REIB 3B0CW 3AZGD 3O62C 2CV5A 4XUJA 5E5AC 3AZHD 5BS7A 3AZEA 3H0RC 1KX3B 1TAFA 3AZMC 2F8NA 4ZUXC 5F99A 5CPKB 5B1LB 2YFWB 3REIA 3MGSA 4R8PC 1P3PD 3LZ0B 1KX3A 4UPKA 5B31D 5CPKA 5B1LA 2XD1A 4CSRA 2Y2GA 2Y2IA 2F8NG 4KUDB 1Z2CB 3UT9C 5AVBB 3REJB 5B1MD 1S32C 5AY8C 3UTAA 1P3MB 3A6NB 3RELD 4KUDA 5AVBA 5B2IB 3REJA 4XZQD 5DNNA 4WU9B 5B32A 3AFAD 3LJAD 1H3OB 3AV1D 1P3MA 2JCHA 3A6NA 1Q9CA 5B24B 3X1SB 2Y2JA 5B2IA 4XUJC 2CV5C 4WU9A 3R45B 5BS7C 1M19B 3AZEC 1ID3B 2BYMB 1P3ID 5GT0B 5AV6B 5AV9B 5F99C 3REIC 5B24A 3MGSC 3AZFA 2PYOD 1M19A 3R45A 3KWQA 1ID3A 2BYMA 3W98D 3AV2D 5GT0A 3REHB 5AV6A 5CPKC 5B1LC 1P3GD 3A1IA 3EPKA 2ZY3A 4WZSB 3KXBB 5AV6D 3W99D 2L5AA 4CAYB 3X1UC 4X23D 4J8WB 5AVCD 2FJ7D 2IO5B 5BT1C 5JA4B 4YM6C 3UTAC 4KUDC 3VH5A 5AVBC 3KXBA 3B6FD 3REJC 5DNNC 5B32C 3X1TB 4WU8D 5CPIB 3MGQD 5AV5A 5B0YB 1P3MC 3MGRB 4JJNA 4WU9C 1P3OD 3B0CT 5B0YA 2ZY5A 1JFIB 5B24C 5GT3D 3AZFC 3AZIC 1M19C 1M18A 3KWQC 3WAAD 3LELA 3AZJD 4WNNB 5GT0C 1HQ3D 3O62B 5B40B 1F1EA 3AZMB 2BYKB 3A1KA 4ZUXB 4J8VD 1F66D 1EQZD 4WNNA 4M6BA 3WA9B 1T3UA 3B0BA 3AZLB 3C1CB 3O62A 1ZLAD 5B40A 2NQBD 3TU4B 3KXBC 1KX5D 1P3AA 4DRBA 2BYKA 4KGCB 5BNVB 2AROC 3NQUB 3WA9A 1P34D 3AZKB 5C3IC 5B2JD 5AV5C 5G49B 3AZLA 3C1CA 4E45A 3KFUG 3UT9B 4JJNC 3TU4A 5B0ZD 4QLCB 4KGCA 3KUYB 5BNVA 3NQUA 3VH6A 5B33B 3AZKA 3X1VD 1S32B 5AY8B 2Y2QA 4Z5TD 3UT9A 5DNMD 4QLCA 1M18C 3KUYA 2XD5A 4KHAB 5B33A 3LELC 1S32A 5BNXB 1N1JB 3AZGA 3KSYA 2CV5B 5CP6D 4KHAA 5B31B 4LD9C 5E5AD 1N1JA 3H0MC 1M1AC 3MGSB 4J8UD 1P3PA 5B40C 3WKJD 1P3AC 5AV8D 2Y2OA 5B31A 3WA9C 3AZLC 3C1CC 4CSRB 3B6GD 3AYWD 3TU4C 1P3FD 3LJAB 3X1UB 4KGCC 4YS3D 2G5IC 3P5JB 3VH6W 3AZKC 3W96D 3UTAB 4YM6B 3REKD 4WV4B 5B31G 2UWXA 4UUZA 1TZYD 5DNNB 3MGPB 4QLCC 5B32B 3X1UA 3LJAA 3KUYC 5B33C 1P3KD 2FFFB 4YM6A 3AZGC 2LY8A 3AN2D 2PYOB 3AZHC 2NZDD 3NQJB 3MGPA 1B67A 1KX4B 1BH8B 1P3GB 2F8ND 1ULYA 1P3PC 2PYOA 5FUGB 3AZFB 3C1BB 3NQJA 3AZIB 4H9NA 3W99B 1KX4A 3KWQB 5AVCB 5B31C 1BH8A 2FJ7B 1P3GA 1WWIA 1KX3D 3VH5T 5B32G 5FUGA 3C1BA 3AZIA 3W99A 4WU8B 4X23A 5B1MC 4G91B 5BO0B 1WWSA 5AVCA 3MGQB 2FJ7A 4WJ3C 3LZ0D 2RVQD 5GT0D 4H9RB 3WTPD 4XZQC 2J8PA 4WU8A 3AFAC 4HGAB 5BO0A 3LJAC 3MGQA 2CWEA 2AROB 3AV1C 5CPJD 5C3IB 4ZBJB 5AV5B 4H9RA 4JJNB 3LZ1D 3MGPC 3A6ND 2AROA 1P3IC 2YFVA 5JRGB 5B2ID 2PYOC 1M18B 1KX4C 5B24D 3AV2C 3X1SD 1F66B 3WAAA 5JRGA 3LELB 1HQ3A 1P3GC 2Y2HA 1AOIB 1ZLAB 1ID3D 2NQBB 2Y2NA 3C1BC 5GXQB 2G5HC 3W99C 5AV9D
chains in the Genus database with same CATH topology
4X23C 4AWLC 1F66A 5AVCC 3FDDA 3H0LC 1P3BD 2ZY2A 2FJ7C 4LD9B 5B2JB 3MVDD 1AOIA 1M1AB 1ZLAA 2Y2PA 2NQBA 1PZRA 5GXQA 4J8XD 3REHD 4H9PB 3B6FC 1U35D 3VH6T 4WU8C 1P3AB 3IP4C 2HIOB 4G91C 4Z2MH 3MGQC 3EPJA 4LD9A 5B2JA 1M1AA 4J8WD 5B0ZA 4H9PA 4HGAC 2HIOA 4Z66D 2DF4C 3MNND 4H9SC 4ZBJC 5GSUD 4Z5TA 1A7WA 3X1TD 3AZND 5CPID 5B0YD 5CP6B 3MGRD 3W97D 3WAAC 3AZJC 5JRGC 1HQ3C 4NFTA 3AZGB 3AZHB 5CP6A 1P3LD 5AV8B 4J8VC 1F66C 4G92C 1AOIC 4DRAA 4J8UA 1ZLAC 2NQBC 1P3PB 3AZHA 5GXQC 3UTBD 2RIQA 1KX5C 5AV8A 4YS3B 4H9OB 3O62D 3EPLA 1P34C 5B2JC 1R4VA 2JE5A 3REKB 3AZMD 3V9RB 4ZUXD 3AYWA 5B0ZC 1P3FA 3AZLD 4YS3A 2HIOC 4H9OA 5B1MB 4R8PD 3W96A 1P3KB 3TU4D 3REKA 4Z5TC 3RELB 3V9RA 1TZYA 4XZQB 2DQNC 4UUZB 4DQYB 4NE5A 3AFAB 5B1MA 1P3KA 3UT9D 3AV1B 2BG1A 4H9QB 3RELA 3AN2A 2JSSA 4QLCD 2NZDA 4XZQA 1S32D 5AY8D 5CP6C 3AFAA 3AV1A 4H9QA 1P3IB 3WTPE 1W2EA 3B0DC 4J8UC 3AL0C 3WKJC 4H9NB 5AV8C 3W98B 3AV2B 1P3IA 2CV5D 4XUJD 3B6GC 3AZED 3WTPB 3AYWC 2YFWA 5F99D 1P3FC 3REID 3W98A 1HTAA 4X23B 3MGSD 4YS3C 2Y2KA 4AWLB 3AV2A 2Y2LA 3W96C 3LZ0A 5CPJB 4EO5C 3REKC 5CHLB 3WTPA 2F2AC 3B6FB 1TZYC 5CPKD 5B1LD 3LZ1B 1P3KC 5CPJA 3RELC 3AN2C 3X1UD 2VQRA 5KDMB 2HUEC 3B6FA 2NZDC 3LZ1A 5BT1D 3UTAD 4YM6D 1P3OB 4KUDD 2YFVB 5AVBD 3REJD 5DNND 3MGPD 5B32D 5GT3B 5KDMA 1H3OA 1P3OA 1P3MD 3EG5B 3X1SA 1P3BB 3WAAB 3AZJB 2Y2MA 4H9SA 3MVDB 1HQ3B 1KX3C 4WU9D 5GT3A 1KX4D 4J8XB 5AV9A 1U35B 3W98C 4J8VB 1P3BA 1EQZB 3AZJA 4G92B 4NE6A 3MVDA 3AZFD 3LZ0C 3C1BD 3AZID 2RVQC 1M19D 3KWQD 3WTPC 4J8XA 3REHA 1U35A 1KX5B 4J8VA 1EQZA 4Z66B 3MNNB 5CPJC 1P34B 5GSUB 4CAYA 4J8WA 3AZNB 1BFMA 5JA4A 5B0ZB 1KX5A 2ZM5A 3LZ1C 3A6NC 4Z66A 3W97B 3MNNA 2F8NK 1P34A 3X1VB 5B2IC 5GSUA 3KXBD 4Z5TB 3AZNA 3X1TA 5CPIA 2AROD 5DNMB 3MGRA 1P3LB 5AV5D 1P3OC 3W97A 3X1SC 3X1VA 4JJND 5GT3C 1ID3C 1BH9B 5DNMA 3UTBB 5JRGD 5AV9C 5AV6C 1P3LA 1JFIA 1B6WA 1P3BC 3MVDC 5E5AB 1M18D 3B0DB 4J8UB 1BH9A 4J8XC 3REHC 3UTBA 3WKJB 3LELD 1U35C 4NE3A 1AOID 4R8PB 1EQZC 5E5AA 2ZY4A 3VH5W 5GXQD 3AZMA 2W8SA 4ZUXA 3B6GB 4J8WC 3F6TA 3AYWB 3WKJA 2F8NH 2IO5C 4LD9D 1M1AD 1P3FB 4R8PA 1KU5A 4Z66C 5B40D 3MNNC 3W96B 5GSUC 4EO5B 3B6GA 1P3AD 3AZNC 3X1TC 5CPIC 2HIOD 5B0YC 5G49A 1TZYB 3WA9D 3MGRC 3C1CD 3W97C 3X1VC 4Z2MG 3AN2B 4KGCD 5DNMC 2HUEB 5AY8A 2NZDB 3AZKD 1P3LC 4XUJB 4E44A 3AZEB 2F8NB 1TAFB 3EPHA 3KUYD 5B33D 3UTBC 5BNXA 5F99B 3REIB 3B0CW 3AZGD 3O62C 2CV5A 4XUJA 5E5AC 3AZHD 5BS7A 3AZEA 3H0RC 1KX3B 1TAFA 3AZMC 2F8NA 4ZUXC 5F99A 5CPKB 5B1LB 2YFWB 3REIA 3MGSA 4R8PC 1P3PD 3LZ0B 1KX3A 4UPKA 5B31D 5CPKA 5B1LA 2XD1A 4CSRA 2Y2GA 2Y2IA 2F8NG 4KUDB 1Z2CB 3UT9C 5AVBB 3REJB 5B1MD 1S32C 5AY8C 3UTAA 1P3MB 3A6NB 3RELD 4KUDA 5AVBA 5B2IB 3REJA 4XZQD 5DNNA 4WU9B 5B32A 3AFAD 3LJAD 1H3OB 3AV1D 1P3MA 2JCHA 3A6NA 1Q9CA 5B24B 3X1SB 2Y2JA 5B2IA 4XUJC 2CV5C 4WU9A 3R45B 5BS7C 1M19B 3AZEC 1ID3B 2BYMB 1P3ID 5GT0B 5AV6B 5AV9B 5F99C 3REIC 5B24A 3MGSC 3AZFA 2PYOD 1M19A 3R45A 3KWQA 1ID3A 2BYMA 3W98D 3AV2D 5GT0A 3REHB 5AV6A 5CPKC 5B1LC 1P3GD 3A1IA 3EPKA 2ZY3A 4WZSB 3KXBB 5AV6D 3W99D 2L5AA 4CAYB 3X1UC 4X23D 4J8WB 5AVCD 2FJ7D 2IO5B 5BT1C 5JA4B 4YM6C 3UTAC 4KUDC 3VH5A 5AVBC 3KXBA 3B6FD 3REJC 5DNNC 5B32C 3X1TB 4WU8D 5CPIB 3MGQD 5AV5A 5B0YB 1P3MC 3MGRB 4JJNA 4WU9C 1P3OD 3B0CT 5B0YA 2ZY5A 1JFIB 5B24C 5GT3D 3AZFC 3AZIC 1M19C 1M18A 3KWQC 3WAAD 3LELA 3AZJD 4WNNB 5GT0C 1HQ3D 3O62B 5B40B 1F1EA 3AZMB 2BYKB 3A1KA 4ZUXB 4J8VD 1F66D 1EQZD 4WNNA 4M6BA 3WA9B 1T3UA 3B0BA 3AZLB 3C1CB 3O62A 1ZLAD 5B40A 2NQBD 3TU4B 3KXBC 1KX5D 1P3AA 4DRBA 2BYKA 4KGCB 5BNVB 2AROC 3NQUB 3WA9A 1P34D 3AZKB 5C3IC 5B2JD 5AV5C 5G49B 3AZLA 3C1CA 4E45A 3KFUG 3UT9B 4JJNC 3TU4A 5B0ZD 4QLCB 4KGCA 3KUYB 5BNVA 3NQUA 3VH6A 5B33B 3AZKA 3X1VD 1S32B 5AY8B 2Y2QA 4Z5TD 3UT9A 5DNMD 4QLCA 1M18C 3KUYA 2XD5A 4KHAB 5B33A 3LELC 1S32A 5BNXB 1N1JB 3AZGA 3KSYA 2CV5B 5CP6D 4KHAA 5B31B 4LD9C 5E5AD 1N1JA 3H0MC 1M1AC 3MGSB 4J8UD 1P3PA 5B40C 3WKJD 1P3AC 5AV8D 2Y2OA 5B31A 3WA9C 3AZLC 3C1CC 4CSRB 3B6GD 3AYWD 3TU4C 1P3FD 3LJAB 3X1UB 4KGCC 4YS3D 2G5IC 3P5JB 3VH6W 3AZKC 3W96D 3UTAB 4YM6B 3REKD 4WV4B 5B31G 2UWXA 4UUZA 1TZYD 5DNNB 3MGPB 4QLCC 5B32B 3X1UA 3LJAA 3KUYC 5B33C 1P3KD 2FFFB 4YM6A 3AZGC 2LY8A 3AN2D 2PYOB 3AZHC 2NZDD 3NQJB 3MGPA 1B67A 1KX4B 1BH8B 1P3GB 2F8ND 1ULYA 1P3PC 2PYOA 5FUGB 3AZFB 3C1BB 3NQJA 3AZIB 4H9NA 3W99B 1KX4A 3KWQB 5AVCB 5B31C 1BH8A 2FJ7B 1P3GA 1WWIA 1KX3D 3VH5T 5B32G 5FUGA 3C1BA 3AZIA 3W99A 4WU8B 4X23A 5B1MC 4G91B 5BO0B 1WWSA 5AVCA 3MGQB 2FJ7A 4WJ3C 3LZ0D 2RVQD 5GT0D 4H9RB 3WTPD 4XZQC 2J8PA 4WU8A 3AFAC 4HGAB 5BO0A 3LJAC 3MGQA 2CWEA 2AROB 3AV1C 5CPJD 5C3IB 4ZBJB 5AV5B 4H9RA 4JJNB 3LZ1D 3MGPC 3A6ND 2AROA 1P3IC 2YFVA 5JRGB 5B2ID 2PYOC 1M18B 1KX4C 5B24D 3AV2C 3X1SD 1F66B 3WAAA 5JRGA 3LELB 1HQ3A 1P3GC 2Y2HA 1AOIB 1ZLAB 1ID3D 2NQBB 2Y2NA 3C1BC 5GXQB 2G5HC 3W99C 5AV9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 C;  4AWL C;  1F66 A;  5AVC C;  1P3B D;  2FJ7 C;  4LD9 B;  5B2J B;  3MVD D;  1AOI A;  1M1A B;  1ZLA A;  2NQB A;  5GXQ A;  4J8X D;  3REH D;  4H9P B;  3B6F C;  1U35 D;  3VH6 T;  4WU8 C;  1P3A B;  4G91 C;  2HIO B;  4Z2M H;  3MGQ C;  4LD9 A;  5B2J A;  1M1A A;  4J8W D;  5B0Z A;  4H9P A;  4HGA C;  2HIO A;  4Z66 D;  3MNN D;  4H9S C;  4ZBJ C;  5GSU D;  4Z5T A;  1A7W A;  3X1T D;  3AZN D;  5CPI D;  5B0Y D;  5CP6 B;  3MGR D;  3W97 D;  3WAA C;  3AZJ C;  5JRG C;  1HQ3 C;  4NFT A;  3AZG B;  3AZH B;  5CP6 A;  1P3L D;  5AV8 B;  4J8V C;  1F66 C;  4G92 C;  1AOI C;  4DRA A;  4J8U A;  1ZLA C;  2NQB C;  1P3P B;  3AZH A;  5GXQ C;  3UTB D;  1KX5 C;  5AV8 A;  4YS3 B;  4H9O B;  3O62 D;  1P34 C;  5B2J C;  1R4V A;  3REK B;  3AZM D;  3V9R B;  4ZUX D;  3AYW A;  5B0Z C;  1P3F A;  3AZL D;  4YS3 A;  2HIO C;  4H9O A;  5B1M B;  4R8P D;  3W96 A;  1P3K B;  3TU4 D;  3REK A;  4Z5T C;  3REL B;  3V9R A;  1TZY A;  4XZQ B;  4UUZ B;  4NE5 A;  3AFA B;  5B1M A;  1P3K A;  3UT9 D;  3AV1 B;  4H9Q B;  3REL A;  3AN2 A;  2JSS A;  4QLC D;  2NZD A;  4XZQ A;  1S32 D;  5AY8 D;  5CP6 C;  3AFA A;  3AV1 A;  4H9Q A;  1P3I B;  3WTP E;  3B0D C;  4J8U C;  3WKJ C;  4H9N B;  5AV8 C;  3W98 B;  3AV2 B;  1P3I A;  2CV5 D;  4XUJ D;  3B6G C;  3AZE D;  3WTP B;  3AYW C;  2YFW A;  5F99 D;  1P3F C;  3REI D;  3W98 A;  1HTA A;  4X23 B;  3MGS D;  4YS3 C;  4AWL B;  3AV2 A;  3W96 C;  3LZ0 A;  5CPJ B;  4EO5 C;  3REK C;  5CHL B;  3WTP A;  3B6F B;  1TZY C;  5CPK D;  5B1L D;  3LZ1 B;  1P3K C;  5CPJ A;  3REL C;  3AN2 C;  3X1U D;  5KDM B;  2HUE C;  3B6F A;  2NZD C;  3LZ1 A;  5BT1 D;  3UTA D;  4YM6 D;  1P3O B;  4KUD D;  2YFV B;  5AVB D;  3REJ D;  5DNN D;  3MGP D;  5B32 D;  5GT3 B;  5KDM A;  1H3O A;  1P3O A;  1P3M D;  3X1S A;  1P3B B;  3WAA B;  3AZJ B;  4H9S A;  3MVD B;  1HQ3 B;  1KX3 C;  4WU9 D;  5GT3 A;  1KX4 D;  4J8X B;  5AV9 A;  1U35 B;  3W98 C;  4J8V B;  1P3B A;  1EQZ B;  3AZJ A;  4G92 B;  4NE6 A;  3MVD A;  3AZF D;  3LZ0 C;  3C1B D;  3AZI D;  2RVQ C;  1M19 D;  3KWQ D;  3WTP C;  4J8X A;  3REH A;  1U35 A;  1KX5 B;  4J8V A;  1EQZ A;  4Z66 B;  3MNN B;  5CPJ C;  1P34 B;  5GSU B;  4CAY A;  4J8W A;  3AZN B;  1BFM A;  5JA4 A;  5B0Z B;  1KX5 A;  3LZ1 C;  3A6N C;  4Z66 A;  3W97 B;  3MNN A;  2F8N K;  1P34 A;  3X1V B;  5B2I C;  5GSU A;  3KXB D;  4Z5T B;  3AZN A;  3X1T A;  5CPI A;  2ARO D;  5DNM B;  3MGR A;  1P3L B;  5AV5 D;  1P3O C;  3W97 A;  3X1S C;  3X1V A;  4JJN D;  5GT3 C;  1ID3 C;  1BH9 B;  5DNM A;  3UTB B;  5JRG D;  5AV9 C;  5AV6 C;  1P3L A;  1JFI A;  1B6W A;  1P3B C;  3MVD C;  5E5A B;  1M18 D;  3B0D B;  4J8U B;  1BH9 A;  4J8X C;  3REH C;  3UTB A;  3WKJ B;  3LEL D;  1U35 C;  4NE3 A;  1AOI D;  4R8P B;  1EQZ C;  5E5A A;  3VH5 W;  5GXQ D;  3AZM A;  3B6G B;  4ZUX A;  4J8W C;  3AYW B;  3WKJ A;  2F8N H;  2IO5 C;  4LD9 D;  1M1A D;  1P3F B;  4R8P A;  1KU5 A;  4Z66 C;  5B40 D;  3MNN C;  3W96 B;  5GSU C;  4EO5 B;  3B6G A;  1P3A D;  3AZN C;  3X1T C;  5CPI C;  2HIO D;  5B0Y C;  5G49 A;  1TZY B;  3WA9 D;  3MGR C;  3C1C D;  3W97 C;  3X1V C;  4Z2M G;  3AN2 B;  4KGC D;  5DNM C;  2HUE B;  5AY8 A;  2NZD B;  3AZK D;  1P3L C;  4XUJ B;  4E44 A;  3AZE B;  2F8N B;  1TAF B;  3KUY D;  5B33 D;  3UTB C;  5BNX A;  5F99 B;  3REI B;  3B0C W;  3AZG D;  3O62 C;  2CV5 A;  4XUJ A;  5E5A C;  3AZH D;  5BS7 A;  3AZE A;  1KX3 B;  2F8N A;  1TAF A;  3AZM C;  4ZUX C;  5F99 A;  5CPK B;  5B1L B;  2YFW B;  3REI A;  3MGS A;  4R8P C;  1P3P D;  3LZ0 B;  1KX3 A;  5B31 D;  5CPK A;  5B1L A;  4CSR A;  2F8N G;  4KUD B;  3UT9 C;  5AVB B;  3REJ B;  5B1M D;  1S32 C;  5AY8 C;  3UTA A;  1P3M B;  3A6N B;  3REL D;  4KUD A;  5AVB A;  5B2I B;  3REJ A;  4XZQ D;  5DNN A;  4WU9 B;  5B32 A;  3AFA D;  3LJA D;  1H3O B;  3AV1 D;  1P3M A;  3A6N A;  1Q9C A;  5B24 B;  3X1S B;  5B2I A;  2CV5 C;  4XUJ C;  4WU9 A;  3R45 B;  5BS7 C;  1M19 B;  3AZE C;  1ID3 B;  2BYM B;  1P3I D;  5GT0 B;  5AV6 B;  5AV9 B;  5F99 C;  3REI C;  5B24 A;  3MGS C;  3AZF A;  2PYO D;  1M19 A;  3R45 A;  3KWQ A;  1ID3 A;  2BYM A;  3W98 D;  3AV2 D;  5GT0 A;  3REH B;  5AV6 A;  5CPK C;  5B1L C;  1P3G D;  4WZS B;  3KXB B;  5AV6 D;  3W99 D;  2L5A A;  4CAY B;  3X1U C;  4X23 D;  4J8W B;  5AVC D;  2FJ7 D;  2IO5 B;  5BT1 C;  5JA4 B;  4YM6 C;  3UTA C;  4KUD C;  3VH5 A;  5AVB C;  3KXB A;  3B6F D;  3REJ C;  5DNN C;  5B32 C;  3X1T B;  4WU8 D;  5CPI B;  3MGQ D;  5AV5 A;  5B0Y B;  1P3M C;  3MGR B;  4JJN A;  4WU9 C;  1P3O D;  3B0C T;  5B0Y A;  1JFI B;  5B24 C;  5GT3 D;  3AZF C;  3AZI C;  1M19 C;  1M18 A;  3KWQ C;  3WAA D;  3LEL A;  3AZJ D;  4WNN B;  5GT0 C;  1HQ3 D;  3O62 B;  5B40 B;  1F1E A;  3AZM B;  2BYK B;  4ZUX B;  4J8V D;  1F66 D;  1EQZ D;  4WNN A;  4M6B A;  3WA9 B;  3B0B A;  3AZL B;  3C1C B;  3O62 A;  1ZLA D;  5B40 A;  2NQB D;  3TU4 B;  3KXB C;  1KX5 D;  1P3A A;  4DRB A;  2BYK A;  4KGC B;  5BNV B;  2ARO C;  3NQU B;  3WA9 A;  1P34 D;  3AZK B;  5C3I C;  5B2J D;  5AV5 C;  5G49 B;  3AZL A;  3C1C A;  4E45 A;  3UT9 B;  4JJN C;  3TU4 A;  5B0Z D;  4QLC B;  4KGC A;  3KUY B;  5BNV A;  3NQU A;  3VH6 A;  5B33 B;  3AZK A;  3X1V D;  1S32 B;  5AY8 B;  4Z5T D;  3UT9 A;  5DNM D;  4QLC A;  1M18 C;  3KUY A;  4KHA B;  5B33 A;  3LEL C;  1S32 A;  5BNX B;  1N1J B;  3AZG A;  3KSY A;  2CV5 B;  5CP6 D;  4KHA A;  5B31 B;  4LD9 C;  5E5A D;  1N1J A;  1M1A C;  3MGS B;  4J8U D;  1P3P A;  5B40 C;  3WKJ D;  1P3A C;  5AV8 D;  5B31 A;  3WA9 C;  3AZL C;  3C1C C;  4CSR B;  3B6G D;  3AYW D;  3TU4 C;  1P3F D;  3LJA B;  3X1U B;  4KGC C;  4YS3 D;  3VH6 W;  3AZK C;  3W96 D;  3UTA B;  4YM6 B;  3REK D;  4WV4 B;  5B31 G;  4UUZ A;  1TZY D;  5DNN B;  3MGP B;  4QLC C;  5B32 B;  3X1U A;  3LJA A;  3KUY C;  5B33 C;  1P3K D;  4YM6 A;  3AZG C;  2LY8 A;  3AN2 D;  2PYO B;  3AZH C;  2NZD D;  3NQJ B;  3MGP A;  1B67 A;  1KX4 B;  1BH8 B;  1P3G B;  2F8N D;  1ULY A;  1P3P C;  2PYO A;  5FUG B;  3AZF B;  3C1B B;  3NQJ A;  3AZI B;  4H9N A;  3W99 B;  1KX4 A;  3KWQ B;  5AVC B;  5B31 C;  1BH8 A;  2FJ7 B;  1P3G A;  1WWI A;  1KX3 D;  3VH5 T;  5B32 G;  5FUG A;  3C1B A;  3AZI A;  3W99 A;  4WU8 B;  4X23 A;  5B1M C;  4G91 B;  5BO0 B;  1WWS A;  5AVC A;  3MGQ B;  2FJ7 A;  3LZ0 D;  2RVQ D;  4H9R B;  3WTP D;  4XZQ C;  4WU8 A;  3AFA C;  4HGA B;  5BO0 A;  3LJA C;  3MGQ A;  2CWE A;  2ARO B;  3AV1 C;  5CPJ D;  5C3I B;  4ZBJ B;  5AV5 B;  4H9R A;  4JJN B;  3LZ1 D;  3MGP C;  3A6N D;  2ARO A;  1P3I C;  2YFV A;  5JRG B;  5B2I D;  2PYO C;  1M18 B;  1KX4 C;  5B24 D;  3AV2 C;  3X1S D;  1F66 B;  3WAA A;  5JRG A;  3LEL B;  1HQ3 A;  1P3G C;  1AOI B;  1ZLA B;  1ID3 D;  2NQB B;  3C1B C;  5GXQ B;  5GT0 D;  3W99 C;  5AV9 D; 
#chains in the Genus database with same CATH topology
 4X23 C;  4AWL C;  1F66 A;  5AVC C;  3FDD A;  3H0L C;  1P3B D;  2ZY2 A;  2FJ7 C;  4LD9 B;  5B2J B;  3MVD D;  1AOI A;  1M1A B;  1ZLA A;  2Y2P A;  2NQB A;  1PZR A;  5GXQ A;  4J8X D;  3REH D;  4H9P B;  3B6F C;  1U35 D;  3VH6 T;  4WU8 C;  1P3A B;  3IP4 C;  2HIO B;  4G91 C;  4Z2M H;  3MGQ C;  3EPJ A;  4LD9 A;  5B2J A;  1M1A A;  4J8W D;  5B0Z A;  4H9P A;  4HGA C;  2HIO A;  4Z66 D;  2DF4 C;  3MNN D;  4H9S C;  4ZBJ C;  5GSU D;  4Z5T A;  1A7W A;  3X1T D;  3AZN D;  5CPI D;  5B0Y D;  5CP6 B;  3MGR D;  3W97 D;  3WAA C;  3AZJ C;  5JRG C;  1HQ3 C;  4NFT A;  3AZG B;  3AZH B;  5CP6 A;  1P3L D;  5AV8 B;  4J8V C;  1F66 C;  4G92 C;  1AOI C;  4DRA A;  4J8U A;  1ZLA C;  2NQB C;  1P3P B;  3AZH A;  5GXQ C;  3UTB D;  2RIQ A;  1KX5 C;  5AV8 A;  4YS3 B;  4H9O B;  3O62 D;  3EPL A;  1P34 C;  5B2J C;  1R4V A;  2JE5 A;  3REK B;  3AZM D;  3V9R B;  4ZUX D;  3AYW A;  5B0Z C;  1P3F A;  3AZL D;  4YS3 A;  2HIO C;  4H9O A;  5B1M B;  4R8P D;  3W96 A;  1P3K B;  3TU4 D;  3REK A;  4Z5T C;  3REL B;  3V9R A;  1TZY A;  4XZQ B;  2DQN C;  4UUZ B;  4DQY B;  4NE5 A;  3AFA B;  5B1M A;  1P3K A;  3UT9 D;  3AV1 B;  2BG1 A;  4H9Q B;  3REL A;  3AN2 A;  2JSS A;  4QLC D;  2NZD A;  4XZQ A;  1S32 D;  5AY8 D;  5CP6 C;  3AFA A;  3AV1 A;  4H9Q A;  1P3I B;  3WTP E;  1W2E A;  3B0D C;  4J8U C;  3AL0 C;  3WKJ C;  4H9N B;  5AV8 C;  3W98 B;  3AV2 B;  1P3I A;  2CV5 D;  4XUJ D;  3B6G C;  3AZE D;  3WTP B;  3AYW C;  2YFW A;  5F99 D;  1P3F C;  3REI D;  3W98 A;  1HTA A;  4X23 B;  3MGS D;  4YS3 C;  2Y2K A;  4AWL B;  3AV2 A;  2Y2L A;  3W96 C;  3LZ0 A;  5CPJ B;  4EO5 C;  3REK C;  5CHL B;  3WTP A;  2F2A C;  3B6F B;  1TZY C;  5CPK D;  5B1L D;  3LZ1 B;  1P3K C;  5CPJ A;  3REL C;  3AN2 C;  3X1U D;  2VQR A;  5KDM B;  2HUE C;  3B6F A;  2NZD C;  3LZ1 A;  5BT1 D;  3UTA D;  4YM6 D;  1P3O B;  4KUD D;  2YFV B;  5AVB D;  3REJ D;  5DNN D;  3MGP D;  5B32 D;  5GT3 B;  5KDM A;  1H3O A;  1P3O A;  1P3M D;  3EG5 B;  3X1S A;  1P3B B;  3WAA B;  3AZJ B;  2Y2M A;  4H9S A;  3MVD B;  1HQ3 B;  1KX3 C;  4WU9 D;  5GT3 A;  1KX4 D;  4J8X B;  5AV9 A;  1U35 B;  3W98 C;  4J8V B;  1P3B A;  1EQZ B;  3AZJ A;  4G92 B;  4NE6 A;  3MVD A;  3AZF D;  3LZ0 C;  3C1B D;  3AZI D;  2RVQ C;  1M19 D;  3KWQ D;  3WTP C;  4J8X A;  3REH A;  1U35 A;  1KX5 B;  4J8V A;  1EQZ A;  4Z66 B;  3MNN B;  5CPJ C;  1P34 B;  5GSU B;  4CAY A;  4J8W A;  3AZN B;  1BFM A;  5JA4 A;  5B0Z B;  1KX5 A;  2ZM5 A;  3LZ1 C;  3A6N C;  4Z66 A;  3W97 B;  3MNN A;  2F8N K;  1P34 A;  3X1V B;  5B2I C;  5GSU A;  3KXB D;  4Z5T B;  3AZN A;  3X1T A;  5CPI A;  2ARO D;  5DNM B;  3MGR A;  1P3L B;  5AV5 D;  1P3O C;  3W97 A;  3X1S C;  3X1V A;  4JJN D;  5GT3 C;  1ID3 C;  1BH9 B;  5DNM A;  3UTB B;  5JRG D;  5AV9 C;  5AV6 C;  1P3L A;  1JFI A;  1B6W A;  1P3B C;  3MVD C;  5E5A B;  1M18 D;  3B0D B;  4J8U B;  1BH9 A;  4J8X C;  3REH C;  3UTB A;  3WKJ B;  3LEL D;  1U35 C;  4NE3 A;  1AOI D;  4R8P B;  1EQZ C;  5E5A A;  2ZY4 A;  3VH5 W;  5GXQ D;  3AZM A;  2W8S A;  4ZUX A;  3B6G B;  4J8W C;  3F6T A;  3AYW B;  3WKJ A;  2F8N H;  2IO5 C;  4LD9 D;  1M1A D;  1P3F B;  4R8P A;  1KU5 A;  4Z66 C;  5B40 D;  3MNN C;  3W96 B;  5GSU C;  4EO5 B;  3B6G A;  1P3A D;  3AZN C;  3X1T C;  5CPI C;  2HIO D;  5B0Y C;  5G49 A;  1TZY B;  3WA9 D;  3MGR C;  3C1C D;  3W97 C;  3X1V C;  4Z2M G;  3AN2 B;  4KGC D;  5DNM C;  2HUE B;  5AY8 A;  2NZD B;  3AZK D;  1P3L C;  4XUJ B;  4E44 A;  3AZE B;  2F8N B;  1TAF B;  3EPH A;  3KUY D;  5B33 D;  3UTB C;  5BNX A;  5F99 B;  3REI B;  3B0C W;  3AZG D;  3O62 C;  2CV5 A;  4XUJ A;  5E5A C;  3AZH D;  5BS7 A;  3AZE A;  3H0R C;  1KX3 B;  1TAF A;  3AZM C;  2F8N A;  4ZUX C;  5F99 A;  5CPK B;  5B1L B;  2YFW B;  3REI A;  3MGS A;  4R8P C;  1P3P D;  3LZ0 B;  1KX3 A;  4UPK A;  5B31 D;  5CPK A;  5B1L A;  2XD1 A;  4CSR A;  2Y2G A;  2Y2I A;  2F8N G;  4KUD B;  1Z2C B;  3UT9 C;  5AVB B;  3REJ B;  5B1M D;  1S32 C;  5AY8 C;  3UTA A;  1P3M B;  3A6N B;  3REL D;  4KUD A;  5AVB A;  5B2I B;  3REJ A;  4XZQ D;  5DNN A;  4WU9 B;  5B32 A;  3AFA D;  3LJA D;  1H3O B;  3AV1 D;  1P3M A;  2JCH A;  3A6N A;  1Q9C A;  5B24 B;  3X1S B;  2Y2J A;  5B2I A;  4XUJ C;  2CV5 C;  4WU9 A;  3R45 B;  5BS7 C;  1M19 B;  3AZE C;  1ID3 B;  2BYM B;  1P3I D;  5GT0 B;  5AV6 B;  5AV9 B;  5F99 C;  3REI C;  5B24 A;  3MGS C;  3AZF A;  2PYO D;  1M19 A;  3R45 A;  3KWQ A;  1ID3 A;  2BYM A;  3W98 D;  3AV2 D;  5GT0 A;  3REH B;  5AV6 A;  5CPK C;  5B1L C;  1P3G D;  3A1I A;  3EPK A;  2ZY3 A;  4WZS B;  3KXB B;  5AV6 D;  3W99 D;  2L5A A;  4CAY B;  3X1U C;  4X23 D;  4J8W B;  5AVC D;  2FJ7 D;  2IO5 B;  5BT1 C;  5JA4 B;  4YM6 C;  3UTA C;  4KUD C;  3VH5 A;  5AVB C;  3KXB A;  3B6F D;  3REJ C;  5DNN C;  5B32 C;  3X1T B;  4WU8 D;  5CPI B;  3MGQ D;  5AV5 A;  5B0Y B;  1P3M C;  3MGR B;  4JJN A;  4WU9 C;  1P3O D;  3B0C T;  5B0Y A;  2ZY5 A;  1JFI B;  5B24 C;  5GT3 D;  3AZF C;  3AZI C;  1M19 C;  1M18 A;  3KWQ C;  3WAA D;  3LEL A;  3AZJ D;  4WNN B;  5GT0 C;  1HQ3 D;  3O62 B;  5B40 B;  1F1E A;  3AZM B;  2BYK B;  3A1K A;  4ZUX B;  4J8V D;  1F66 D;  1EQZ D;  4WNN A;  4M6B A;  3WA9 B;  1T3U A;  3B0B A;  3AZL B;  3C1C B;  3O62 A;  1ZLA D;  5B40 A;  2NQB D;  3TU4 B;  3KXB C;  1KX5 D;  1P3A A;  4DRB A;  2BYK A;  4KGC B;  5BNV B;  2ARO C;  3NQU B;  3WA9 A;  1P34 D;  3AZK B;  5C3I C;  5B2J D;  5AV5 C;  5G49 B;  3AZL A;  3C1C A;  4E45 A;  3KFU G;  3UT9 B;  4JJN C;  3TU4 A;  5B0Z D;  4QLC B;  4KGC A;  3KUY B;  5BNV A;  3NQU A;  3VH6 A;  5B33 B;  3AZK A;  3X1V D;  1S32 B;  5AY8 B;  2Y2Q A;  4Z5T D;  3UT9 A;  5DNM D;  4QLC A;  1M18 C;  3KUY A;  2XD5 A;  4KHA B;  5B33 A;  3LEL C;  1S32 A;  5BNX B;  1N1J B;  3AZG A;  3KSY A;  2CV5 B;  5CP6 D;  4KHA A;  5B31 B;  4LD9 C;  5E5A D;  1N1J A;  3H0M C;  1M1A C;  3MGS B;  4J8U D;  1P3P A;  5B40 C;  3WKJ D;  1P3A C;  5AV8 D;  2Y2O A;  5B31 A;  3WA9 C;  3AZL C;  3C1C C;  4CSR B;  3B6G D;  3AYW D;  3TU4 C;  1P3F D;  3LJA B;  3X1U B;  4KGC C;  4YS3 D;  2G5I C;  3P5J B;  3VH6 W;  3AZK C;  3W96 D;  3UTA B;  4YM6 B;  3REK D;  4WV4 B;  5B31 G;  2UWX A;  4UUZ A;  1TZY D;  5DNN B;  3MGP B;  4QLC C;  5B32 B;  3X1U A;  3LJA A;  3KUY C;  5B33 C;  1P3K D;  2FFF B;  4YM6 A;  3AZG C;  2LY8 A;  3AN2 D;  2PYO B;  3AZH C;  2NZD D;  3NQJ B;  3MGP A;  1B67 A;  1KX4 B;  1BH8 B;  1P3G B;  2F8N D;  1ULY A;  1P3P C;  2PYO A;  5FUG B;  3AZF B;  3C1B B;  3NQJ A;  3AZI B;  4H9N A;  3W99 B;  1KX4 A;  3KWQ B;  5AVC B;  5B31 C;  1BH8 A;  2FJ7 B;  1P3G A;  1WWI A;  1KX3 D;  3VH5 T;  5B32 G;  5FUG A;  3C1B A;  3AZI A;  3W99 A;  4WU8 B;  4X23 A;  5B1M C;  4G91 B;  5BO0 B;  1WWS A;  5AVC A;  3MGQ B;  2FJ7 A;  4WJ3 C;  3LZ0 D;  2RVQ D;  5GT0 D;  4H9R B;  3WTP D;  4XZQ C;  2J8P A;  4WU8 A;  3AFA C;  4HGA B;  5BO0 A;  3LJA C;  3MGQ A;  2CWE A;  2ARO B;  3AV1 C;  5CPJ D;  5C3I B;  4ZBJ B;  5AV5 B;  4H9R A;  4JJN B;  3LZ1 D;  3MGP C;  3A6N D;  2ARO A;  1P3I C;  2YFV A;  5JRG B;  5B2I D;  2PYO C;  1M18 B;  1KX4 C;  5B24 D;  3AV2 C;  3X1S D;  1F66 B;  3WAA A;  5JRG A;  3LEL B;  1HQ3 A;  1P3G C;  2Y2H A;  1AOI B;  1ZLA B;  1ID3 D;  2NQB B;  2Y2N A;  3C1B C;  5GXQ B;  2G5H C;  3W99 C;  5AV9 D; 
#chains in the Genus database with same CATH homology
 4X23 C;  4AWL C;  1F66 A;  5AVC C;  3FDD A;  3H0L C;  1P3B D;  2ZY2 A;  2FJ7 C;  4LD9 B;  5B2J B;  3MVD D;  1AOI A;  1M1A B;  1ZLA A;  2Y2P A;  2NQB A;  1PZR A;  5GXQ A;  4J8X D;  3REH D;  4H9P B;  3B6F C;  1U35 D;  3VH6 T;  4WU8 C;  1P3A B;  3IP4 C;  2HIO B;  4G91 C;  4Z2M H;  3MGQ C;  3EPJ A;  4LD9 A;  5B2J A;  1M1A A;  4J8W D;  5B0Z A;  4H9P A;  4HGA C;  2HIO A;  4Z66 D;  2DF4 C;  3MNN D;  4H9S C;  4ZBJ C;  5GSU D;  4Z5T A;  1A7W A;  3X1T D;  3AZN D;  5CPI D;  5B0Y D;  5CP6 B;  3MGR D;  3W97 D;  3WAA C;  3AZJ C;  5JRG C;  1HQ3 C;  4NFT A;  3AZG B;  3AZH B;  5CP6 A;  1P3L D;  5AV8 B;  4J8V C;  1F66 C;  4G92 C;  1AOI C;  4DRA A;  4J8U A;  1ZLA C;  2NQB C;  1P3P B;  3AZH A;  5GXQ C;  3UTB D;  2RIQ A;  1KX5 C;  5AV8 A;  4YS3 B;  4H9O B;  3O62 D;  3EPL A;  1P34 C;  5B2J C;  1R4V A;  2JE5 A;  3REK B;  3AZM D;  3V9R B;  4ZUX D;  3AYW A;  5B0Z C;  1P3F A;  3AZL D;  4YS3 A;  2HIO C;  4H9O A;  5B1M B;  4R8P D;  3W96 A;  1P3K B;  3TU4 D;  3REK A;  4Z5T C;  3REL B;  3V9R A;  1TZY A;  4XZQ B;  2DQN C;  4UUZ B;  4DQY B;  4NE5 A;  3AFA B;  5B1M A;  1P3K A;  3UT9 D;  3AV1 B;  2BG1 A;  4H9Q B;  3REL A;  3AN2 A;  2JSS A;  4QLC D;  2NZD A;  4XZQ A;  1S32 D;  5AY8 D;  5CP6 C;  3AFA A;  3AV1 A;  4H9Q A;  1P3I B;  3WTP E;  1W2E A;  3B0D C;  4J8U C;  3AL0 C;  3WKJ C;  4H9N B;  5AV8 C;  3W98 B;  3AV2 B;  1P3I A;  2CV5 D;  4XUJ D;  3B6G C;  3AZE D;  3WTP B;  3AYW C;  2YFW A;  5F99 D;  1P3F C;  3REI D;  3W98 A;  1HTA A;  4X23 B;  3MGS D;  4YS3 C;  2Y2K A;  4AWL B;  3AV2 A;  2Y2L A;  3W96 C;  3LZ0 A;  5CPJ B;  4EO5 C;  3REK C;  5CHL B;  3WTP A;  2F2A C;  3B6F B;  1TZY C;  5CPK D;  5B1L D;  3LZ1 B;  1P3K C;  5CPJ A;  3REL C;  3AN2 C;  3X1U D;  2VQR A;  5KDM B;  2HUE C;  3B6F A;  2NZD C;  3LZ1 A;  5BT1 D;  3UTA D;  4YM6 D;  1P3O B;  4KUD D;  2YFV B;  5AVB D;  3REJ D;  5DNN D;  3MGP D;  5B32 D;  5GT3 B;  5KDM A;  1H3O A;  1P3O A;  1P3M D;  3EG5 B;  3X1S A;  1P3B B;  3WAA B;  3AZJ B;  2Y2M A;  4H9S A;  3MVD B;  1HQ3 B;  1KX3 C;  4WU9 D;  5GT3 A;  1KX4 D;  4J8X B;  5AV9 A;  1U35 B;  3W98 C;  4J8V B;  1P3B A;  1EQZ B;  3AZJ A;  4G92 B;  4NE6 A;  3MVD A;  3AZF D;  3LZ0 C;  3C1B D;  3AZI D;  2RVQ C;  1M19 D;  3KWQ D;  3WTP C;  4J8X A;  3REH A;  1U35 A;  1KX5 B;  4J8V A;  1EQZ A;  4Z66 B;  3MNN B;  5CPJ C;  1P34 B;  5GSU B;  4CAY A;  4J8W A;  3AZN B;  1BFM A;  5JA4 A;  5B0Z B;  1KX5 A;  2ZM5 A;  3LZ1 C;  3A6N C;  4Z66 A;  3W97 B;  3MNN A;  2F8N K;  1P34 A;  3X1V B;  5B2I C;  5GSU A;  3KXB D;  4Z5T B;  3AZN A;  3X1T A;  5CPI A;  2ARO D;  5DNM B;  3MGR A;  1P3L B;  5AV5 D;  1P3O C;  3W97 A;  3X1S C;  3X1V A;  4JJN D;  5GT3 C;  1ID3 C;  1BH9 B;  5DNM A;  3UTB B;  5JRG D;  5AV9 C;  5AV6 C;  1P3L A;  1JFI A;  1B6W A;  1P3B C;  3MVD C;  5E5A B;  1M18 D;  3B0D B;  4J8U B;  1BH9 A;  4J8X C;  3REH C;  3UTB A;  3WKJ B;  3LEL D;  1U35 C;  4NE3 A;  1AOI D;  4R8P B;  1EQZ C;  5E5A A;  2ZY4 A;  3VH5 W;  5GXQ D;  3AZM A;  2W8S A;  4ZUX A;  3B6G B;  4J8W C;  3F6T A;  3AYW B;  3WKJ A;  2F8N H;  2IO5 C;  4LD9 D;  1M1A D;  1P3F B;  4R8P A;  1KU5 A;  4Z66 C;  5B40 D;  3MNN C;  3W96 B;  5GSU C;  4EO5 B;  3B6G A;  1P3A D;  3AZN C;  3X1T C;  5CPI C;  2HIO D;  5B0Y C;  5G49 A;  1TZY B;  3WA9 D;  3MGR C;  3C1C D;  3W97 C;  3X1V C;  4Z2M G;  3AN2 B;  4KGC D;  5DNM C;  2HUE B;  5AY8 A;  2NZD B;  3AZK D;  1P3L C;  4XUJ B;  4E44 A;  3AZE B;  2F8N B;  1TAF B;  3EPH A;  3KUY D;  5B33 D;  3UTB C;  5BNX A;  5F99 B;  3REI B;  3B0C W;  3AZG D;  3O62 C;  2CV5 A;  4XUJ A;  5E5A C;  3AZH D;  5BS7 A;  3AZE A;  3H0R C;  1KX3 B;  1TAF A;  3AZM C;  2F8N A;  4ZUX C;  5F99 A;  5CPK B;  5B1L B;  2YFW B;  3REI A;  3MGS A;  4R8P C;  1P3P D;  3LZ0 B;  1KX3 A;  4UPK A;  5B31 D;  5CPK A;  5B1L A;  2XD1 A;  4CSR A;  2Y2G A;  2Y2I A;  2F8N G;  4KUD B;  1Z2C B;  3UT9 C;  5AVB B;  3REJ B;  5B1M D;  1S32 C;  5AY8 C;  3UTA A;  1P3M B;  3A6N B;  3REL D;  4KUD A;  5AVB A;  5B2I B;  3REJ A;  4XZQ D;  5DNN A;  4WU9 B;  5B32 A;  3AFA D;  3LJA D;  1H3O B;  3AV1 D;  1P3M A;  2JCH A;  3A6N A;  1Q9C A;  5B24 B;  3X1S B;  2Y2J A;  5B2I A;  4XUJ C;  2CV5 C;  4WU9 A;  3R45 B;  5BS7 C;  1M19 B;  3AZE C;  1ID3 B;  2BYM B;  1P3I D;  5GT0 B;  5AV6 B;  5AV9 B;  5F99 C;  3REI C;  5B24 A;  3MGS C;  3AZF A;  2PYO D;  1M19 A;  3R45 A;  3KWQ A;  1ID3 A;  2BYM A;  3W98 D;  3AV2 D;  5GT0 A;  3REH B;  5AV6 A;  5CPK C;  5B1L C;  1P3G D;  3A1I A;  3EPK A;  2ZY3 A;  4WZS B;  3KXB B;  5AV6 D;  3W99 D;  2L5A A;  4CAY B;  3X1U C;  4X23 D;  4J8W B;  5AVC D;  2FJ7 D;  2IO5 B;  5BT1 C;  5JA4 B;  4YM6 C;  3UTA C;  4KUD C;  3VH5 A;  5AVB C;  3KXB A;  3B6F D;  3REJ C;  5DNN C;  5B32 C;  3X1T B;  4WU8 D;  5CPI B;  3MGQ D;  5AV5 A;  5B0Y B;  1P3M C;  3MGR B;  4JJN A;  4WU9 C;  1P3O D;  3B0C T;  5B0Y A;  2ZY5 A;  1JFI B;  5B24 C;  5GT3 D;  3AZF C;  3AZI C;  1M19 C;  1M18 A;  3KWQ C;  3WAA D;  3LEL A;  3AZJ D;  4WNN B;  5GT0 C;  1HQ3 D;  3O62 B;  5B40 B;  1F1E A;  3AZM B;  2BYK B;  3A1K A;  4ZUX B;  4J8V D;  1F66 D;  1EQZ D;  4WNN A;  4M6B A;  3WA9 B;  1T3U A;  3B0B A;  3AZL B;  3C1C B;  3O62 A;  1ZLA D;  5B40 A;  2NQB D;  3TU4 B;  3KXB C;  1KX5 D;  1P3A A;  4DRB A;  2BYK A;  4KGC B;  5BNV B;  2ARO C;  3NQU B;  3WA9 A;  1P34 D;  3AZK B;  5C3I C;  5B2J D;  5AV5 C;  5G49 B;  3AZL A;  3C1C A;  4E45 A;  3KFU G;  3UT9 B;  4JJN C;  3TU4 A;  5B0Z D;  4QLC B;  4KGC A;  3KUY B;  5BNV A;  3NQU A;  3VH6 A;  5B33 B;  3AZK A;  3X1V D;  1S32 B;  5AY8 B;  2Y2Q A;  4Z5T D;  3UT9 A;  5DNM D;  4QLC A;  1M18 C;  3KUY A;  2XD5 A;  4KHA B;  5B33 A;  3LEL C;  1S32 A;  5BNX B;  1N1J B;  3AZG A;  3KSY A;  2CV5 B;  5CP6 D;  4KHA A;  5B31 B;  4LD9 C;  5E5A D;  1N1J A;  3H0M C;  1M1A C;  3MGS B;  4J8U D;  1P3P A;  5B40 C;  3WKJ D;  1P3A C;  5AV8 D;  2Y2O A;  5B31 A;  3WA9 C;  3AZL C;  3C1C C;  4CSR B;  3B6G D;  3AYW D;  3TU4 C;  1P3F D;  3LJA B;  3X1U B;  4KGC C;  4YS3 D;  2G5I C;  3P5J B;  3VH6 W;  3AZK C;  3W96 D;  3UTA B;  4YM6 B;  3REK D;  4WV4 B;  5B31 G;  2UWX A;  4UUZ A;  1TZY D;  5DNN B;  3MGP B;  4QLC C;  5B32 B;  3X1U A;  3LJA A;  3KUY C;  5B33 C;  1P3K D;  2FFF B;  4YM6 A;  3AZG C;  2LY8 A;  3AN2 D;  2PYO B;  3AZH C;  2NZD D;  3NQJ B;  3MGP A;  1B67 A;  1KX4 B;  1BH8 B;  1P3G B;  2F8N D;  1ULY A;  1P3P C;  2PYO A;  5FUG B;  3AZF B;  3C1B B;  3NQJ A;  3AZI B;  4H9N A;  3W99 B;  1KX4 A;  3KWQ B;  5AVC B;  5B31 C;  1BH8 A;  2FJ7 B;  1P3G A;  1WWI A;  1KX3 D;  3VH5 T;  5B32 G;  5FUG A;  3C1B A;  3AZI A;  3W99 A;  4WU8 B;  4X23 A;  5B1M C;  4G91 B;  5BO0 B;  1WWS A;  5AVC A;  3MGQ B;  2FJ7 A;  4WJ3 C;  3LZ0 D;  2RVQ D;  5GT0 D;  4H9R B;  3WTP D;  4XZQ C;  2J8P A;  4WU8 A;  3AFA C;  4HGA B;  5BO0 A;  3LJA C;  3MGQ A;  2CWE A;  2ARO B;  3AV1 C;  5CPJ D;  5C3I B;  4ZBJ B;  5AV5 B;  4H9R A;  4JJN B;  3LZ1 D;  3MGP C;  3A6N D;  2ARO A;  1P3I C;  2YFV A;  5JRG B;  5B2I D;  2PYO C;  1M18 B;  1KX4 C;  5B24 D;  3AV2 C;  3X1S D;  1F66 B;  3WAA A;  5JRG A;  3LEL B;  1HQ3 A;  1P3G C;  2Y2H A;  1AOI B;  1ZLA B;  1ID3 D;  2NQB B;  2Y2N A;  3C1B C;  5GXQ B;  2G5H C;  3W99 C;  5AV9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...