3UFEA

Structure of transcriptional antiterminator (bglg-family) at 1.5 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
LRPLSEVNQHSQLMAQLVEVIEDSFQMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLMLLLKNEYPLCYNTAWKLIKILQQTLKKPVHEAEAVYLTLHLIPINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional antiterminator (BGLG family)
publication title Structure of transcriptional antiterminator (BGLG-family) at 1.5 A resolution
rcsb
source organism Bacillus subtilis
total genus 32
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ufeA02
1.20.890.100 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3ufeA01
3UFEA 3GWHA
chains in the Genus database with same CATH superfamily
2MYSA 5FY1A 3KBTA 1FIOA 3N2OA 3ESLA 2XHEB 4RTAA 3UT5E 3EDVA 3K1SA 1KNRA 4IE6A 4YLHA 2KMFA 5HWYA 1YD8G 3MACA 1ZOYA 3QFZA 4ZS3A 1OWAA 3AA1B 5L2LA 4RT4A 4GOUA 4F6RC 2FJEA 4YSYA 4DMVA 1ZV4X 2LE8A 5L4EA 2VQFT 4ZHQE 4AISA 2WMNA 3N2KE 1B7TA 3FZFB 5J1GA 3PUAA 3IBPA 3V5UA 2LT3A 1UURA 2OA5A 2WZHA 3C51A 2CQTA 1W09A 1AJ3A 4PJLA 4GK0E 2E9XC 3LBXB 2MAWA 2NW8A 3RF1A 4AKIA 3ACSA 1X79A 3NRYA 3JAEA 2MPKA 3QOFA 3WAKA 4CXXA 1T8BA 3RPUA 2EHOB 1KNZA 4K0KT 3TLTA 3S4CA 3VHLA 2WDRA 2HN2A 4GK5E 4ZI2D 1E7PA 2UUBT 1OEDB 3N9QA 5DJQC 1YQ4A 2W2UA 2Y8DA 3ZJ1A 3ONJA 5HCMA 1HG2A 3P4SA 4ZI3D 1O3XA 2VKJA 3GN5A 2X9YA 4WBOA 4B3ST 2BKNA 2NP9A 2DRNA 2W0GA 3MJXA 2ZM0A 2V1DB 2LKHA 3EI0A 2CBIA 1D0XA 1FEWA 4KHPT 4DR4T 3FXEB 4HWHA 4UF0A 1D1BA 4TV9E 4ILUA 4I43B 4X64T 3AA7B 2OUTA 2WWVA 5AQMB 2V5CA 4EV6A 2BKPA 3C64A 5FYMA 1CUNA 2J47A 2XASB 4ISTA 2XAHB 4JBWF 3A8YC 5EK2A 3JCFA 1ZEEA 4Z90A 4CQIA 4HN9A 3AVRA 4V1Av 3H3MA 5JRCA 2N1GA 2EZWA 5FP3A 2UXBT 3HL6A 5FXWA 2W66A 1N34T 5L4HA 3VKGA 2CRBA 5JR9C 4EEBA 3RGLA 3QG0A 2DLRA 2QVAA 4G2AA 2WP9A 3Q5DA 3RQUA 5AQHB 2E5LT 3CWZB 2P9BA 4AQFA 3RIAA 4IL9A 2LOSA 3OTOT 5FVKA 3T1YT 4JI6T 3E0ZA 2DNXA 4LFCT 3AE8A 4DUYT 4PK5A 2IUBA 4KUMB 4ISSA 4LF5T 2XQ3A 5LBMA 2NTXA 2V6XA 3S4BA 3AEEA 4O4JE 2C0SA 2IMLA 3CPZA 1UX5A 1I6ZA 2CXDA 3E22E 3FXDB 1UUSA 4DBQA 4ILBA 2CBGA 2CBJA 5JDQA 4AKHA 3IA3A 5FMNA 4ANJA 1WR0A 2CHOA 3F2EA 4B3RT 2X66A 3FZKB 4TWDA 3A7MA 5LGNB 1HG5A 1JNRA 3PE0A 3ZMVB 4IE7A 1HNWT 5LYJE 3O1HA 4DV5T 5F5WA 2YOEA 3UULA 4X1IE 2JQHA 5LHHB 3L8RA 4EIWA 3RKGA 4EYUA 3B5MA 4U72A 3KBUA 3Q9DA 5JDNA 4AQGA 2LSKA 2Q9QC 3HKCE 4QKNA 1VCTA 5FKYA 5FXXA 4YHJA 2E9XA 2B1EA 2QA7A 2YDRA 4G63A 1MNDA 4JLEA 3KV9A 3IF8B 5KDMC 4TWFA 5H6RB 4P09A 2VKOA 3DP7A 4FJOA 3ZPOA 2ZLYA 1T98A 4KBMB 1IAPA 2WM9A 4LMLA 2RP4A 5ABGA 3RIUC 1J5ET 2UUAT 3ANWA 2D2SA 5AQFB 1UCUA 1SE7A 2ODVA 1V9DA 3OPCA 5JDMA 3SFEA 1WRDA 3ETUA 2X9XA 2NW7A 3VRBA 2QYWA 1N36T 4YSXA 3ZSTA 2V6YB 3BK9A 3PUZF 5IHYA 2ZM6T 3RRCA 1IZNB 3BQLA 2WQYA 1U5PA 5JDGA 2MOZA 2X51A 5E0OA 3TLUA 4QXBB 3ZCIA 2VL8A 4OYKA 2LEHA 2XJ7A 5AQKB 4B3MT 2K9QA 4YTPA 3LSVA 3PUQA 1D0ZA 5LP6E 5C2TA 3IHRA 2Y48B 3HI2A 3ZEFB 2XSBA 3ZYKA 4XAXB 4LF6T 5ABHA 4JI3T 4ASKA 5CGMA 3VR8A 3OJAA 4O8SA 2DI4A 3FZHB 2R6GF 3P7IA 1NEKA 2WB5A 4BJNA 4GKKT 4IHJE 3ACTA 3RI5A 5KMGP 3WI3A 2IAKA 1WCRA 1OEDC 4ZZCA 3HKBE 5JR9A 1WYCA 4LF4T 2VL0A 1MIWA 2E8IA 2WSSV 1YKEB 2X0HA 4IGUA 1MMGA 4ILAA 2DWKA 1UK5A 3AE5A 2CCQA 1IBMT 4ILCA 4P1NA 4MBQA 3T1HT 2KXPB 2X68A 3EABA 4Z91A 3PU3A 1HNXT 1KEYA 4NXMT 4I55E 4YT0A 4JEHB 1G8XA 5HXCA 2X9HA 3AFJA 3O9XA 3UFGA 2KZ7B 4HWCA 2V7JA 4YJ3E 5AQTB 2KNDA 5AQSB 3I1AA 3AE6A 2LHRA 2VURA 3HA4A 4H63H 3KV4A 2YKSA 3PUWF 3M3ZB 1FMWA 2V7MA 2XTLA 4AXPA 1XZYA 2CHNA 4PJMA 1XNRT 5DABA 3MA9A 5HCJA 5LMNT 2PBIA 3P4WA 4ZP3A 3QB5A 4J2CA 2UXCT 3M65A 2IIUA 5L3CB 2W00A 5AQUB 2Q9QA 3CK6A 3CMLA 4I0UA 2WDQA 5FL1A 3K3QC 4EAHA 1DU2A 4LMJA 2JMKA 3KV5A 2CM0A 2Z6EA 4HTEA 2WWUA 3N9PA 4YJ2E 3AE7A 3K3NA 2LSIA 4QX8B 4JI1T 2LJLA 4IIJE 2K9AA 3L39A 3RRWA 3RHWA 3O1IA 4TX5A 5JH7E 4ZOLE 2NR4A 1Y64B 4TNWA 3MKDA 5JTGA 5LNKA 2L3LA 5JREA 3OYZA 3EDUA 3ZLIA 3LK42 4DV7T 4XZCA 2XY8B 3RIUA 2WZIA 2ZMAA 4DNDA 4X62T 1FMVA 2UXNB 4IE0A 2M6IA 4H9NC 2V26A 3KDSE 3N9LA 1EZ3A 1W9RA 5AQRB 2X0YA 5HEUA 3GWHA 2V5DA 4DR3T 1L6EA 3OBVE 4EZ4A 4JI0T 2QRXA 5HYAA 2JMHA 5AQGB 2ES0A 2KINB 1HR0T 3H37A 4YFSA 5HXSA 1ZHCA 4NXNT 2N2NA 2H9RA 2K3WA 5LMUT 3GN5B 5BR8T 2X67A 2OV9A 4PK6A 3AAAB 2LOPA 4HFDA 1LRZA 5ABFA 3JAFA 3R84B 2UUCT 1Y01A 3ZYMA 4UF0B 3AEGA 2JJ9A 2JQQA 3RLFF 2LSYA 4P0AA 4OX9T 2NW9A 4GIWA 4O2BE 4OFZA 3UQ4A 1OEDA 2YN6A 1HF8A 5KX5E 4YHHT 4PNIA 3AEBA 5L3GB 5KXJA 4X66T 4N78D 1YW0A 2BBJA 2FJBA 2D0UA 2BG9C 3SS1A 4DIDB 2XPKA 3J7Yq 5JRCB 1XDOA 3W15B 3RYCE 4HWFA 4DV6T 4U3CA 2FJAA 2XAGB 3VR9A 2VVNA 2KT9A 2VKHA 1W0BA 3QB5K 2YINA 3J9X1 2BZBA 4JI4T 3VRAA 4JV5T 4A98A 2DHRA 1WR6A 5HXRA 5LXTE 3O1JA 4XBFB 3UFEA 2IZYA 3VKHA 3OYXA 2BS3A 4PFPA 2A9UA 2M67A 3RIFA 2NOXA 2XZEA 1MIVA 2YU1A 5FL0A 2CLYB 2JPFA 2J1DG 3AE2A 1HX1B 4FI5A 2CWOA 4UELA 2PG8A 2ZM2A 2J4GA 3EVYA 4EGWA 2XQ6A 4QHOA 3MK7C 2OLTA 3PMIA 3HKEE 4H9QC 1R8IA 4CN4A 3RYHE 3D0TA 3I9WA 4ZI2C 4HFCA 2I59A 2AE9A 2LM9A 3CX7B 4CZZB 4KX6A 5JDHA 4PK4A 3PTRB 2LKGA 2HH7A 3UU6A 1KFYA 4ZI3C 2LSGA 2M6BA 2KSRA 3AB3B 2KWHA 5JQGE 1SHZC 4DV4T 4QH1A 2DWGA 4LMKA 2XQYA 1IBLT 2SPCA 2BDEA 4HE8A 3RQWA 3UUMA 1I94T 3QC9A 2XM2A 5C8YE 3ONLC 5FY0A 1IJ5A 3U78A 4B3TT 4ADZA 4IL4A 5LG4A 4AKGA 5LJNA 3V5SA 5LG3A 4HFIA 5L47A 2N9DA 5LOVE 1E1HB 3UU8A 4MHCA 4COFA 2QGSA 2BS4A 4M1PA 2CXFA 4CXWA 4BJMA 2X0LB 3SRZA 2MBGA 3FB2A 1SUMB 3ANWB 2CXLA 5HEOA 4WYVA 4PJNA 5BMVE 2A2FX 2WBLA 3ZMTB 5FXZA 2XM1A 3ZT6A 2KLQA 5JVDE 2VWAA 4TZ4C 2LRKA 1HCIA 2ACZA 2H3RA 1ZKEA 5AQLB 3SOLA 3AA6B 4DR5T 4DV0T 4DO0A 1CHUA 4CXYA 4AKRB 3N5LA 4QXCB 2BVMA 4O4LE 4CN6A 3P4RA 2XUEA 3FBZA 4U74A 2C5KT 3IEEA 3I0QA 1BR2A 4U7IA 3AA0B 1ZP0A 3N9NA 3JC6D 5CA0E 5F3JA 4HFEA 3ZT7A 4YSZA 3UUXB 3K3OA 4AKLA 4WNKA 2BG9A 1X9BA 3AAEB 3N9OA 3PJAA 4UVBB 2NTYA 5JDFA 3T8OA 2A72A 1D1CA 2W67A 3TLWA 4H9RC 1VRBA 4HKAA 5EZYE 4KI0F 4P0BA 1UX4A 3RC3A 5EK3A 3P50A 4DR1T 3PUVF 2W63A 3AE1A 3H3AA 5JR9B 2EHOC 3P4PA 4EYYR 4ZI7E 4DBRA 3RX6A 2BBHA 4EEDA 3KFWX 3S4UA 1T7SA 3EHZA 1KNPA 5J2UE 2CWYA 3AAIA 3CX8B 4IDPA 4EZHA 4HWDA 4U7YA 1XNQT 4JI7T 4X1KE 2I15A 1BR4A 2XSAA 2WDVA 4LF9T 4E7ZA 3PJAJ 2ODUA 4ZS2A 3Q5XA 5DQVA 4IDZA 3FZLB 3AE9A 2CE7A 4HFHA 4H63V 1L0VA 3RYIE 4B6XA 3AXJA 2W62A 5CA1E 2WS3A 2FUPA 5FVLA 3RH3A 4LFBT 1HTJF 4UVCB 4JI8T 3LG7A 2E9XD 3UUNA 1LVFA 1D0YA 3ZSSA 2KNGA 3AEAA 5LB7B 3SFDA 2IC6A 3RSYA 2IC9A 2V7KA 1G73A 4QWNB 3CQXC 1HNZT 3RYFE 4GYRA 1W0AA 2CMRA 3A5XA 1E2AA 3OKQA 5AQJB 4U33A 2K24A 2GK9A 5J0ZA 3QNUA 3ZJ2A 3N2GE 3S4DA 5C3JA 3CVRA 3E08A 1S35A 5FXVA 2LM2A 2Q9QB 4YXDA 1GQEA 4JI2T 2V7LA 1MMNA 1HFAA 4X20E 3IM3A 5HVZA 3PUYF 1BR1A 4MALA 3DTOA 3N9MA 2LLYA 2XQ8A 5FY7A 4L0RA 4X1YE 3AE3A 1YKHB 3TLSA 2XAQB 4TV8E 3RRSA 4AIUA 4IE5A 1NWMX 2PFVA 4I50E 5DQWA 1J1JA 4UR9A 5ADXL 4RIQA 5AQVB 1WYBA 5HEHA 2HHHT 3ZMZB 1MMAA 2E5VA 2YDQA 4LF8T 2A3DA 2CEAA 2WY2A 4TUYE 5L3FB 2ACXA 2XAFB 1HX8A 2CPTA 1S94A 2XQ7A 2BVLA 3Q5EA 3AVSA 2I6HA 4HFVA 4UVAB 3OVUA 5A1LA 2UXXB 4OHFA 3AECA 3EUHA 2H89A 4LFAT 4BA9A 3NVOA 3KVAA 3I0OA 3ZKRA 3TKLB 3L3PA 3PUXF 4ZXLA 2C5JA 4DR6T 1VOMA 4ERRA 4K0UA 2W61A 2IW5B 3U3IA 4IT4A 4O4HE 5CFBA 2UXDT 4DV1T 2VB6A 3AEDA 3Q2MA 3UTKA 3DJBA 5ABFB 5AQQB 4EB6E 4F8HA 4HGAA 5HXEA 3MXZA 3EAMA 3CKDA 1XDPA 4HEAA 4OK0A 3LBXA 2BG9E 3GMIA 4DMWA 4U2ZA 4X5TA 3MZKB 5HWXA 3C50A 4C91A 4X65T 1HS7A 5CB4E 3PU8A 2BKOA 5GONE 2JIWA 1M62A 1Z0PA 2EHOA 3C4ZA 2VVSA 3UUBA 3QFYA 2KYGA 2IDOB 4DR7T 3QK6A 4JUYA 2NWBA 3PURA 2LSJA 2V7IA 3FHNA 5LJMA 3C4WA 5LCYA 3ETVA 3BQIA 3RKOA 4O4IE 4UEMA 3NKZA 4H9SE 4H9PC 2RA1A 3FZMB 3G36A 3Q5WA 4WBNE 2YU2A 3C98B 3SWHA 5IUXA 4PAGA 5HEGA 2Q9QD 4C90A 3I9YA 2AXDS 2VASA 4JEUB 1OXZA 5FNVE 1QUUA 3L09A 4GKJT 4H9OC 2JQ9A 3LJCA 3PV0F 2PTFA 4DR2T 2FJDA 2IHR1 2L8KA 4AQYT 1FJGT 4U2YA 5JDLA 3BQKA 4HFBA 3WAJA 4EOZB 4L5GA 3AEFA 2CB9A 4HWIB 1IBKT 4NPPA 3NRXA 3P4QA 3LFMA 5H6QB 1WFDA 4JI5T 2VKDA 5AQPB 4WW0A 4WZXA 2HPJA 3PDYA 1KK7A 3F31A 4UV8B 4PW8A 2DCFA 2H7OA 3K8PC 3RC8A 4CI1B 1M7KA 5ETWA 5L3EB 2FBWA 3LK3B 1QSDA 2JRKA 3R6NA 4L9IA 4QX7B 1XMOT 2KWIB 4MFRA 5LGTB 4YTMA 2WAUA 1R2AA 1NENA 4CN1A 4TNVA 4IDOA 2H7VC 1H7CA 3LDQB 3KV6A 3ZN0B 4NUVA 1JNZA 2B76A 2MTQA 3S4AA 4UIGA 2E9XB 2I0MA 4YY3T 2WU2A 3KVBA 4A97A 2HN1A 4IE4A 4IREA 2EHOD 5CJ5A 4JYAT 1IJ6A 1VCSA 4TWHA 2C5IT 1XWMA 4EXTA 4UXNB 5HEJA 2RQYA 2PJQA 5J2TE 2ZM8A 3GA8A 3UQ7A 1T72A 2WMOA 2BS2A 5IWAT 5HAXA 4DUZT 2UU9T 4CI3B 2W4XA 3O4XE 3CIRA 2HPLA 4TN7B 3NWIA 2XQAA 4ZEYA 4YTNA 2D5UA 3ZMUB 3C4XA 2WU5A 3UU5A 2YK0A 5AFUL 2D0TA 4A56A 2WCAA 3NZPA 3FBLA 1BR0A 2BG9B 3CX6B 1YXRA 5TAOA 2E2AA 1OEDE 1MIYA 5M4YA 2DL1A 3UU3A 4LF7T 5L3DB 1QLBA 3JADA 1SA0E 2V8SV 2RPAA 1NAFA 3CQGB 4IDNA 4F9KA 1U4QA 2K48A 3KINB 3ZT5A 1J5WA 2LRLA 3X1DA 4O2AE 5EK4A 2YEVC 3QUJA 1XMQT 4Q25A 1N33T 2V6YA 5LGUB 3ZN1B 2G0UA 4BAYB 5IYZE 4QH5A 5HXHA 4KHZF 2J62A 5LBQB 4NIQA 1US7B 3IM4A 3ONXA 2Y6XA 2XQ9A 4QH4A 2H88A 4DV3T 5ABEA 3AXJB 3B13A 3TLVA 1YQ3A 4PFOA 3ZC0A 1MNEA 5LHGB 4AI6A 4KP3C 4GYSA 4QXHB 5LA6E 1Z8UA 2L9QA 1N32T 3HR0A 4I4TE 4E7SA 5AQIB 4Z8XA 3AE4A 4CI2B 2X9WA 1KF6A 4OYJA 5AQNB 3QDEA 2D9DA 3ZYLA 4DVDA 4NUUA 2JQKA 1LVKA 1D1AA 4IDQA 1LKXA 2XQ5A 1UGOA 3ZCJA 4ZZBA 2XQ4A 3PUGA 3ABVA 2K5BB 3PUSA 3NZQA 2YDSA 3VU7H 5AQOB 3F57A 2VK9A 3ZC1A 5L3BB 4DV2T 3HKDE 3NBXX 1WLXA 4KMCA 3ZMSB 3CQCB 5LHIB 2CA5A 2LHNA 3LK2B 4AQFC 3JC6C 3B57A 3P8CD 5F8PA 2F4VT 3UU4A 4MLKA 1MMDA 4U31A 4PJJA 3G06A 2XAJB 4UV9B 2VQET 4A5XA 2CQSA 2CLYC
chains in the Genus database with same CATH topology
2XQYA 5LJMA 3IHRA 2MYSA 3C4WA 5LCYA 2SPCA 5FY1A 3ETVA 3BQIA 3KBTA 1FIOA 3N2OA 3ESLA 2Y48B 2XHEB 3RKOA 3UT5E 2BDEA 3EDVA 3HI2A 4HE8A 3ZEFB 4O4IE 3ZYKA 4XAXB 3UUMA 4IE6A 4UEMA 3QC9A 4ASKA 5C8YE 5FY0A 1IJ5A 4YLHA 2KMFA 3U78A 5HWYA 1YD8G 4H9SE 4ADZA 4H9PC 3MACA 2RA1A 3OJAA 4O8SA 2DI4A 3Q5WA 4WBNE 2YU2A 4ZS3A 1OWAA 3C98B 3P7IA 3SWHA 5LG4A 3AA1B 4PAGA 5L2LA 4BJNA 4C90A 2Q9QD 4GOUA 4IHJE 3I9YA 4F6RC 4AKGA 5LJNA 3V5SA 5KMGP 3WI3A 2IAKA 2VASA 2N9DA 4JEUB 5LOVE 1E1HB 1ZV4X 2LE8A 4DMVA 4MHCA 2QGSA 3HKBE 5JR9A 1OXZA 1WYCA 5FNVE 4ZHQE 4M1PA 1MIWA 2WMNA 2CXFA 3N2KE 4CXWA 1QUUA 1B7TA 2E8IA 2WSSV 2X0LB 4BJMA 3L09A 3SRZA 1YKEB 4H9OC 3LJCA 4IGUA 2MBGA 1MMGA 3FB2A 2DWKA 3ANWB 2CXLA 2L8KA 4PJNA 5J1GA 3PUAA 3IBPA 2CCQA 3V5UA 5BMVE 2A2FX 5JDLA 2WBLA 3BQKA 3ZMTB 5FXZA 2LT3A 4MBQA 3WAJA 2OA5A 4EOZB 3C51A 4L5GA 2KLQA 5JVDE 2CB9A 2VWAA 1AJ3A 4PJLA 4TZ4C 2KXPB 2X68A 4GK0E 2E9XC 3LBXB 1HCIA 3NRXA 2H3RA 2NW8A 3PU3A 4AKIA 1ZKEA 3LFMA 1X79A 5H6QB 3SOLA 3NRYA 3AA6B 4I55E 4JEHB 2VKDA 1G8XA 5HXCA 2X9HA 4WW0A 3O9XA 3WAKA 4DO0A 4CXYA 2KZ7B 4AKRB 2HPJA 4CXXA 3PDYA 3RPUA 2V7JA 1KK7A 3N5LA 4YJ3E 3F31A 4UV8B 4QXCB 2BVMA 4O4LE 4PW8A 2DCFA 2H7OA 2EHOB 1KNZA 2KNDA 3K8PC 3RC8A 3I1AA 2XUEA 3FBZA 4CI1B 4U74A 2C5KT 3IEEA 3I0QA 5ETWA 3VHLA 5L3EB 1BR2A 3HA4A 4GK5E 3LK3B 4H63H 3KV4A 1QSDA 4ZI2D 2JRKA 3AA0B 3R6NA 3N9QA 4L9IA 4QX7B 1FMWA 2V7MA 2XTLA 3N9NA 2KWIB 4AXPA 3JC6D 5CA0E 5DJQC 4MFRA 5LGTB 5F3JA 2Y8DA 4PJMA 2WAUA 5DABA 3MA9A 3ZJ1A 3UUXB 2PBIA 3K3OA 4AKLA 4WNKA 4J2CA 1HG2A 3M65A 4ZI3D 5L3CB 2H7VC 1O3XA 2VKJA 3AAEB 3GN5A 3N9OA 4UVBB 5JDFA 2NTYA 2X9YA 3T8OA 2A72A 2W00A 1H7CA 1D1CA 2Q9QA 3CMLA 3KV6A 4H9RC 4WBOA 3ZN0B 4NUVA 1VRBA 3K3QC 2NP9A 2W0GA 4HKAA 5EZYE 4EAHA 4P0BA 2MTQA 3MJXA 1UX4A 2JMKA 2ZM0A 3KV5A 2V1DB 4UIGA 3RC3A 2E9XB 2CM0A 2Z6EA 5EK3A 4HTEA 2W63A 2WWUA 3H3AA 1D0XA 1FEWA 3N9PA 4YJ2E 5JR9B 3KVBA 2EHOC 3FXEB 3K3NA 4UF0A 4IE4A 1D1BA 4EYYR 4ZI7E 4TV9E 4ILUA 4DBRA 3RX6A 2LSIA 3KFWX 2EHOD 4I43B 3S4UA 4QX8B 2LJLA 1IJ6A 4IIJE 2K9AA 5J2UE 2CWYA 3AA7B 2OUTA 3AAIA 2C5IT 3CX8B 3RRWA 4EZHA 3O1IA 4EXTA 4UXNB 4TX5A 4X1KE 5JH7E 1BR4A 2RQYA 4ZOLE 2PJQA 3C64A 5FYMA 1Y64B 5J2TE 1CUNA 2XASB 3MKDA 4E7ZA 5LNKA 4ISTA 2ODUA 2XAHB 5EK2A 2L3LA 4ZS2A 3OYZA 5JREA 2ZM8A 3EDUA 3GA8A 3LK42 3ZLIA 3Q5XA 5DQVA 1ZEEA 4XZCA 4IDZA 4CQIA 4HN9A 3AVRA 2CE7A 4V1Av 2WMOA 5JRCA 2ZMAA 4H63V 4DNDA 5HAXA 3RYIE 4B6XA 1FMVA 2N1GA 2UXNB 5FP3A 4IE0A 2W62A 4CI3B 3HL6A 4H9NC 2V26A 5CA1E 3O4XE 5FXWA 3RH3A 3KDSE 1HTJF 3N9LA 4UVCB 2HPLA 3VKGA 3LG7A 4TN7B 1EZ3A 2E9XD 5JR9C 3UUNA 1LVFA 1D0YA 2DLRA 3GWHA 2KNGA 2IC6A 4G2AA 2IC9A 2V7KA 3OBVE 1G73A 4EZ4A 3CWZB 2P9BA 3CQXC 4QWNB 4AQFA 3RYFE 4GYRA 2CMRA 2LOSA 5HYAA 2D5UA 2JMHA 3ZMUB 3A5XA 3OKQA 3C4XA 2ES0A 2K24A 2GK9A 3E0ZA 2KINB 2DNXA 3H37A 4YFSA 5HXSA 2YK0A 5AFUL 2D0TA 3ZJ2A 1ZHCA 4A56A 4PK5A 3N2GE 2N2NA 3NZPA 3FBLA 4KUMB 1BR0A 4ISSA 3CX6B 3GN5B 3CVRA 2X67A 3E08A 1S35A 5LBMA 5FXVA 5TAOA 2Q9QB 1MIYA 4PK6A 2NTXA 3AAAB 2LOPA 5M4YA 2V7LA 1MMNA 4O4JE 2C0SA 5L3DB 1LRZA 1HFAA 4X20E 3CPZA 1SA0E 2CLYC 3R84B 1NAFA 3CQGB 1BR1A 1UX5A 4MALA 3DTOA 3N9MA 2CXDA 3E22E 3FXDB 3ZYMA 1U4QA 2K48A 3KINB 4L0RA 4X1YE 5FY7A 4DBQA 2CBGA 4UF0B 5JDQA 2JJ9A 2JQQA 4O2AE 5EK4A 4AKHA 2YEVC 3QUJA 5FMNA 4ANJA 3F2EA 1YKHB 2LSYA 5LGUB 3ZN1B 4P0AA 2XAQB 2X66A 2G0UA 4TV8E 2NW9A 4BAYB 5LGNB 5IYZE 4GIWA 4IE5A 4O2BE 5HXHA 1NWMX 2PFVA 4OFZA 4I50E 1HG5A 5DQWA 1HF8A 5KX5E 3PE0A 5LBQB 4PNIA 3ZMVB 5ADXL 4IE7A 1US7B 5L3GB 1WYBA 5LYJE 3O1HA 3ZMZB 1MMAA 3UULA 4X1IE 3ONXA 2Y6XA 3FHNA 5LHHB 2A3DA 4N78D 2CEAA 1YW0A 2D0UA 4EIWA 4EYUA 3SS1A 4U72A 4TUYE 3KBUA 3Q9DA 5JDNA 5L3FB 2ACXA 3J7Yq 5JRCB 4AQGA 2LSKA 2Q9QC 3HKCE 3W15B 2XAFB 3RYCE 4QKNA 1HX8A 3B13A 5FXXA 1S94A 2XAGB 2BVLA 4PFOA 3ZC0A 1MNEA 2E9XA 4YHJA 5LHGB 2B1EA 2QA7A 3AVSA 2KT9A 2VKHA 4AI6A 4HFVA 4KP3C 4UVAB 2YINA 4G63A 4GYSA 4QXHB 3J9X1 5A1LA 1MNDA 4JLEA 5LA6E 2L9QA 2BZBA 3KV9A 3HR0A 4I4TE 4E7SA 2UXXB 2DHRA 4OHFA 1WR6A 5HXRA 3IF8B 5LXTE 5KDMC 3EUHA 3O1JA 4Z8XA 4XBFB 3UFEA 4CI2B 2X9WA 4BA9A 3VKHA 3KVAA 3OYXA 4OYJA 3I0OA 3TKLB 3L3PA 3ZYLA 4PFPA 2M67A 5H6RB 4P09A 2VKOA 3DP7A 4FJOA 3ZPOA 4DVDA 2C5JA 2ZLYA 1VOMA 1T98A 4ERRA 4KBMB 4K0UA 4NUUA 2W61A 2IW5B 1IAPA 2WM9A 1LVKA 2NOXA 1D1AA 3U3IA 1LKXA 4O4HE 1MIVA 2YU1A 2RP4A 2CLYB 3ANWA 2VB6A 2D2SA 2JPFA 1UCUA 3Q2MA 3ZCJA 2J1DG 4FI5A 3UTKA 3PUGA 2K5BB 3DJBA 3PUSA 2CWOA 4UELA 2ODVA 4EB6E 3NZQA 2PG8A 1V9DA 2ZM2A 3EVYA 5JDMA 1WRDA 3ETUA 4HGAA 5HXEA 3MXZA 2X9XA 3CKDA 2NW7A 4QHOA 3VU7H 4HEAA 3F57A 4OK0A 3LBXA 2VK9A 3MK7C 3ZC1A 3GMIA 4DMWA 5L3BB 3PMIA 3HKEE 3HKDE 4H9QC 3NBXX 3RYHE 1WLXA 3MZKB 5HWXA 3D0TA 3I9WA 3BK9A 3C50A 4KMCA 4ZI2C 5IHYA 3CQCB 2CA5A 2I59A 3ZMSB 3RRCA 2LHNA 4C91A 5LHIB 1HS7A 3LK2B 5CB4E 4AQFC 2LM9A 3CX7B 1IZNB 3PU8A 3BQLA 3JC6C 5GONE 3B57A 4CZZB 1U5PA 5JDHA 5JDGA 1Z0PA 4PK4A 3P8CD 2EHOA 2MOZA 2X51A 3C4ZA 5E0OA 3PTRB 4QXBB 3ZCIA 2VL8A 4OYKA 2HH7A 2LEHA 5F8PA 2K9QA 3PUQA 1MMDA 2LSGA 4MLKA 3AB3B 3QK6A 4ZI3C 2KWHA 4JUYA 4PJJA 5JQGE 1SHZC 2NWBA 3PURA 2LSJA 2XAJB 4UV9B 2V7IA 1D0ZA 5LP6E 2DWGA 2LHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFE A;  3GWH A; 
#chains in the Genus database with same CATH topology
 2MYS A;  5FY1 A;  3KBT A;  1FIO A;  3N2O A;  3ESL A;  2XHE B;  4RTA A;  3UT5 E;  3EDV A;  3K1S A;  1KNR A;  4IE6 A;  4YLH A;  2KMF A;  5HWY A;  1YD8 G;  3MAC A;  1ZOY A;  3QFZ A;  4ZS3 A;  1OWA A;  3AA1 B;  5L2L A;  4RT4 A;  4GOU A;  4F6R C;  2FJE A;  4YSY A;  4DMV A;  1ZV4 X;  2LE8 A;  5L4E A;  2VQF T;  4ZHQ E;  4AIS A;  2WMN A;  3N2K E;  1B7T A;  3FZF B;  5J1G A;  3PUA A;  3IBP A;  3V5U A;  2LT3 A;  1UUR A;  2OA5 A;  2WZH A;  3C51 A;  2CQT A;  1W09 A;  1AJ3 A;  4PJL A;  4GK0 E;  2E9X C;  3LBX B;  2MAW A;  2NW8 A;  3RF1 A;  4AKI A;  3ACS A;  1X79 A;  3NRY A;  3JAE A;  2MPK A;  3QOF A;  3WAK A;  4CXX A;  1T8B A;  3RPU A;  2EHO B;  1KNZ A;  4K0K T;  3TLT A;  3S4C A;  3VHL A;  2WDR A;  2HN2 A;  4GK5 E;  4ZI2 D;  1E7P A;  2UUB T;  1OED B;  3N9Q A;  5DJQ C;  1YQ4 A;  2W2U A;  2Y8D A;  3ZJ1 A;  3ONJ A;  5HCM A;  1HG2 A;  3P4S A;  4ZI3 D;  1O3X A;  2VKJ A;  3GN5 A;  2X9Y A;  4WBO A;  4B3S T;  2BKN A;  2NP9 A;  2DRN A;  2W0G A;  3MJX A;  2ZM0 A;  2V1D B;  2LKH A;  3EI0 A;  2CBI A;  1D0X A;  1FEW A;  4KHP T;  4DR4 T;  3FXE B;  4HWH A;  4UF0 A;  1D1B A;  4TV9 E;  4ILU A;  4I43 B;  4X64 T;  3AA7 B;  2OUT A;  2WWV A;  5AQM B;  2V5C A;  4EV6 A;  2BKP A;  3C64 A;  5FYM A;  1CUN A;  2J47 A;  2XAS B;  4IST A;  2XAH B;  4JBW F;  3A8Y C;  5EK2 A;  3JCF A;  1ZEE A;  4Z90 A;  4CQI A;  4HN9 A;  3AVR A;  4V1A v;  3H3M A;  5JRC A;  2N1G A;  2EZW A;  5FP3 A;  2UXB T;  3HL6 A;  5FXW A;  2W66 A;  1N34 T;  5L4H A;  3VKG A;  2CRB A;  5JR9 C;  4EEB A;  3RGL A;  3QG0 A;  2DLR A;  2QVA A;  4G2A A;  2WP9 A;  3Q5D A;  3RQU A;  5AQH B;  2E5L T;  3CWZ B;  2P9B A;  4AQF A;  3RIA A;  4IL9 A;  2LOS A;  3OTO T;  5FVK A;  3T1Y T;  4JI6 T;  3E0Z A;  2DNX A;  4LFC T;  3AE8 A;  4DUY T;  4PK5 A;  2IUB A;  4KUM B;  4ISS A;  4LF5 T;  2XQ3 A;  5LBM A;  2NTX A;  2V6X A;  3S4B A;  3AEE A;  4O4J E;  2C0S A;  2IML A;  3CPZ A;  1UX5 A;  1I6Z A;  2CXD A;  3E22 E;  3FXD B;  1UUS A;  4DBQ A;  4ILB A;  2CBG A;  2CBJ A;  5JDQ A;  4AKH A;  3IA3 A;  5FMN A;  4ANJ A;  1WR0 A;  2CHO A;  3F2E A;  4B3R T;  2X66 A;  3FZK B;  4TWD A;  3A7M A;  5LGN B;  1HG5 A;  1JNR A;  3PE0 A;  3ZMV B;  4IE7 A;  1HNW T;  5LYJ E;  3O1H A;  4DV5 T;  5F5W A;  2YOE A;  3UUL A;  4X1I E;  2JQH A;  5LHH B;  3L8R A;  4EIW A;  3RKG A;  4EYU A;  3B5M A;  4U72 A;  3KBU A;  3Q9D A;  5JDN A;  4AQG A;  2LSK A;  2Q9Q C;  3HKC E;  4QKN A;  1VCT A;  5FKY A;  5FXX A;  4YHJ A;  2E9X A;  2B1E A;  2QA7 A;  2YDR A;  4G63 A;  1MND A;  4JLE A;  3KV9 A;  3IF8 B;  5KDM C;  4TWF A;  5H6R B;  4P09 A;  2VKO A;  3DP7 A;  4FJO A;  3ZPO A;  2ZLY A;  1T98 A;  4KBM B;  1IAP A;  2WM9 A;  4LML A;  2RP4 A;  5ABG A;  3RIU C;  1J5E T;  2UUA T;  3ANW A;  2D2S A;  5AQF B;  1UCU A;  1SE7 A;  2ODV A;  1V9D A;  3OPC A;  5JDM A;  3SFE A;  1WRD A;  3ETU A;  2X9X A;  2NW7 A;  3VRB A;  2QYW A;  1N36 T;  4YSX A;  3ZST A;  2V6Y B;  3BK9 A;  3PUZ F;  5IHY A;  2ZM6 T;  3RRC A;  1IZN B;  3BQL A;  2WQY A;  1U5P A;  5JDG A;  2MOZ A;  2X51 A;  5E0O A;  3TLU A;  4QXB B;  3ZCI A;  2VL8 A;  4OYK A;  2LEH A;  2XJ7 A;  5AQK B;  4B3M T;  2K9Q A;  4YTP A;  3LSV A;  3PUQ A;  1D0Z A;  5LP6 E;  5C2T A;  3IHR A;  2Y48 B;  3HI2 A;  3ZEF B;  2XSB A;  3ZYK A;  4XAX B;  4LF6 T;  5ABH A;  4JI3 T;  4ASK A;  5CGM A;  3VR8 A;  3OJA A;  4O8S A;  2DI4 A;  3FZH B;  2R6G F;  3P7I A;  1NEK A;  2WB5 A;  4BJN A;  4GKK T;  4IHJ E;  3ACT A;  3RI5 A;  5KMG P;  3WI3 A;  2IAK A;  1WCR A;  1OED C;  4ZZC A;  3HKB E;  5JR9 A;  1WYC A;  4LF4 T;  2VL0 A;  1MIW A;  2E8I A;  2WSS V;  1YKE B;  2X0H A;  4IGU A;  1MMG A;  4ILA A;  2DWK A;  1UK5 A;  3AE5 A;  2CCQ A;  1IBM T;  4ILC A;  4P1N A;  4MBQ A;  3T1H T;  2KXP B;  2X68 A;  3EAB A;  4Z91 A;  3PU3 A;  1HNX T;  1KEY A;  4NXM T;  4I55 E;  4YT0 A;  4JEH B;  1G8X A;  5HXC A;  2X9H A;  3AFJ A;  3O9X A;  3UFG A;  2KZ7 B;  4HWC A;  2V7J A;  4YJ3 E;  5AQT B;  2KND A;  5AQS B;  3I1A A;  3AE6 A;  2LHR A;  2VUR A;  3HA4 A;  4H63 H;  3KV4 A;  2YKS A;  3PUW F;  3M3Z B;  1FMW A;  2V7M A;  2XTL A;  4AXP A;  1XZY A;  2CHN A;  4PJM A;  1XNR T;  5DAB A;  3MA9 A;  5HCJ A;  5LMN T;  2PBI A;  3P4W A;  4ZP3 A;  3QB5 A;  4J2C A;  2UXC T;  3M65 A;  2IIU A;  5L3C B;  2W00 A;  5AQU B;  2Q9Q A;  3CK6 A;  3CML A;  4I0U A;  2WDQ A;  5FL1 A;  3K3Q C;  4EAH A;  1DU2 A;  4LMJ A;  2JMK A;  3KV5 A;  2CM0 A;  2Z6E A;  4HTE A;  2WWU A;  3N9P A;  4YJ2 E;  3AE7 A;  3K3N A;  2LSI A;  4QX8 B;  4JI1 T;  2LJL A;  4IIJ E;  2K9A A;  3L39 A;  3RRW A;  3RHW A;  3O1I A;  4TX5 A;  5JH7 E;  4ZOL E;  2NR4 A;  1Y64 B;  4TNW A;  3MKD A;  5JTG A;  5LNK A;  2L3L A;  5JRE A;  3OYZ A;  3EDU A;  3ZLI A;  3LK4 2;  4DV7 T;  4XZC A;  2XY8 B;  3RIU A;  2WZI A;  2ZMA A;  4DND A;  4X62 T;  1FMV A;  2UXN B;  4IE0 A;  2M6I A;  4H9N C;  2V26 A;  3KDS E;  3N9L A;  1EZ3 A;  1W9R A;  5AQR B;  2X0Y A;  5HEU A;  3GWH A;  2V5D A;  4DR3 T;  1L6E A;  3OBV E;  4EZ4 A;  4JI0 T;  2QRX A;  5HYA A;  2JMH A;  5AQG B;  2ES0 A;  2KIN B;  1HR0 T;  3H37 A;  4YFS A;  5HXS A;  1ZHC A;  4NXN T;  2N2N A;  2H9R A;  2K3W A;  5LMU T;  3GN5 B;  5BR8 T;  2X67 A;  2OV9 A;  4PK6 A;  3AAA B;  2LOP A;  4HFD A;  1LRZ A;  5ABF A;  3JAF A;  3R84 B;  2UUC T;  1Y01 A;  3ZYM A;  4UF0 B;  3AEG A;  2JJ9 A;  2JQQ A;  3RLF F;  2LSY A;  4P0A A;  4OX9 T;  2NW9 A;  4GIW A;  4O2B E;  4OFZ A;  3UQ4 A;  1OED A;  2YN6 A;  1HF8 A;  5KX5 E;  4YHH T;  4PNI A;  3AEB A;  5L3G B;  5KXJ A;  4X66 T;  4N78 D;  1YW0 A;  2BBJ A;  2FJB A;  2D0U A;  2BG9 C;  3SS1 A;  4DID B;  2XPK A;  3J7Y q;  5JRC B;  1XDO A;  3W15 B;  3RYC E;  4HWF A;  4DV6 T;  4U3C A;  2FJA A;  2XAG B;  3VR9 A;  2VVN A;  2KT9 A;  2VKH A;  1W0B A;  3QB5 K;  2YIN A;  3J9X 1;  2BZB A;  4JI4 T;  3VRA A;  4JV5 T;  4A98 A;  2DHR A;  1WR6 A;  5HXR A;  5LXT E;  3O1J A;  4XBF B;  3UFE A;  2IZY A;  3VKH A;  3OYX A;  2BS3 A;  4PFP A;  2A9U A;  2M67 A;  3RIF A;  2NOX A;  2XZE A;  1MIV A;  2YU1 A;  5FL0 A;  2CLY B;  2JPF A;  2J1D G;  3AE2 A;  1HX1 B;  4FI5 A;  2CWO A;  4UEL A;  2PG8 A;  2ZM2 A;  2J4G A;  3EVY A;  4EGW A;  2XQ6 A;  4QHO A;  3MK7 C;  2OLT A;  3PMI A;  3HKE E;  4H9Q C;  1R8I A;  4CN4 A;  3RYH E;  3D0T A;  3I9W A;  4ZI2 C;  4HFC A;  2I59 A;  2AE9 A;  2LM9 A;  3CX7 B;  4CZZ B;  4KX6 A;  5JDH A;  4PK4 A;  3PTR B;  2LKG A;  2HH7 A;  3UU6 A;  1KFY A;  4ZI3 C;  2LSG A;  2M6B A;  2KSR A;  3AB3 B;  2KWH A;  5JQG E;  1SHZ C;  4DV4 T;  4QH1 A;  2DWG A;  4LMK A;  2XQY A;  1IBL T;  2SPC A;  2BDE A;  4HE8 A;  3RQW A;  3UUM A;  1I94 T;  3QC9 A;  2XM2 A;  5C8Y E;  3ONL C;  5FY0 A;  1IJ5 A;  3U78 A;  4B3T T;  4ADZ A;  4IL4 A;  5LG4 A;  4AKG A;  5LJN A;  3V5S A;  5LG3 A;  4HFI A;  5L47 A;  2N9D A;  5LOV E;  1E1H B;  3UU8 A;  4MHC A;  4COF A;  2QGS A;  2BS4 A;  4M1P A;  2CXF A;  4CXW A;  4BJM A;  2X0L B;  3SRZ A;  2MBG A;  3FB2 A;  1SUM B;  3ANW B;  2CXL A;  5HEO A;  4WYV A;  4PJN A;  5BMV E;  2A2F X;  2WBL A;  3ZMT B;  5FXZ A;  2XM1 A;  3ZT6 A;  2KLQ A;  5JVD E;  2VWA A;  4TZ4 C;  2LRK A;  1HCI A;  2ACZ A;  2H3R A;  1ZKE A;  5AQL B;  3SOL A;  3AA6 B;  4DR5 T;  4DV0 T;  4DO0 A;  1CHU A;  4CXY A;  4AKR B;  3N5L A;  4QXC B;  2BVM A;  4O4L E;  4CN6 A;  3P4R A;  2XUE A;  3FBZ A;  4U74 A;  2C5K T;  3IEE A;  3I0Q A;  1BR2 A;  4U7I A;  3AA0 B;  1ZP0 A;  3N9N A;  3JC6 D;  5CA0 E;  5F3J A;  4HFE A;  3ZT7 A;  4YSZ A;  3UUX B;  3K3O A;  4AKL A;  4WNK A;  2BG9 A;  1X9B A;  3AAE B;  3N9O A;  3PJA A;  4UVB B;  2NTY A;  5JDF A;  3T8O A;  2A72 A;  1D1C A;  2W67 A;  3TLW A;  4H9R C;  1VRB A;  4HKA A;  5EZY E;  4KI0 F;  4P0B A;  1UX4 A;  3RC3 A;  5EK3 A;  3P50 A;  4DR1 T;  3PUV F;  2W63 A;  3AE1 A;  3H3A A;  5JR9 B;  2EHO C;  3P4P A;  4EYY R;  4ZI7 E;  4DBR A;  3RX6 A;  2BBH A;  4EED A;  3KFW X;  3S4U A;  1T7S A;  3EHZ A;  1KNP A;  5J2U E;  2CWY A;  3AAI A;  3CX8 B;  4IDP A;  4EZH A;  4HWD A;  4U7Y A;  1XNQ T;  4JI7 T;  4X1K E;  2I15 A;  1BR4 A;  2XSA A;  2WDV A;  4LF9 T;  4E7Z A;  3PJA J;  2ODU A;  4ZS2 A;  3Q5X A;  5DQV A;  4IDZ A;  3FZL B;  3AE9 A;  2CE7 A;  4HFH A;  4H63 V;  1L0V A;  3RYI E;  4B6X A;  3AXJ A;  2W62 A;  5CA1 E;  2WS3 A;  2FUP A;  5FVL A;  3RH3 A;  4LFB T;  1HTJ F;  4UVC B;  4JI8 T;  3LG7 A;  2E9X D;  3UUN A;  1LVF A;  1D0Y A;  3ZSS A;  2KNG A;  3AEA A;  5LB7 B;  3SFD A;  2IC6 A;  3RSY A;  2IC9 A;  2V7K A;  1G73 A;  4QWN B;  3CQX C;  1HNZ T;  3RYF E;  4GYR A;  1W0A A;  2CMR A;  3A5X A;  1E2A A;  3OKQ A;  5AQJ B;  4U33 A;  2K24 A;  2GK9 A;  5J0Z A;  3QNU A;  3ZJ2 A;  3N2G E;  3S4D A;  5C3J A;  3CVR A;  3E08 A;  1S35 A;  5FXV A;  2LM2 A;  2Q9Q B;  4YXD A;  1GQE A;  4JI2 T;  2V7L A;  1MMN A;  1HFA A;  4X20 E;  3IM3 A;  5HVZ A;  3PUY F;  1BR1 A;  4MAL A;  3DTO A;  3N9M A;  2LLY A;  2XQ8 A;  5FY7 A;  4L0R A;  4X1Y E;  3AE3 A;  1YKH B;  3TLS A;  2XAQ B;  4TV8 E;  3RRS A;  4AIU A;  4IE5 A;  1NWM X;  2PFV A;  4I50 E;  5DQW A;  1J1J A;  4UR9 A;  5ADX L;  4RIQ A;  5AQV B;  1WYB A;  5HEH A;  2HHH T;  3ZMZ B;  1MMA A;  2E5V A;  2YDQ A;  4LF8 T;  2A3D A;  2CEA A;  2WY2 A;  4TUY E;  5L3F B;  2ACX A;  2XAF B;  1HX8 A;  2CPT A;  1S94 A;  2XQ7 A;  2BVL A;  3Q5E A;  3AVS A;  2I6H A;  4HFV A;  4UVA B;  3OVU A;  5A1L A;  2UXX B;  4OHF A;  3AEC A;  3EUH A;  2H89 A;  4LFA T;  4BA9 A;  3NVO A;  3KVA A;  3I0O A;  3ZKR A;  3TKL B;  3L3P A;  3PUX F;  4ZXL A;  2C5J A;  4DR6 T;  1VOM A;  4ERR A;  4K0U A;  2W61 A;  2IW5 B;  3U3I A;  4IT4 A;  4O4H E;  5CFB A;  2UXD T;  4DV1 T;  2VB6 A;  3AED A;  3Q2M A;  3UTK A;  3DJB A;  5ABF B;  5AQQ B;  4EB6 E;  4F8H A;  4HGA A;  5HXE A;  3MXZ A;  3EAM A;  3CKD A;  1XDP A;  4HEA A;  4OK0 A;  3LBX A;  2BG9 E;  3GMI A;  4DMW A;  4U2Z A;  4X5T A;  3MZK B;  5HWX A;  3C50 A;  4C91 A;  4X65 T;  1HS7 A;  5CB4 E;  3PU8 A;  2BKO A;  5GON E;  2JIW A;  1M62 A;  1Z0P A;  2EHO A;  3C4Z A;  2VVS A;  3UUB A;  3QFY A;  2KYG A;  2IDO B;  4DR7 T;  3QK6 A;  4JUY A;  2NWB A;  3PUR A;  2LSJ A;  2V7I A;  3FHN A;  5LJM A;  3C4W A;  5LCY A;  3ETV A;  3BQI A;  3RKO A;  4O4I E;  4UEM A;  3NKZ A;  4H9S E;  4H9P C;  2RA1 A;  3FZM B;  3G36 A;  3Q5W A;  4WBN E;  2YU2 A;  3C98 B;  3SWH A;  5IUX A;  4PAG A;  5HEG A;  2Q9Q D;  4C90 A;  3I9Y A;  2AXD S;  2VAS A;  4JEU B;  1OXZ A;  5FNV E;  1QUU A;  3L09 A;  4GKJ T;  4H9O C;  2JQ9 A;  3LJC A;  3PV0 F;  2PTF A;  4DR2 T;  2FJD A;  2IHR 1;  2L8K A;  4AQY T;  1FJG T;  4U2Y A;  5JDL A;  3BQK A;  4HFB A;  3WAJ A;  4EOZ B;  4L5G A;  3AEF A;  2CB9 A;  4HWI B;  1IBK T;  4NPP A;  3NRX A;  3P4Q A;  3LFM A;  5H6Q B;  1WFD A;  4JI5 T;  2VKD A;  5AQP B;  4WW0 A;  4WZX A;  2HPJ A;  3PDY A;  1KK7 A;  3F31 A;  4UV8 B;  4PW8 A;  2DCF A;  2H7O A;  3K8P C;  3RC8 A;  4CI1 B;  1M7K A;  5ETW A;  5L3E B;  2FBW A;  3LK3 B;  1QSD A;  2JRK A;  3R6N A;  4L9I A;  4QX7 B;  1XMO T;  2KWI B;  4MFR A;  5LGT B;  4YTM A;  2WAU A;  1R2A A;  1NEN A;  4CN1 A;  4TNV A;  4IDO A;  2H7V C;  1H7C A;  3LDQ B;  3KV6 A;  3ZN0 B;  4NUV A;  1JNZ A;  2B76 A;  2MTQ A;  3S4A A;  4UIG A;  2E9X B;  2I0M A;  4YY3 T;  2WU2 A;  3KVB A;  4A97 A;  2HN1 A;  4IE4 A;  4IRE A;  2EHO D;  5CJ5 A;  4JYA T;  1IJ6 A;  1VCS A;  4TWH A;  2C5I T;  1XWM A;  4EXT A;  4UXN B;  5HEJ A;  2RQY A;  2PJQ A;  5J2T E;  2ZM8 A;  3GA8 A;  3UQ7 A;  1T72 A;  2WMO A;  2BS2 A;  5IWA T;  5HAX A;  4DUZ T;  2UU9 T;  4CI3 B;  2W4X A;  3O4X E;  3CIR A;  2HPL A;  4TN7 B;  3NWI A;  2XQA A;  4ZEY A;  4YTN A;  2D5U A;  3ZMU B;  3C4X A;  2WU5 A;  3UU5 A;  2YK0 A;  5AFU L;  2D0T A;  4A56 A;  2WCA A;  3NZP A;  3FBL A;  1BR0 A;  2BG9 B;  3CX6 B;  1YXR A;  5TAO A;  2E2A A;  1OED E;  1MIY A;  5M4Y A;  2DL1 A;  3UU3 A;  4LF7 T;  5L3D B;  1QLB A;  3JAD A;  1SA0 E;  2V8S V;  2RPA A;  1NAF A;  3CQG B;  4IDN A;  4F9K A;  1U4Q A;  2K48 A;  3KIN B;  3ZT5 A;  1J5W A;  2LRL A;  3X1D A;  4O2A E;  5EK4 A;  2YEV C;  3QUJ A;  1XMQ T;  4Q25 A;  1N33 T;  2V6Y A;  5LGU B;  3ZN1 B;  2G0U A;  4BAY B;  5IYZ E;  4QH5 A;  5HXH A;  4KHZ F;  2J62 A;  5LBQ B;  4NIQ A;  1US7 B;  3IM4 A;  3ONX A;  2Y6X A;  2XQ9 A;  4QH4 A;  2H88 A;  4DV3 T;  5ABE A;  3AXJ B;  3B13 A;  3TLV A;  1YQ3 A;  4PFO A;  3ZC0 A;  1MNE A;  5LHG B;  4AI6 A;  4KP3 C;  4GYS A;  4QXH B;  5LA6 E;  1Z8U A;  2L9Q A;  1N32 T;  3HR0 A;  4I4T E;  4E7S A;  5AQI B;  4Z8X A;  3AE4 A;  4CI2 B;  2X9W A;  1KF6 A;  4OYJ A;  5AQN B;  3QDE A;  2D9D A;  3ZYL A;  4DVD A;  4NUU A;  2JQK A;  1LVK A;  1D1A A;  4IDQ A;  1LKX A;  2XQ5 A;  1UGO A;  3ZCJ A;  4ZZB A;  2XQ4 A;  3PUG A;  3ABV A;  2K5B B;  3PUS A;  3NZQ A;  2YDS A;  3VU7 H;  5AQO B;  3F57 A;  2VK9 A;  3ZC1 A;  5L3B B;  4DV2 T;  3HKD E;  3NBX X;  1WLX A;  4KMC A;  3ZMS B;  3CQC B;  5LHI B;  2CA5 A;  2LHN A;  3LK2 B;  4AQF C;  3JC6 C;  3B57 A;  3P8C D;  5F8P A;  2F4V T;  3UU4 A;  4MLK A;  1MMD A;  4U31 A;  4PJJ A;  3G06 A;  2XAJ B;  4UV9 B;  2VQE T;  4A5X A;  2CQS A;  2CLY C; 
#chains in the Genus database with same CATH homology
 2XQY A;  5LJM A;  3IHR A;  2MYS A;  3C4W A;  5LCY A;  2SPC A;  5FY1 A;  3ETV A;  3BQI A;  3KBT A;  1FIO A;  3N2O A;  3ESL A;  2Y48 B;  2XHE B;  3RKO A;  3UT5 E;  2BDE A;  3EDV A;  3HI2 A;  4HE8 A;  3ZEF B;  4O4I E;  3ZYK A;  4XAX B;  3UUM A;  4IE6 A;  4UEM A;  3QC9 A;  4ASK A;  5C8Y E;  5FY0 A;  1IJ5 A;  4YLH A;  2KMF A;  3U78 A;  5HWY A;  1YD8 G;  4H9S E;  4ADZ A;  4H9P C;  3MAC A;  2RA1 A;  3OJA A;  4O8S A;  2DI4 A;  3Q5W A;  4WBN E;  2YU2 A;  4ZS3 A;  1OWA A;  3C98 B;  3P7I A;  3SWH A;  5LG4 A;  3AA1 B;  4PAG A;  5L2L A;  4BJN A;  4C90 A;  2Q9Q D;  4GOU A;  4IHJ E;  3I9Y A;  4F6R C;  4AKG A;  5LJN A;  3V5S A;  5KMG P;  3WI3 A;  2IAK A;  2VAS A;  2N9D A;  4JEU B;  5LOV E;  1E1H B;  1ZV4 X;  2LE8 A;  4DMV A;  4MHC A;  2QGS A;  3HKB E;  5JR9 A;  1OXZ A;  1WYC A;  5FNV E;  4ZHQ E;  4M1P A;  1MIW A;  2WMN A;  2CXF A;  3N2K E;  4CXW A;  1QUU A;  1B7T A;  2E8I A;  2WSS V;  2X0L B;  4BJM A;  3L09 A;  3SRZ A;  1YKE B;  4H9O C;  3LJC A;  4IGU A;  2MBG A;  1MMG A;  3FB2 A;  2DWK A;  3ANW B;  2CXL A;  2L8K A;  4PJN A;  5J1G A;  3PUA A;  3IBP A;  2CCQ A;  3V5U A;  5BMV E;  2A2F X;  5JDL A;  2WBL A;  3BQK A;  3ZMT B;  5FXZ A;  2LT3 A;  4MBQ A;  3WAJ A;  2OA5 A;  4EOZ B;  3C51 A;  4L5G A;  2KLQ A;  5JVD E;  2CB9 A;  2VWA A;  1AJ3 A;  4PJL A;  4TZ4 C;  2KXP B;  2X68 A;  4GK0 E;  2E9X C;  3LBX B;  1HCI A;  3NRX A;  2H3R A;  2NW8 A;  3PU3 A;  4AKI A;  1ZKE A;  3LFM A;  1X79 A;  5H6Q B;  3SOL A;  3NRY A;  3AA6 B;  4I55 E;  4JEH B;  2VKD A;  1G8X A;  5HXC A;  2X9H A;  4WW0 A;  3O9X A;  3WAK A;  4DO0 A;  4CXY A;  2KZ7 B;  4AKR B;  2HPJ A;  4CXX A;  3PDY A;  3RPU A;  2V7J A;  1KK7 A;  3N5L A;  4YJ3 E;  3F31 A;  4UV8 B;  4QXC B;  2BVM A;  4O4L E;  4PW8 A;  2DCF A;  2H7O A;  2EHO B;  1KNZ A;  2KND A;  3K8P C;  3RC8 A;  3I1A A;  2XUE A;  3FBZ A;  4CI1 B;  4U74 A;  2C5K T;  3IEE A;  3I0Q A;  5ETW A;  3VHL A;  5L3E B;  1BR2 A;  3HA4 A;  4GK5 E;  3LK3 B;  4H63 H;  3KV4 A;  1QSD A;  4ZI2 D;  2JRK A;  3AA0 B;  3R6N A;  3N9Q A;  4L9I A;  4QX7 B;  1FMW A;  2V7M A;  2XTL A;  3N9N A;  2KWI B;  4AXP A;  3JC6 D;  5CA0 E;  5DJQ C;  4MFR A;  5LGT B;  5F3J A;  2Y8D A;  4PJM A;  2WAU A;  5DAB A;  3MA9 A;  3ZJ1 A;  3UUX B;  2PBI A;  3K3O A;  4AKL A;  4WNK A;  4J2C A;  1HG2 A;  3M65 A;  4ZI3 D;  5L3C B;  2H7V C;  1O3X A;  2VKJ A;  3AAE B;  3GN5 A;  3N9O A;  4UVB B;  5JDF A;  2NTY A;  2X9Y A;  3T8O A;  2A72 A;  2W00 A;  1H7C A;  1D1C A;  2Q9Q A;  3CML A;  3KV6 A;  4H9R C;  4WBO A;  3ZN0 B;  4NUV A;  1VRB A;  3K3Q C;  2NP9 A;  2W0G A;  4HKA A;  5EZY E;  4EAH A;  4P0B A;  2MTQ A;  3MJX A;  1UX4 A;  2JMK A;  2ZM0 A;  3KV5 A;  2V1D B;  4UIG A;  3RC3 A;  2E9X B;  2CM0 A;  2Z6E A;  5EK3 A;  4HTE A;  2W63 A;  2WWU A;  3H3A A;  1D0X A;  1FEW A;  3N9P A;  4YJ2 E;  5JR9 B;  3KVB A;  2EHO C;  3FXE B;  3K3N A;  4UF0 A;  4IE4 A;  1D1B A;  4EYY R;  4ZI7 E;  4TV9 E;  4ILU A;  4DBR A;  3RX6 A;  2LSI A;  3KFW X;  2EHO D;  4I43 B;  3S4U A;  4QX8 B;  2LJL A;  1IJ6 A;  4IIJ E;  2K9A A;  5J2U E;  2CWY A;  3AA7 B;  2OUT A;  3AAI A;  2C5I T;  3CX8 B;  3RRW A;  4EZH A;  3O1I A;  4EXT A;  4UXN B;  4TX5 A;  4X1K E;  5JH7 E;  1BR4 A;  2RQY A;  4ZOL E;  2PJQ A;  3C64 A;  5FYM A;  1Y64 B;  5J2T E;  1CUN A;  2XAS B;  3MKD A;  4E7Z A;  5LNK A;  4IST A;  2ODU A;  2XAH B;  5EK2 A;  2L3L A;  4ZS2 A;  3OYZ A;  5JRE A;  2ZM8 A;  3EDU A;  3GA8 A;  3LK4 2;  3ZLI A;  3Q5X A;  5DQV A;  1ZEE A;  4XZC A;  4IDZ A;  4CQI A;  4HN9 A;  3AVR A;  2CE7 A;  4V1A v;  2WMO A;  5JRC A;  2ZMA A;  4H63 V;  4DND A;  5HAX A;  3RYI E;  4B6X A;  1FMV A;  2N1G A;  2UXN B;  5FP3 A;  4IE0 A;  2W62 A;  4CI3 B;  3HL6 A;  4H9N C;  2V26 A;  5CA1 E;  3O4X E;  5FXW A;  3RH3 A;  3KDS E;  1HTJ F;  3N9L A;  4UVC B;  2HPL A;  3VKG A;  3LG7 A;  4TN7 B;  1EZ3 A;  2E9X D;  5JR9 C;  3UUN A;  1LVF A;  1D0Y A;  2DLR A;  3GWH A;  2KNG A;  2IC6 A;  4G2A A;  2IC9 A;  2V7K A;  3OBV E;  1G73 A;  4EZ4 A;  3CWZ B;  2P9B A;  3CQX C;  4QWN B;  4AQF A;  3RYF E;  4GYR A;  2CMR A;  2LOS A;  5HYA A;  2D5U A;  2JMH A;  3ZMU B;  3A5X A;  3OKQ A;  3C4X A;  2ES0 A;  2K24 A;  2GK9 A;  3E0Z A;  2KIN B;  2DNX A;  3H37 A;  4YFS A;  5HXS A;  2YK0 A;  5AFU L;  2D0T A;  3ZJ2 A;  1ZHC A;  4A56 A;  4PK5 A;  3N2G E;  2N2N A;  3NZP A;  3FBL A;  4KUM B;  1BR0 A;  4ISS A;  3CX6 B;  3GN5 B;  3CVR A;  2X67 A;  3E08 A;  1S35 A;  5LBM A;  5FXV A;  5TAO A;  2Q9Q B;  1MIY A;  4PK6 A;  2NTX A;  3AAA B;  2LOP A;  5M4Y A;  2V7L A;  1MMN A;  4O4J E;  2C0S A;  5L3D B;  1LRZ A;  1HFA A;  4X20 E;  3CPZ A;  1SA0 E;  2CLY C;  3R84 B;  1NAF A;  3CQG B;  1BR1 A;  1UX5 A;  4MAL A;  3DTO A;  3N9M A;  2CXD A;  3E22 E;  3FXD B;  3ZYM A;  1U4Q A;  2K48 A;  3KIN B;  4L0R A;  4X1Y E;  5FY7 A;  4DBQ A;  2CBG A;  4UF0 B;  5JDQ A;  2JJ9 A;  2JQQ A;  4O2A E;  5EK4 A;  4AKH A;  2YEV C;  3QUJ A;  5FMN A;  4ANJ A;  3F2E A;  1YKH B;  2LSY A;  5LGU B;  3ZN1 B;  4P0A A;  2XAQ B;  2X66 A;  2G0U A;  4TV8 E;  2NW9 A;  4BAY B;  5LGN B;  5IYZ E;  4GIW A;  4IE5 A;  4O2B E;  5HXH A;  1NWM X;  2PFV A;  4OFZ A;  4I50 E;  1HG5 A;  5DQW A;  1HF8 A;  5KX5 E;  3PE0 A;  5LBQ B;  4PNI A;  3ZMV B;  5ADX L;  4IE7 A;  1US7 B;  5L3G B;  1WYB A;  5LYJ E;  3O1H A;  3ZMZ B;  1MMA A;  3UUL A;  4X1I E;  3ONX A;  2Y6X A;  3FHN A;  5LHH B;  2A3D A;  4N78 D;  2CEA A;  1YW0 A;  2D0U A;  4EIW A;  4EYU A;  3SS1 A;  4U72 A;  4TUY E;  3KBU A;  3Q9D A;  5JDN A;  5L3F B;  2ACX A;  3J7Y q;  5JRC B;  4AQG A;  2LSK A;  2Q9Q C;  3HKC E;  3W15 B;  2XAF B;  3RYC E;  4QKN A;  1HX8 A;  3B13 A;  5FXX A;  1S94 A;  2XAG B;  2BVL A;  4PFO A;  3ZC0 A;  1MNE A;  2E9X A;  4YHJ A;  5LHG B;  2B1E A;  2QA7 A;  3AVS A;  2KT9 A;  2VKH A;  4AI6 A;  4HFV A;  4KP3 C;  4UVA B;  2YIN A;  4G63 A;  4GYS A;  4QXH B;  3J9X 1;  5A1L A;  1MND A;  4JLE A;  5LA6 E;  2L9Q A;  2BZB A;  3KV9 A;  3HR0 A;  4I4T E;  4E7S A;  2UXX B;  2DHR A;  4OHF A;  1WR6 A;  5HXR A;  3IF8 B;  5LXT E;  5KDM C;  3EUH A;  3O1J A;  4Z8X A;  4XBF B;  3UFE A;  4CI2 B;  2X9W A;  4BA9 A;  3VKH A;  3KVA A;  3OYX A;  4OYJ A;  3I0O A;  3TKL B;  3L3P A;  3ZYL A;  4PFP A;  2M67 A;  5H6R B;  4P09 A;  2VKO A;  3DP7 A;  4FJO A;  3ZPO A;  4DVD A;  2C5J A;  2ZLY A;  1VOM A;  1T98 A;  4ERR A;  4KBM B;  4K0U A;  4NUU A;  2W61 A;  2IW5 B;  1IAP A;  2WM9 A;  1LVK A;  2NOX A;  1D1A A;  3U3I A;  1LKX A;  4O4H E;  1MIV A;  2YU1 A;  2RP4 A;  2CLY B;  3ANW A;  2VB6 A;  2D2S A;  2JPF A;  1UCU A;  3Q2M A;  3ZCJ A;  2J1D G;  4FI5 A;  3UTK A;  3PUG A;  2K5B B;  3DJB A;  3PUS A;  2CWO A;  4UEL A;  2ODV A;  4EB6 E;  3NZQ A;  2PG8 A;  1V9D A;  2ZM2 A;  3EVY A;  5JDM A;  1WRD A;  3ETU A;  4HGA A;  5HXE A;  3MXZ A;  2X9X A;  3CKD A;  2NW7 A;  4QHO A;  3VU7 H;  4HEA A;  3F57 A;  4OK0 A;  3LBX A;  2VK9 A;  3MK7 C;  3ZC1 A;  3GMI A;  4DMW A;  5L3B B;  3PMI A;  3HKE E;  3HKD E;  4H9Q C;  3NBX X;  3RYH E;  1WLX A;  3MZK B;  5HWX A;  3D0T A;  3I9W A;  3BK9 A;  3C50 A;  4KMC A;  4ZI2 C;  5IHY A;  3CQC B;  2CA5 A;  2I59 A;  3ZMS B;  3RRC A;  2LHN A;  4C91 A;  5LHI B;  1HS7 A;  3LK2 B;  5CB4 E;  4AQF C;  2LM9 A;  3CX7 B;  1IZN B;  3PU8 A;  3BQL A;  3JC6 C;  5GON E;  3B57 A;  4CZZ B;  1U5P A;  5JDH A;  5JDG A;  1Z0P A;  4PK4 A;  3P8C D;  2EHO A;  2MOZ A;  2X51 A;  3C4Z A;  5E0O A;  3PTR B;  4QXB B;  3ZCI A;  2VL8 A;  4OYK A;  2HH7 A;  2LEH A;  5F8P A;  2K9Q A;  3PUQ A;  1MMD A;  2LSG A;  4MLK A;  3AB3 B;  3QK6 A;  4ZI3 C;  2KWH A;  4JUY A;  4PJJ A;  5JQG E;  1SHZ C;  2NWB A;  3PUR A;  2LSJ A;  2XAJ B;  4UV9 B;  2V7I A;  1D0Z A;  5LP6 E;  2DWG A;  2LHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...