2K9QA

Solution nmr structure of hth_xre family transcriptional regulator bt_p548217 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr244.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
MELSNELKVERIRLSLTAKSVAEEMGISRQQLCNIEQSETAPVVVKYIAFLRSKGVDLNALFDRIIVNKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Solution NMR structure of HTH_XRE family transcriptional regulator BT_p548217 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR244.
rcsb
source organism Bacteroides thetaiotaomicron
total genus 21
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2k9qA01
1.20.890.80 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2k9qA02
2HDDA 3CCYA 4IHWA 2JA7J 1FEXA 2VKEA 1POGA 1K61A 1IJWC 1YRNA 2L7FP 5FLVA 1ZR2A 2WAQN 1G2HA 4J19A 3BTLA 3BR0A 1JJ6C 2O8KA 1UHSA 2ECCA 4AUXA 5M5YJ 4X6AJ 2DA1A 5DS9A 2LLKA 2JA8J 2B63J 3F0CA 2CRGA 3FK6A 1HCRA 5K7HA 1OCTC 2CQXA 5EGOA 2M34A 1Z77A 5GPAA 2EZIA 3BTJA 1D5YA 4FISA 4A3FJ 5BNGA 2G0EA 4JYKA 3S1MJ 2ME0A 1NTCA 5JLXA 2GM4A 2HOTA 3NAUA 3BQYA 3FISA 3HOWJ 4XRSG 3ZQHA 4LOCA 4DW6A 5J1RA 4D7NA 5EG0B 1W0TA 4B3AA 1PUFB 1BA5A 2CUFA 3SDGA 1MBHA 2HXIA 1H89C 1MBKA 2L9RA 1IDZA 1TWCJ 4JX4A 5FKNA 1CQTA 2KDZA 3Q0UA 2LVSA 4Y7NJ 3BTIA 4MLOA 4C3JJ 1AU7A 3K2AA 1R9TJ 1JTYA 1TWAJ 1JUSA 1GDTA 5F0FA 3RQIA 2DA3A 1JGGA 3TW7A 3BG5A 2EZHA 2XGCA 2LP0A 3I4NJ 4IHVA 3BR5A 1GV2A 9ANTA 1QPIA 1UG2A 1ETKA 4V2FA 3JRDA 2M0CA 5FKMA 3D1NI 4MFEA 3HGYA 3CDLA 5FKOA 4IHXA 5FLMJ 3GTJJ 3HOXJ 4XRSA 3LOCA 1LFUP 5GP9A 2ECBA 3HGGA 3GTOJ 2DA4A 3LSPA 1JKPC 4BBSJ 2ID3A 1RETA 1QVTA 2EBIA 1RESA 2XB5A 4S0HB 3SFIA 1ZQ3P 2HYJA 1MBEA 3RZOJ 3SJMA 2H1KA 1VF9A 1MH3A 1B72A 1JTXA 3JRHA 2E2JJ 2R5ZA 1E3OC 2ELKA 3G1MA 2EZKA 1WI3A 1WCMJ 2YUSA 4A3IJ 3L1PA 1JUMA 4D7MA 3S1NJ 1LE8A 3IH4A 1FJLA 5IP9J 1T56A 3JREA 4UUTA 2WB1N 4UUSB 3K7AJ 2EH3A 3BQZA 4AC0A 2L7ZA 3B6CA 2FX0A 5FKKA 3H3VK 4C3IJ 3TEDA 1ZTRA 4A3CJ 4BKXA 3LSGA 4IEJA 3MN2A 4XRMA 2LKXA 3JRIA 2M2EA 2DA2A 2LR8A 2XB0X 1FTTA 5C4JJ 1EF4A 3FIWA 4A3LJ 2M8GX 3QPLA 4M3FA 4CYCA 3I4MJ 2DMNA 2NVTJ 1IG7A 4A3GJ 2JK3A 2R7ZJ 5IYDJ 3B6AA 1MNMC 3FKIJ 3OSFA 1MSEC 1AKHA 2QCOA 2HOSA 4FE4A 3ZQCA 2Y0SN 2XGDA 1UMQA 3FK7A 2AO9A 4C3HJ 5M3MJ 4I6ZA 1Z0XA 1IUFA 4M3GA 2XPWA 5F1JA 4MO7A 2VPRA 3HDDA 2HQ5A 3GTMJ 5J1UA 1RR7A 3TP0A 2K40A 4D5FA 3JR9A 1B8IB 1Q1VA 1RKWA 4FE7A 3WHBA 5FJ8J 3W6VA 1WGXA 5F08A 4XICA 1BW6A 2E1OA 4DYCA 2YS9A 1XS9A 2K9SA 2R5YA 2NS7A 1K83J 4XIDA 5EEAA 3ZQFA 2CUEA 2MGQA 2LTPA 2ID6A 3HB9A 4B1RA 3HOUJ 2HI3A 3S14J 3HOVJ 3CMYA 1S7EA 1GUUA 1WH5A 2FJ1A 2X9DA 4RBOA 5F27A 2XPVA 3Q3SA 4RDUA 2Y31A 1ITYA 3JRAA 4BY7J 1DU0A 3BG9A 2DJNA 2NOGA 3IV5A 1F36A 3JRGA 4DYRA 2R5ZB 1ZGWA 5EYRA 1I50J 2KT0A 4MIMA 2LK2A 4ABZA 1ETWA 1IDYA 2VKVA 5M5XJ 1LE8B 1HDDC 2CJJA 2JJ7A 3ZOBA 1X2NA 2K9QA 2ZB9A 1A6IA 1HDPA 3CQZJ 2IEKA 4W97A 1T33A 3MKLA 5J1YA 4EEFG 3BR2A 2R93J 2WV1A 5FKLA 2I10A 2JMWA 3QQAA 5IP6A 2W48A 4A3DJ 3DCFA 1OFCX 3A01A 1BL0A 2HOAA 3RKQA 2DMTA 2X48A 1PUFA 1QRYA 3OIOA 5EDNA 3JRBA 1ETXA 2K9NA 3GTPJ 1U9NA 1ETYA 4L5EA 1RPWA 2DA6A 4CYCB 2D5VA 1TC3C 1YRNB 5M3FJ 1HLVA 2DMPA 3O8GA 3G1OA 2M9HA 1NK3P 4NDLA 4M3EA 3LSRA 1F43A 1RKTA 4JX6A 1JUPA 1QVUA 4XK4A 5IYBJ 4JP0A 1TWFJ 1X58A 5C44J 1APLC 1U8BA 4FTHA 2E19A 1GV5A 1MSFC 3S1QJ 2VI6A 3BT9A 2R0QC 3S15J 5EGOB 3BR1A 5J3LA 2LD5A 1JKQC 2EZLA 3DEWA 2O7OA 1A5JA 2N8GA 1HF0A 2DN0A 1ENHA 4A93J 1ETOA 3NARA 3S1RJ 4GFBA 1SANA 1U9OA 5IOYA 2Y9YA 5C4XJ 2GLOA 1P7JA 4C2MJ 2MSYA 1JT0A 5HODA 2NVYJ 3PO3J 4QIWN 3QPSA 2EQRA 2ME6A 2R92J 1IC8A 3S17J 1MH4A 3S2DJ 4MFDA 3HM5A 3BR6A 2MG4A 4A69C 1BJZA 1AHDP 3JRCA 5IPAA 5F0CA 3BTCA 4M6VA 2X6OA 2XSDC 2JA6J 3ZQIA 1O4XA 1I6HJ 2DA5A 1FIAA 1TWHJ 2XGEA 3ZQGA 5EZHA 2DA7A 5E3MA 1HOMA 2COBA 2YU9J 1BW5A 4DZJA 3H0GJ 1IV6A 1FIPA 3HKZN 2H8RA 1I3QJ 5E3LA 4DZPA 5IYCJ 4X1EA 2QF7A 4UUSA 1TWGJ 2O9LA 3IH3A 1XG1A 5M5WJ 5E3NA 2DTZA 4M3DA 4IHYA 3PO2J 3M4OJ 2NS8A 3LNQA 3TP3A 3IH2A 4HNVA 2JA5J 4A3EJ 1VFCA 2TRTA 2DMQA 3A01B 3RZDJ 3E7LA 3GTQJ 3UKGA 4FCYA 4B4CA 1B72B 3S2HJ 1P7IA 4G12A 1W0UA 2DMUA 3GBGA 5DTDA 2OPTA 3G1LA 2FD5A 2LY9A 1ETQA 1ZK8A 4BY1J 3Q0VA 2OF7A 3HOYJ 3TW6A 4BBRJ 2Y30A 2NVXJ 2P81A 3A03A 3C2BA 4M3BA 1VNDA 2LFBA 1OCPA 1FTZA 4I76A 1ZR4A 5K7FA 1WH7A 4Y52J 5JLWA 2CU7A 3O8HA 2L0KA 4QSHA 1GVDA 4V2GA 4A3JJ 3GTGJ 1B8IA 3OSGA 1H8AC 5EG0A 2MW8A 3OOUA 2NVQJ 4DYQA 2PMZN 3S16J 3HOZJ 2TCTA 1JT6A 5EF6A 3JRFA 2JN6A 2IBDA 2E2HJ 2IAIA 1MBJA 1JJ8C 1ORKA 1IRZA 2L7MP 3BG3A 3WHCA 1IGNA 1AKHB 2CQQA 1GT0C 4A3KJ 5F04A 3LSJA 1JKRC 5E3OA 3A02A 2VUMJ 4W1UA 1ETVA 3HBLA 4A3BJ 4D5CA 1MBGA 3PM1A 2RAEA 5IOZA 1Y1WJ 3MVPA 1VI0A 2GBYA 1XC5A 5K7ZA 1Y1VJ 2HXOA 1U78A 3M3YJ 1MBFA 5GPCA 1H88C 1SFOJ 1DU6A 5IP7J 2XRLA 4QTRA 3VPRA 3HEFA 3GTLJ 2FQ4A 3Q0WA 4A3MJ 5F0HA 1X2MA 3GTKJ 2JWTA 1LFBA 2Y9ZA 4BXXJ 1ZKGA 2Y2ZA 3ZQLA 1JKOC 1WPKA 5EZGA 2R5YB 2XPUA 3BR3A 1OJLA 2E2IJ 1NK2P 4AYBN 4JX5A 5C3EJ 2AHQA
chains in the Genus database with same CATH superfamily
3CCYA 1FEXA 1BI1A 2V6CA 4B09A 1K61A 3GX4X 2TDXA 2RDPA 5FLVA 3HYIA 2XROA 4HAMA 4EV0A 2FA5A 1OYYA 4HPQA 1G2HA 3FXJA 5E1XA 2QQ8A 3JSPA 5LHHA 5TISC 3TDZC 3OYGA 4B3XA 2DA1A 2DK5A 3N4MA 1W7PA 2CH0A 2QBYA 3F0CA 3SZGA 2DW4A 3V7CA 3OYBA 3ELKA 2GOMA 1XPXA 1OCTC 4RAYA 3OYNA 4U88A 1RC9A 1V54H 4UB6C 4AIHA 2DDAA 5KAIC 2ZJ2A 2G0EA 4JYKA 5E1WA 1B6AA 2HNHA 1G3TA 2HOTA 3NAUA 2CBGA 2K5CA 3OS0A 3CC7I 2BW3B 3WGGA 5B3SH 5EG0B 2XRNA 1W0TA 2LRDA 5ICFA 1BA5A 3PIOF 1QHGA 2IA1A 3SDGA 3F6VA 3F23A 1H89C 2L9RA 1TWCJ 5FB2A 2W24A 2K4JA 2W4SA 3WTSC 1DPRA 2BZTA 4JX4A 2P6SA 4OWRB 4II3A 4HF1A 4HDUA 3H35A 2BY0A 3WTUC 2KDZA 3OYLA 3HC7A 1WWXA 1AU7A 1TZLA 1Z1DA 3K2AA 1G4DA 1SD7A 1YQAA 5GADJ 3K1MA 1YYVA 2BEOA 2EZHA 1SAUA 2Y0MA 3HXLA 3CDIA 1XDSA 1STZA 1ZGJA 2E1NA 1IRGA 1J0RA 3BR5A 3RPQA 9ANTA 4HX7A 3JRDA 2M0CA 1G59A 5FKMA 1I39A 2RQPA 3MKWB 3E5XA 4CYDA 2AS5F 1YJWI 1KU2A 1C0WA 4B44A 2R7SA 2IS6A 4LLGF 1LFUP 1S29A 2ECBA 3HGGA 3GTOJ 4II2A 4F91B 3A2KA 1JKPC 3HG9A 4N4OB 3AFHA 3E6CC 3HTSB 3J81K 2GXAA 3DBLB 4S0HB 1MBEA 3RZOJ 1LVAA 3BWGA 3J7ZI 3FXUA 1MH3A 5HS9A 5HLTA 3MMYB 1JTXA 2GOXB 3JRHA 5ILUA 2GXGA 1ZN2A 2E5NA 2EZKA 5KNLA 2HDCA 3L1PA 4RAFA 3S4DA 1V55H 4XQFA 1BN5A 3TO7A 3S1NJ 1FJLA 1U6GA 2OZ6A 3GWZA 4MTDA 5D5WB 1BJAA 2IGNA 4UUSB 2DT6A 3K7AJ 3BQZA 4U0VA 4AC0A 3L2WA 2FX0A 3JTGA 3WG7H 2DFFA 5LGUA 1WQ2A 2ZC2A 4C3IJ 3IRRA 3TEDA 1D1BA 4CCNA 5D6EA 4A3CJ 2DXIA 2EV0A 3BJOA 2FSWA 5JI6A 2R7XA 4RGSA 1S8NA 2VBZA 4MGRA 4XRMA 4M73A 2LKXA 2VPLA 1T38A 1HSTA 2M2EA 2P0WA 5C4JJ 3FIWA 1XN7A 3COAC 2DMNA 1T95A 3U9GA 2M30A 4A3GJ 1U3EM 2JK3A 4I0AA 1WFXA 2CQNA 5IYDJ 1IN6A 1Z6TA 2CMPA 3P9IA 1PP8F 1MSEC 1WJ5A 3C7JA 4OMZA 4M9XA 2ZJRF 3ESWB 3ZQCA 3F21A 1UAAA 1BIAA 2V6EA 3HSRA 4XLCA 5M3MJ 1Z3XA 5E8IA 5CKTA 3CCLI 3OR1C 1Z0XA 2H09A 2L5QA 4M3GA 2VJ4A 3HDDA 1ODDA 3BLYA 4A5NA 3GTMJ 5J1UA 1KU9A 3G4SI 1PUEE 3LMMA 3TP0A 1LEAA 5E20A 1NG7A 2EPFA 3GVAA 1RIOH 1Z6RA 2WTEA 3H92A 3FMQA 2JZYA 2LY2A 5D5UB 2PN6A 3E3VA 1O3SA 1ZYRF 2XGXA 3FX3A 3W6VA 4MQVA 2VBXA 5KVRA 2O03A 4ESFA 2WC2A 4ZH4F 1CF7A 3PL8A 4PFPA 2DCEA 5D4RA 3FWEA 1BC7C 2R4GA 1R49A 2E1OA 1R6RA 1XS9A 4AWXB 1LDJA 3H9JA 2EFPA 1K83J 5EEAA 5GAEJ 2R7QA 2MGQA 1W4MA 1IF1A 3L2UA 2LTPA 6PAXA 4NBQA 3W3CA 3I3LA 3N97A 1GUUA 2HVSA 3LA3A 2ISYA 5FRNA 2D1VA 2CW8A 2KIFA 3GZ6A 2XPVA 3DTKA 3O3KA 3RQ4A 3Q3SA 4XRFA 4FASD 2Z5UA 3IWZA 4BY7J 4RAZA 3BG9A 2V1UA 4DYRA 1OR7C 4OIOF 4PJ0C 1AOYA 3IHUA 1ZARA 1IW7F 2M8EA 3U1DA 1FPQA 4ENMA 2FF4A 2UZKA 2A5YB 5M5XJ 1WJDA 2JT1A 2PMHA 5J8CA 1W7PD 1HDPA 3K70C 3CQZJ 1T33A 2D1HA 4EEFG 1MMAA 3SQNA 4CZCA 1LJ9A 2VQHA 1P4WA 4DOZA 4HZFA 1WJBA 2W85A 3T0YA 1S9HA 2HOAA 1B9MA 4LITA 1P2FA 4B48A 1K79A 1T98A 4S04A 1X3UA 5CJ9A 1XGNA 3U1KA 4ANJA 1Z05A 3MKZA 1SFKA 4L5EA 1KGSA 4AM3A 4LB6B 1DGWY 1HW5A 1R00A 2ZFUA 3FF5A 3EDPA 3KEOA 2OV7A 4ZYDA 4IKFA 4ITVA 2KIUA 3L7WA 1RKTA 1U5TC 2FNAA 1QVUA 4HA8A 3CESA 2EFQA 4XSXF 2E36A 2VC0A 2E19A 1GV5A 2QBYB 3S1QJ 3I53A 3BT9A 2R0QC 2B9SA 2A6TA 3BR1A 3GFJA 3I54A 4MNUA 5J3LA 2LD5A 5F64A 4S05A 5K5OA 1IN7A 2O7OA 3W6KB 1J7KA 3S4AA 4NNJA 3B02A 4B8XA 2P5LC 1LDDA 4PK4A 2KP6A 4GFBA 1AA7A 3KE2A 3PQJA 4KISA 3K4BA 3AG4H 5C4XJ 1FX7A 2J5OA 2NNYA 4XMYA 2NVYJ 2M7AA 4QIWN 2PI0A 5HDNA 3QPSA 4HYEA 3DQVC 2EQRA 1XMXA 2ME6A 5ICGA 1MH4A 1D8KA 4KICA 2XAHA 4DJAA 2W00A 3JRCA 4XONA 2UXXA 3FXKA 1TQPA 4M6VA 2XSDC 4YFNF 3J7AY 3F6OA 3PSIA 5E8GA 3OYHA 2DA7A 3CP2A 1QQIA 2DI3A 4IOAF 1H9GA 2LKPA 4DZJA 2VT2A 2K85A 4BQQA 1FIPA 2IA0A 2VQCA 1M1EB 5AIPA 3ABUA 5F6FA 2P5KA 1KZHA 3M9AA 1R2AA 4XLEA 2O9LA 2WY7Q 3C3WA 1LVKA 2DLLA 2NS8A 3QODA 3LNQA 1EH7A 2PG4A 3IP4B 1U5TB 4UNOA 4OIRF 1BIBA 2FNPA 4A12A 4IF4A 2OA4A 1U8RA 3ZMSA 4XLPF 3TKYA 3G73A 1ON2A 3L2CA 3QFZA 3FXMA 4NC6A 3J80Z 2CV2A 2H8WA 3K4JA 1ZLJA 1J5YA 2CW0F 1OCOH 3FZVA 4FCYA 2HKOA 4BE2A 3OS1A 2EWNA 1QZEA 3L09A 3BG7A 2ZMEA 1FP2A 2DBBA 2NOJB 3IRQA 4ESJA 1ZK8A 5D5VB 2OF7A 5CVRA 5L3GA 3TW6A 5JHFA 5HLIA 1I1SA 2QQ9A 1FMWA 1DP7P 4YFKF 3QP6A 2DPUA 4JQFA 3G36A 1FTZA 4I76A 2EZWA 3I58A 3IM3A 3GWHA 4GYIA 1YJNI 2WAEA 2CU7A 2V7FA 5IT9Z 3BY6A 3G71I 3DKXA 3OSGA 1B8IA 2PJRB 2UV1A 2BW3A 5EG0A 4AIKA 2MW8A 3OOUA 2OTLI 2A3SA 3S16J 2VE9A 3H3UA 5HDGA 2BY2A 1D8JA 2IAIA 1JJ8C 4A0YA 4E4HA 1ORKA 4P96A 3U2RA 3LAPA 3KYCB 4I2OA 2P6TA 5H2FC 2BE5F 1X3ZB 4HNTA 4QWQA 3BCAA 4FX4A 3KLNA 1Z67A 4IXAA 4G8XA 4CCMA 2KHMA 3H1CA 4L18B 5F04A 5ILSA 4N4NB 4PCQA 3LSJA 4NUBA 5E3OA 5TGTA 1ETVA 1W36C 1LB2A 3DF8A 3LSTA 3HZJA 3RSYA 1Y1WJ 3MVPA 2GBYA 4EJUA 1JE8A 1R4NB 2MC4A 1J09A 1X1DA 2M87A 2PX9A 3HKZA 2QA4I 1H88C 2V9PA 4XLFA 2V9VA 2RNGA 2RC4A 1K4TA 4QTRA 1A6QA 2QWWA 1LFBA 3CMAI 4BXXJ 3ZP5A 4AU7A 3S3NA 4J00A 2JSCA 3CMMA 1J75A 3BR3A 2EIMH 1YJ9I 1ZRFA 1MKMA 1WRJA 4CICA 3S8PA 2FMYA 2R7OA 5DDGA 2EK5A 2E2IJ 2R3SA 1VTNC 1W36D 5HVZA 1FC3A 1XSVA 3WTXC 5C3EJ 2HDDA 3BPVA 3PNTA 2EB7A 2XDVA 2JA7J 4BUPA 4HG2A 4HNUA 1IJWC 2XF5A 2BY1A 4LLNA 3CMEI 2RREA 2L7KA 2OBPA 3BCBA 1VQMI 3SYTA 1FOKA 2LYCA 4EJWA 2VASA 5CVVA 3R60A 4I7HA 1JJ6C 3OYJA 1UHSA 2ECCA 5DS9A 3TMOA 1V4RA 2HR3A 1L3LA 5EEHA 3MD2A 3ZQ7A 2LF8A 3IKTA 1XGMA 2CRGA 4E7IA 3FK6A 5K7HA 1JI8A 2HTJA 1YTYA 2CQXA 4XLNF 5EGOA 2RQYA 1O3RA 4IQ4A 2R7DA 3UFEA 4XLHA 2LSOA 4ETSA 3GUDA 4CGZA 1OMIA 1NTCA 5JLXA 2DYSH 5AONA 1X1AA 2OUTA 5IT3A 3FISA 4ZTJA 4XRSG 5BOXA 1P9QC 4LOCA 4CO8A 4HQMA 4YFXF 4BGDA 4B3AA 4KT5C 3OYIA 2CUFA 1IRXA 5L3EA 3DXJF 3HOTA 1QZYA 4XSZF 2RKHA 1IDZA 2DK8A 5DUKA 3NRVA 2IRFG 1BOAA 2MC3A 1GXQA 3VYSB 2FOWA 4BYYA 2DDBA 4P55A 5FKNA 4E70A 1E17A 1YOVB 2W7NA 3CLOA 4Y7NJ 3BTIA 1K4SA 2W82A 2XKOA 2E35A 4I02A 2QYOA 4OIPF 1TWAJ 1SMYF 3QG0A 5F0FA 3R6SA 3RQIA 2MYSA 1GVJA 3P9KA 3CP8A 2XGCA 3G6EI 2OU2A 5HS8A 3I4NJ 1MJ9A 2ZO4A 3IAM2 2O6GE 4IHVA 2L9VA 3R4KA 4RGXA 4EATA 2BXYA 1OYIA 1KA8A 4P1WA 3JSOA 3S3MA 4L5IA 3HSEA 4HX8A 1WZ2A 1IAWA 1O3QA 3FKJA 5FKOA 1T2KA 2ZXWH 4N9HA 2R7WA 2DFIA 3ECHA 2ZMEC 4LIUA 3REOA 2JSPA 5ILVA 1F5TA 4CDGA 3E97A 2YSRA 1IO2A 3DTEA 1LQ1A 1QVTA 1TNSA 2DT5A 1FBQA 2FU4A 3GZNB 3EYIA 2XB5A 4U87A 3ASOH 1QHHD 5BS6A 2HFHA 3QRFF 1IUYA 4I09A 2XUBA 3BJAA 4ON0A 4Y13A 4UV9A 4OIQF 3HRTA 2IS1A 1ZLKA 3F72A 2H1LA 4HV6A 2IJLA 4O6JA 3LAJA 1WI3A 3G1MA 1SMTA 2QEXI 1JUMA 3OS2A 4D7MA 2L4AA 4RMNA 3OR2C 2PMUA 2QENA 3K2ZA 3J7YJ 1FLIA 4G6QA 4EGZA 3GFLA 2QSFX 1VQ7I 2Y0SA 3JREA 2W84A 4E7SA 1X1BA 3DEEA 5E79C 2QLZA 2BVMA 3DV8A 5FKKA 2ZXJA 3KP6A 4RB3C 3S3OA 1IXCA 1YFHA 4M6YA 3BZ6A 5DD4A 3MN2A 2L9SA 5GTHC 3QOPA 2AQFA 2DA2A 2QVOA 3BPXA 3LA7A 4Y33A 3TBIA 5CVJA 4ESBA 1A31A 2HQRA 4XNFA 3JTHA 3ZXSA 3T1BA 4GYGA 2M8GX 3QPLA 4M3FA 4OMYA 5B66C 2NVTJ 2IP2A 2V4JC 3GXOA 3DPTA 4XN3A 3OMYA 2WBMA 3TDUC 2VOOA 3FBIB 2ZMEB 1VQOI 4I99C 2HOSA 2Y0SN 4AVPA 2XGDA 3FK7A 2W25A 4G6DA 2A68F 2P4WA 2C6YA 2P8TA 2F5FA 1H9TA 3BP8A 5F1JA 3SEQA 5LHIA 2HEOA 3QU3A 3V8LA 2MD5A 1WJAA 4A6EA 3HUGA 4BS9A 1BR2A 4D5FA 1ZREA 3G2BA 2WADA 2K7LA 3K1NA 1YITI 1ON1A 1HW2A 2OZUA 2F4OB 4L9VA 1OR7A 3AG3H 5D4SA 1B8IB 4L9JA 1RKWA 4FE7A 2NNNA 5FJ8J 1LNWA 2CUZA 4BXFA 3S4CA 4XICA 4DYCA 4D9JA 2K9SA 2NS7A 3MCZA 2KZGA 3ZQFA 2BOLA 4FHTA 2EV5A 3ULQB 1TT0A 2ID6A 4G6TB 5KK1A 3S14J 4BEHA 3CMYA 2QZ8A 3DBRB 5BPIA 3W2WA 2BY3A 3HHGA 3LL7A 5HOOA 4RBOA 1KYWA 2ESNA 3M8EA 2K27A 4P9FA 3LSIA 3CCVI 2VOPA 1DQUA 1SC7A 4RDUA 1YS7A 3OYCA 2Y31A 1ITYA 1QNTA 3HPHA 3LQRA 2DJNA 3RDIA 3JRGA 2R7VA 2CB9A 4BJ6C 3ACTA 1HQCA 2IT0A 2KT0A 4MIMA 2V1NA 4ABZA 1SVOA 1ETWA 2LBFB 2VKVA 1LE8B 1RNLA 2VXZA 1Z21A 3CJRB 1AWCA 1B59A 2JJ7A 4LIVA 5LRSA 2XF6A 1U5TA 3PFIA 4XKBA 4R79A 3F8BA 2GIVA 2K9QA 2ZB9A 2DPDA 4F92B 4EM1A 3BR2A 3VSKA 2R93J 4PJMA 1IN4A 2LH9A 1VQ4I 2MH9A 5L3BA 4CCJA 4YG2F 1BL0A 1G8XA 4HF0A 3J80K 4XKCA 1TLHB 1YW8A 4PZJA 2DMTA 4HX4A 2CFXA 1UG0A 2UUZA 1QRYA 3JRBA 1S5LC 3F9KA 3EPZA 4WXCA 4BHCA 2K9NA 3FMSA 3EYYA 3F22A 3T8RA 4KDPA 1R1UA 4NC7A 1RPWA 2DA6A 2DTRA 3F8MA 4YELA 3CTAA 3ROUA 1TC3C 4X0GA 2WV0A 3KZIC 4QPOA 1OLTA 5M3FJ 4FETA 2PQ8A 4BE1A 1XMKA 2M9HA 3KEYA 1D3YA 5JHUA 5B5EC 5BQTA 3GW2A 2ISZA 1SD5A 1S7AA 2ACJA 1JUPA 5IYBJ 4ZYEA 4JP0A 4M6XA 1WKMA 1U8BA 4FTHA 1R36A 4L0ZB 3L2RA 4EGYA 2VI6A 2GIZA 2ICWG 3S15J 2QQAA 5EGOB 3H9GA 2X0LA 2PJRA 1RI7A 2AXTC 5CQEA 4WX9A 5DEQA 5CVUA 1FMVA 1UJ8A 2N8GA 3K4NA 2DN0A 3PUFA 3DLAA 1ETOA 1S7OA 3KETA 3S1RJ 2F4IA 1ONVA 1KQ9A 1MNEA 1U9OA 2PBIA 5TJJA 4KIFA 2MSYA 2GA2A 1S72I 2R92J 2V1DA 4IVNA 2KLOA 1SVMA 2HU9A 5E1ZB 4F55A 5IPAA 1YHQI 1AHDP 4YIRX 2E5ZA 4RS8A 1BBYA 5F0CA 4JK1X 2JA6J 2KISA 1FIAA 3EUKL 1TWHJ 3CJQB 4M72A 1VQ6I 3VWBA 1HOMA 3RRSA 2KFDA 3GCMA 4HSRA 2YU9J 1BW5A 4PDKA 1SD4A 2Z2SB 3RKXA 1IV6A 2H8RA 1I3QJ 3RI4A 4UV8A 1FNNA 5IYCJ 1B9NA 3IKVA 4A5MA 3KP5A 3BZKA 3V4GA 3X2QH 1O57A 5M5WJ 4M3DA 3KLOA 4IHYA 4XN0A 1P6RA 1XGOA 3DBHB 3FHZA 1QZZA 3TP3A 4C2TA 1NHAA 3IH2A 3E6BA 4MQ9F 2JA5J 4BQOA 4A3EJ 2LMDA 5HS7A 4M74A 2CQKA 2XHKA 2YX7A 2V26A 2DMQA 5HLGA 2A05A 1N78A 1PYVA 3RZDJ 3GTQJ 4DBQA 1SEUA 2YX4A 3RCOA 3K9TA 2F5CA 3VSLA 5FLXZ 2OJED 2ZSIB 3T5XA 3WTWC 4ZP3A 1XTAA 3QWLA 5LRRA 3OWTA 2OPTA 2RV8A 4D0PA 2E60A 3F3XA 2L02A 1VQ5I 1WVRA 2EA4A 2QKMB 2VXDA 4NC8A 4XL9A 1GHCA 1UB9A 3MQ0A 3R61A 4U0YA 3IUOA 3C2BA 3A0BC 3LQQA 1VNDA 3DFGA 2F5EA 2WAFA 3ZMZA 1ZR4A 3RJPA 4KFCA 2Z1DA 2K02A 4FQGA 3JAMZ 4Y52J 5JLWA 2CS3A 1D1AA 3GEZA 2O3FA 3GTGJ 2X4HA 1EH8A 2Q2EA 1H8AC 5JVGF 3KPHA 4DYQA 3E6MA 3CCRI 1KONA 2TCTA 5EF6A 1ZRDA 2IBDA 4AIJA 2E2HJ 4ZJZA 1Y0UA 3JW4A 3K10A 1D0XA 3CCJI 1HBXG 1S6LA 3WHCA 1HA8A 3L2VA 1IGNA 4UB8C 2VN2A 4ZZDA 1U0JA 4KIBA 3K70D 1SFUA 2CGPA 3VDXA 3IC7A 4FX0A 3MAJA 4RGRA 5DM7F 2VUMJ 4W1UA 2NRAC 4D5CA 1X4OA 2R7UA 2EIJH 1DUXC 3HUGB 2E1MC 4GRIA 1VI0A 1Y1VJ 1MGTA 4BE0A 1ZRCA 1OISA 5GPCA 2QSHX 1OYWA 4BH9A 2DOFA 1V5EA 1DU6A 4LG3A 5IP7J 5A2QZ 2CV0A 3SFZA 2FXAA 1MMDA 2ETHA 2FQ4A 2K9MA 5F0HA 4RLFA 5J8FA 5J6XA 2DYRH 1DGRM 1LUJB 1JXSA 1DDNA 4HBLA 3ACSA 5H6RA 3NQOA 3ZQLA 2KMUA 3WODF 5DV5A 1R5ID 4LFUA 4ZTFA 2KKOA 2LOOA 3D5RC 2COMA 1NK2P 2OC6A 3UNGC 4AYBN 1E2XA 3CJNA 2K3PA 4JX5A 1T39A 2AHQA 3BG6A 4BNCA 2HOEA 1YIOA 4KN7X 4BEHB 3WGIA 1R5HA 2VKEA 4EJVA 1U2WA 4XKWA 3V8JA 3CO7C 2JA2A 3TO9A 1GXPA 2FBHA 2VL8A 3WTTC 4J19A 3BR0A 1WJFA 3PNYA 4CH7A 2RQQA 3BZCA 4AUXA 5M5YJ 2CO5A 2HTSA 2UXNA 2X51A 2DJIA 2JA8J 4PJJA 1VQ9I 1HCRA 3ONQA 1FWZA 1Z91A 3H36A 2M34A 1Z77A 5GPAA 3E1SA 1W5SA 3I59B 1T8IA 1D5YA 2DRNA 2PFBA 4LGWA 3HSFA 4FISA 5CQGA 3QFYA 5BNGA 2KRCA 2ME0A 2GM4A 1LFPA 3FM5A 1EA3A 3BQYA 2E1MB 1ZG1A 4C9YA 3ZQHA 4DW6A 1G6NA 2EFOA 3ABLH 4NHJA 1TQIA 3BOQA 3O6BB 2HXIA 3TOAA 1MBKA 1I6XA 4BJTA 4HLXA 1XSDA 4C30A 3RKWA 4OU0A 1FZPB 4ENKA 2LY1A 1WJEA 3VYRB 1XDUA 3J81Z 4R1HA 3E5UA 3LSHA 2K4BA 3KYDB 2XASA 3CC4I 3M8FA 1RUNA 4EVIA 4MLOA 5KHDA 5LEKA 5DM6F 3ZN0A 1JTYA 3L00A 2VBWA 1G3WA 1Y8QB 2DA3A 2QQBA 2WA0A 1G3SA 1JGGA 3LFKA 5FRMA 2IZYA 3BG5A 4HQEA 1TT5B 2LP0A 1EH6A 1GV2A 5B1BH 3QYEA 4V2FA 3M7GA 1K78A 4R8HA 3WU2C 1P92A 2ZKZA 3D1NI 1YX5A 4MFEA 3HGYA 2K86A 4IHXA 3SZPA 1J9IA 3FXRA 2CW7A 5FFZA 2BVLA 4U7BA 3LOCA 5GP9A 2Z99A 3DLLF 2BGCA 2DA4A 3DKYA 4GXOA 4GDFA 4E7ZA 4RT4A 3LSPA 3J7AO 4ZYHA 2ID3A 5H20A 4Y3OA 5LEJA 4BBSJ 1RESA 1BI2A 1F1ZA 3DU5A 1KU7A 4IL6C 2JPCA 5AIQA 4BAYA 2FEZA 3WU0A 1ZQ3P 5D8KB 2HYJA 2K9LA 2XSJC 2H1KA 5FFXA 2JUGA 5DCMB 4ZYAA 1K6OA 1B72A 4CCOA 2A6HF 4DNCA 1K6YA 1E3OC 4I01A 2ELKA 2JUCA 2G7UA 1D0ZA 5EEGA 2XV4S 5BPDA 1TW2A 2H9RA 1WCMJ 4A3IJ 5CPRB 5KAFC 3GZ5A 2LBFA 3DPLC 5J47A 1LE8A 3IH4A 4DQ2A 5IP9J 5ED4A 2WWYA 2D45A 2IPQX 1T56A 3S4BA 3KCCA 1PP7U 3B6CA 4IRGA 3A0HC 3H3VK 2FQ3A 2OTJI 1YLFA 1RUOA 2X1CA 1ZTRA 3TO6A 5BMZA 4RB2C 4F93B 4EMSA 3HIFA 1I3AA 1Z3YA 2XB0X 2LR8A 1FTTA 2HVQA 2HKXA 1O7FA 1N75A 2O0YA 5FROA 2PLYA 4UVBA 3HHHA 4OOIA 3AG2H 3WE2A 1IG7A 4LK1F 4WWCA 3GYHX 4LB5A 3FKIJ 3OSFA 3SEZA 5D8LB 1Y6IA 2QCOA 4MHGA 4A0ZA 3M1EA 4E7LA 3CO6C 3CJTB 2KRFA 3SHFA 1UMQA 3RPUA 2AO9A 4C3HJ 4IHSA 4IRIA 2F5DA 3HRUA 2L9NA 2OCEA 3H3ZA 4MO7A 2VPRA 3M07A 2HQ5A 1SD6A 2G9WA 1UELB 3MZ8A 2F2EA 3JR9A 4CXFA 4XR6A 5LD2C 2CUJA 4WXHA 1YW9A 2KRHA 2Q2EB 3DPUA 1XX5A 3KEQA 2MBFA 5HDKA 3V42A 5F08A 1EJ9A 2VT3A 1BW6A 2OAZA 1HC8A 2VQLA 4MEXF 2A6EF 2H6CA 1LDKB 1ZGAA 4XIDA 1MMGA 3PFYA 2A69F 1R23A 4EJOA 1TW3A 5EJCA 4H0EA 2HI3A 3B73A 3HOVJ 1WH5A 3LSMA 2AQEA 1R1TA 4YIIA 2HZDA 3I55I 4AD9A 2ZFWA 3FBNB 3FXQA 3ABMH 5K5RA 1MNDA 1MIJA 1DU0A 2R5ZB 1W5TA 2B7EA 2XKPA 4BQAA 1BM9A 3PIPF 1I50J 2ZNYA 4PFOA 2CSOA 4IO9F 2I15A 2GXBA 2LK2A 3CC2I 2CWEA 4HW0A 2O61A 2KIMA 1IDYA 1LPQA 2W57A 4IRHA 2IEKA 2CQ7A 1R4MB 4KUMA 4LG0A 5J1YA 3ZN1A 1P4AA 3U21A 3QQAA 2KYGA 2W48A 1HXDA 3D5SC 3LSKA 2CFOA 1OQYA 1PUFA 4L9TA 2VJJA 5D5XB 5EDNA 4RIQA 1RRJA 3PNVA 3R0AA 1QGPA 1U9NA 2VJ5A 4I98B 1ETYA 4IJAA 4CYCB 1YX3A 4OINF 1MJAA 3ABKH 4XLAA 5FLXK 1HLVA 1L0OC 1R58A 1JHHA 4PSWA 1TQMA 3O8GA 2NAZA 3BJ6A 4ZC3A 1NK3P 4NDLA 1VQPI 3LSRA 1F43A 3Q9VA 4JX6A 3F8CA 3K4MA 4XK4A 1APLC 3KX2A 3K4CA 1BI0A 5L3DA 2HZTA 1ZG5A 4ZDPA 3FXLA 3OYDA 2Q8KA 4RAGA 3DWLE 3P5JA 5FGMA 3SZTA 4U0WA 4XORA 3ABTA 1JKQC 2EZLA 1KU3A 3DEWA 1MW7A 3MFKA 2WY8Q 2JPBA 1ACIA 1SAXA 4NQWB 4H4KC 1ENHA 3AL0C 1DP3A 2L3DA 1TTYA 4KITB 3VOEA 3NARA 3CD6I 2OUMA 1V5GA 3S93A 5L3CA 2Y9YA 2GLOA 2DO7A 1MMSA 4KJZA 4PUSA 5HODA 4N0BA 4Z2YA 1JGSA 1IC8A 3JCUC 1IXSB 2V1XA 3HM5A 2ZXHA 4XKVA 2MG4A 2JTVA 4A69C 1BJZA 2O8XA 4HEA2 4JBAA 4CHUA 3RSNA 3BTCA 2KIQA 3ZQIA 1O4XA 1I6HJ 3R0JA 3EETA 3PUBA 4PJNA 3QYBA 5EZHA 1OKRA 4A6DA 1UFMA 3ASNH 5E3MA 1WSUA 4Q4ZF 4KN4X 1RR8C 5CYVA 1SVLA 4HDVA 1J59A 4DZPA 4X1EA 2QF7A 1K78B 1TWGJ 2Y75A 2M4KA 1EKEA 3OV8A 1VZ0A 4P5OA 3GO5A 4UXNA 5LGNA 5E3NA 2DTZA 4UY8I 3M4OJ 5A2QK 1FOWA 3HJEA 4G7ZF 2AXLA 2JRMA 4P9UA 3C2HA 2KNGA 2CYYA 2DOAA 2VC1A 1PDNC 2TRTA 2GAUA 3A01B 3KIOA 3UKGA 3ZMDA 4LJZF 3VFZA 3DP7A 2NYXA 1B72B 3AL0B 3K6GA 3S2HJ 1P7IA 1BI3A 1YIJI 2VKDA 1W0UA 3K4KA 2QGUA 3G1LA 1TL8A 5E17F 3OOPA 1ETQA 4BY1J 1E3HA 3Q0VA 1I5ZA 3HOYJ 3RTRA 2LDUA 1PJRA 4A2UA 1OCZH 3LFUA 2GA1A 3H5NA 2NVXJ 2KJBA 4E7HA 3K4LA 5LBQA 4J01A 1TP4A 3RPUD 2E7XA 2LKSA 2ZCWA 3I59A 1SFEA 4GGGA 1XGSA 2OQRA 2FOKA 2M4GA 3O8HA 2L0KA 4G94A 4QSHA 1H0MA 1IV8A 1GVDA 3E0JB 4V2GA 5ICCA 4A3JJ 1OCRH 4HRIA 1J2XA 2P7VB 5K5QA 1LKXA 2M7BA 2HPMA 2IXSA 3EQLF 1XMAA 3S32A 3HOSA 2IVMA 1MDMB 2M5WA 4RGUA 3JRFA 1JT6A 2Q0OA 1T0FC 1HKSA 1WI9A 2Z16A 1MBJA 2CG4A 3MEXA 1VQLI 3GFMA 2QSGX 2L7MP 3V8KA 5FD6A 1N25A 4FT8A 4M71A 5H6QA 1QA6A 4CA0A 2CQQA 3TGNA 1GT0C 4A3KJ 1YG2A 1FSHA 1R1VA 4E6KG 1TNTA 2DFHA 3CUQA 1JKRC 4RB0A 2K3FA 3A02A 3NEUA 2E34A 2LC2A 3PSFA 5F1RA 3HRSA 4RLQA 3H5RA 1IN5A 3PM1A 2X85A 5IY5H 2DFEA 2X6YA 2GQQA 4WXDA 2MFZA 3GFIA 2DT7B 5IT9K 1XC5A 3FMRA 4PSXA 5K7ZA 1CGPA 3I5UA 1R71A 2QUFA 4Z6YA 5JR3A 1U78A 4G9YA 3M3YJ 2WAQA 1BR1A 2RGVA 2EFWA 1FOXA 2MABA 2YR2A 1ZHFA 2XRLA 3K69A 3OIQA 4RTAA 3VPRA 3HEFA 3GTLJ 2VODA 1YS6A 2JWTA 3QOEA 4ZDLA 2Y9ZA 3GMEA 3MZYA 4CUGA 2Y2ZA 3CF5F 2X6XA 1WPKA 2HWVA 5EZGA 2PEXA 4HF2A 4A0XA 1OJLA 3W2AA 1B1BA 1SFXA 4ENJA 1UCRA 1ZAOA 3G1OA 3DEUA 4RB1A 5DCMA 2I8DA 4IHWA 3ERMA 2MLGA 1HSJA 1V3FA 1POGA 1YRNA 2Z3YA 2KQRA 2L7FP 4BHPA 4YEJA 2IGMA 3RKYA 4O5VA 2GWRA 3MKYB 1YW7A 1RZ4A 2A07F 1ZR2A 2WAQN 1KQ0A 3BTLA 2O8KA 2X1DA 4IHTA 4X6AJ 4ENNA 3EUHA 1G3YA 4D1QA 2CV1A 3BDDA 3L9FA 4WF2A 2LLKA 1MJBA 4HV5A 1B4AA 2B63J 2JQ7A 2Z33A 4GCVA 4UVAA 2E71A 1IN8A 2HYFA 2ZXIA 4RA2A 3I4PA 4B43A 4LK0F 2EZIA 3BTJA 2F48A 4M9ZA 1F4KA 1IRFA 4A3FJ 4Q48A 1XD7A 3NWSA 4LG0B 3S1MJ 4IX7A 2VKHA 2FBKA 3VEPA 3QAHA 3Q9SA 1ZELA 3I64A 3M8JA 4NB5A 2VB6A 3HOWJ 3DTIA 4MTEA 3K1PA 1REPC 5J1RA 3KZYA 4D7NA 3RIRA 3T8TA 2JRTA 1PUFB 3WTYC 4TV7A 1Z7UA 1Y56A 1MBHA 4EM0B 3WG9A 2KJCA 2MA3A 2MD0A 1XCBA 4JOMA 3BC8A 4HOBA 3WTVC 1CQTA 1A36A 2NVUB 1O7LA 2EV6A 4LD5A 5HVQC 3Q0UA 2LVSA 4C3JJ 2ELJA 3ML6A 1R9TJ 3L2QA 3CDHA 4EQQA 2VQGA 3RYPA 1L6EA 2KDOA 3H5AA 1JUSA 1GDTA 2XAQA 3QP5A 3VYTB 3TW7A 4B47A 1OPCA 2ZBKA 4EM2A 1YO5C 2VLAA 1QPIA 1UG2A 1ETKA 2R7FA 3AAFA 3CCUI 1YI2I 3F8FA 3HPGA 2EJRA 2ELHA 2XVCA 4Y15A 2NS0A 3I9V2 2YPRA 2GZWA 2X1EA 3CDLA 4YIFA 3KP4A 4AIDA 5FLMJ 1USTA 1I1GA 2WB1A 3GTJJ 3HOXJ 4XRSA 3IWFA 5LFAA 2OQGA 4DGWB 3O2PE 2EILH 1RETA 3QPHA 3AG1H 2EBIA 3IM4A 3BROA 5J40A 4ASNA 2LG4A 4IOCF 2H6BA 2F5VA 3SFIA 1YE9A 2MLKA 5DD8A 3SJMA 4AYBA 3P7NA 1VF9A 2FBIA 2HDWA 1ERDA 1X19A 2E2JJ 4EJTA 2R5ZA 1O3TA 3TL4X 1KQ8A 2IS4A 3CUOA 2YUSA 2FRHA 2Q1ZB 2XF7A 3ZMTA 2HVRA 3C18A 2FUG2 5DYMA 4UUTA 2WB1N 2EH3A 2E7WA 2L7ZA 1W7PB 1FYLA 4LMYA 3KZZA 3OYEA 4BDYA 1UZCA 3A1YA 3C2GA 4DIQA 2QKLB 1A04A 2O5RA 3D5LA 3KFWX 4WK8F 2HPIA 2BHYA 3OY9A 4BKXA 1D5VA 3CZ6A 3LSGA 4I0BA 3KP3A 4IEJA 2RNJA 3RYRA 4E7KA 1Y39A 3CUQC 3JRIA 3V7SA 3CLQA 1EF4A 2E1CA 3H0DA 4PGHA 2EINH 4A3LJ 2CQSA 4CYCA 3I4MJ 1GLNA 4GO1A 2KPMA 3I71A 2R7ZJ 1Y8RB 3B6AA 4AVZA 1P4XA 5LGTA 1MNMC 3D0SA 1MMNA 2ESHA 3E5QA 1AKHA 1EV7A 4RM2A 5TRDA 1HW1A 4CCLA 4FE4A 3WTZA 4F3QA 1W5CC 5GAHJ 4I6ZA 4QLCU 1IUFA 2XPWA 3LA2A 3ZRGA 3WGHA 2OD5A 3QYFA 1RR7A 2K40A 5J4YA 3CF2A 3FDYA 3ZMUA 4PJLA 3QDEA 1F9NA 5HNHA 2BBYA 2KL4A 4NQWA 1FYKA 2IS2A 3PQKA 2XC7A 1LEBA 1X1CA 2YU3A 2DQLA 3WE3A 2M0MA 5E18F 1Q1VA 2ADUA 2XAUA 3WHBA 1WGXA 3M1CA 1D0YA 4K2EA 1S3JA 1NH3A 2YS9A 2B0LA 3KP7A 3VYUB 3UR3C 2R5YA 1BOBA 2M45A 3EUHC 2CUEA 2L54A 2DODA 3HB9A 4B1RA 3VB2A 2D2WA 3HOUJ 3ZGKA 2RVCA 2FE3A 4BU2A 4Y4RA 4ZDOA 1S7EA 2FJ1A 2X9DA 5F27A 3CUQB 4F7ZA 5JVTA 3OYMA 3IAS2 3FHNA 2RN7A 2NXNB 3JRAA 2NOGA 3IV5A 1F36A 4G7HF 3NWTA 1ZGWA 5EYRA 1VQ8I 1HKTA 4KA4A 1FBUA 4KMFA 2EA2A 4O3MA 4G7OF 2G7HA 4M9SA 3AKZA 1PVEA 3G3ZA 2DQRA 2V9KA 4C2UA 1HDDC 2UWMA 2CJJA 5FD5A 3ZOBA 3IL2A 1FP1D 5J4VA 3OL3A 3MWMA 1X2NA 4W97A 1A6IA 3CCMI 2Y69H 3MKLA 3GLLA 3DKWA 2WV1A 2A5WA 2I10A 5FKLA 2A61A 2JMWA 5IP6A 4A3DJ 3DCFA 4UHTA 1OFCX 5KCMA 3VODA 2JVHA 4CSWA 3A01A 3RKQA 1X4PA 4L5JA 1QBJA 5HLHA 1IXRC 2X48A 4HLYA 2EFNA 1R5GA 3OIOA 2HQNA 1ETXA 1OCCH 4ZYGA 2ZNZA 3GLXA 4KYWA 3GTPJ 2R7RA 3ECOA 4KT6A 2D5VA 1QO0D 1YRNB 2STWA 2EIKH 2DMPA 4XM3A 1VQKI 3ZQQA 3PMIA 4M3EA 4F9KA 1QU3A 2BYVE 1UHMA 1WHUA 2V79A 1TWFJ 1X58A 2KZVA 4CZZA 5C44J 2L2OA 2CQTA 1I27A 2IGOA 2F6CA 2Y48A 1KYZA 1MSFC 2HYGD 1WJCA 4BL0B 2ZJPF 2DAOA 4ZZLA 5LLQA 5GAGJ 2VJIA 3SDBA 1UHWA 2MH2A 1E3PA 3LWFA 1A5JA 2P7CB 4RM3A 4HSTA 1T6SA 1MDMA 1HF0A 4A93J 1NG6A 3ZPLA 3V7RA 3N05A 1SANA 2J5PA 5IOYA 1P7JA 4C2MJ 1JT0A 1CF7B 3TQNA 1W1WE 5JFRA 3PO3J 4BACA 3S17J 5CLSA 3S2DJ 3ERED 4XOTA 4XBFA 4MFDA 2R7TA 3BR6A 3MZHA 2QM3A 2ZSHB 2X6OA 4YRVA 1Y0NA 2DA5A 1Q1HA 2F4MB 1Z9CA 2FMLA 3FM3A 2XGEA 4KMUX 3ZQGA 4MEYF 2XIGA 2ZJQF 3HL2A 4N9IA 2COBA 5B1AH 2LREA 3H0GJ 1HKQA 3QPTA 3HKZN 5E3LA 1XCVA 4BQNA 5ICEA 2HS5A 4UUSA 4UUVA 3QU6A 5DCFA 3IH3A 2L01A 1XG1A 4KNYA 1BR4A 2VBYA 3PO2J 3OIPA 3W2VA 1ZH5A 4HNVA 2H94A 2H27A 4BHBA 1VFCA 4Q47A 3OYAA 3OYKA 1MZBA 1T08B 1ZG3A 1X3WB 2IGKA 3KYLA 3KP2A 1A35A 3CCQI 3TOBA 4CCKA 3E7LA 1R22A 2IA2A 2HGCA 4B4CA 5FO5A 4E7JA 2PMZA 3FXOA 1T0FA 2Z9OA 1K7AA 3F8NA 1XSXA 4G12A 4OAZA 2DMUA 2PJPA 3GBGA 5DTDA 1MD0A 5CVIA 3PJRA 2FD5A 2LY9A 4BBRJ 1USSA 1V5FA 2Y30A 4IQJA 2P81A 3A03A 3HRMA 5GTIC 2LNBA 4M3BA 4Y17A 1D1CA 2LFBA 3I56I 1OCPA 2I5UA 2L4MA 4XOPA 4L9NA 5K7FA 4BJ5C 1BC8C 1WH7A 2OCCH 4F52A 1IZ1A 2BV6A 4V19K 3C1DA 3ZR8X 2VIXA 1N77A 4Q5SF 2NVQJ 2PMZN 2XAFA 3HOZJ 2JVGA 2DU9A 3CCSI 1FYMA 2JN6A 1FY7A 2IW5A 1ULYA 3P9CA 5L3FA 4IZZA 1VQNI 2HQAA 1X1PA 1IRZA 1XB4A 3GF2A 4BDZA 2VONA 2LF7A 3A4CA 3BG3A 4DBRA 3OL4A 4IPAA 4QPQA 3ISPA 1AKHB 3OYFA 1E0EA 5DUIA 2M3AA 3I0TA 1DPUA 1FOYA 1JHFA 3CCEI 4PGGA 5LHGA 2BXZA 4OAYA 2W1OA 1TBXA 5ERIA 3HBLA 4A3BJ 4WCGA 3AFJA 1QPMA 1MBGA 3E6DA 4U7DA 4BXUA 2RAEA 3ZMVA 5IOZA 4L0YB 3EUAA 1R7JA 3Q5FA 2VE8A 3K0LA 3JAMK 3WU1B 1FT9A 3H9QA 2HXOA 3SXYA 2X6WA 1MBFA 5D6FA 1SFOJ 2BHZA 4LLLA 2P5VA 2STTA 3W6JB 3DU6A 1FSEA 4UVCA 5HNFA 3Q0WA 4A3MJ 1X2MA 3GTKJ 1Z7LA 1ZKGA 1FBSA 2XAGA 1JKOC 3S2WA 2R5YB 2DOEA 2XPUA 2XAJA 2M1BA 3HTUA 3ZCOA 5K1YA 4KIGA
chains in the Genus database with same CATH topology
2HDDA 3CCYA 4IHWA 2JA7J 1FEXA 2VKEA 1POGA 1K61A 1IJWC 1YRNA 2L7FP 5FLVA 1ZR2A 2WAQN 1G2HA 4J19A 3BTLA 3BR0A 1JJ6C 2O8KA 1UHSA 2ECCA 4AUXA 5M5YJ 4X6AJ 2DA1A 5DS9A 2LLKA 2JA8J 2B63J 3F0CA 2CRGA 3FK6A 1HCRA 5K7HA 1OCTC 2CQXA 5EGOA 2M34A 2RQYA 1Z77A 5GPAA 3UFEA 2EZIA 3BTJA 1D5YA 4FISA 4A3FJ 5BNGA 2G0EA 4JYKA 3S1MJ 2ME0A 1NTCA 5JLXA 2GM4A 2HOTA 3NAUA 2CBGA 2OUTA 3BQYA 3FISA 3HOWJ 4XRSG 3ZQHA 4LOCA 4DW6A 5J1RA 4D7NA 5EG0B 1W0TA 4B3AA 1PUFB 1BA5A 2CUFA 3SDGA 1MBHA 2HXIA 1H89C 1MBKA 2L9RA 1IDZA 1TWCJ 4JX4A 5FKNA 1CQTA 2KDZA 3Q0UA 2LVSA 4Y7NJ 3BTIA 4MLOA 4C3JJ 1AU7A 3K2AA 1R9TJ 1JTYA 1TWAJ 1JUSA 1GDTA 5F0FA 3RQIA 2DA3A 1JGGA 3TW7A 3BG5A 2EZHA 2XGCA 2LP0A 3I4NJ 4IHVA 3BR5A 1GV2A 9ANTA 1QPIA 1UG2A 1ETKA 4V2FA 3JRDA 2M0CA 5FKMA 3D1NI 4MFEA 3HGYA 3CDLA 5FKOA 4IHXA 5FLMJ 3GTJJ 3HOXJ 4XRSA 3LOCA 1LFUP 5GP9A 2ECBA 3HGGA 3GTOJ 2DA4A 3LSPA 1JKPC 4BBSJ 2ID3A 1RETA 1QVTA 2EBIA 1RESA 2XB5A 4S0HB 3SFIA 1ZQ3P 2HYJA 1MBEA 3RZOJ 3SJMA 2H1KA 1VF9A 1MH3A 1B72A 1JTXA 3JRHA 2E2JJ 2R5ZA 1E3OC 2ELKA 3G1MA 2EZKA 1WI3A 1WCMJ 2YUSA 4A3IJ 3L1PA 1JUMA 4D7MA 3S1NJ 1LE8A 3IH4A 1FJLA 5IP9J 1T56A 3JREA 4UUTA 2WB1N 4UUSB 3K7AJ 2EH3A 3BQZA 4AC0A 2L7ZA 3B6CA 2FX0A 5FKKA 3H3VK 4C3IJ 3TEDA 1ZTRA 4A3CJ 4BKXA 3LSGA 4IEJA 3MN2A 4XRMA 2LKXA 3JRIA 2M2EA 2DA2A 2LR8A 2XB0X 1FTTA 5C4JJ 1EF4A 3FIWA 4A3LJ 2M8GX 3QPLA 4M3FA 4CYCA 3I4MJ 2DMNA 2NVTJ 1IG7A 4A3GJ 2JK3A 2R7ZJ 5IYDJ 3B6AA 1MNMC 3FKIJ 3OSFA 1MSEC 1AKHA 2QCOA 2HOSA 4FE4A 3ZQCA 2Y0SN 2XGDA 1UMQA 3FK7A 2AO9A 4C3HJ 5M3MJ 4I6ZA 1Z0XA 1IUFA 4M3GA 2XPWA 5F1JA 4MO7A 2VPRA 3HDDA 2HQ5A 3GTMJ 5J1UA 1RR7A 3TP0A 2K40A 4D5FA 3JR9A 1B8IB 1Q1VA 1RKWA 4FE7A 3WHBA 5FJ8J 3W6VA 1WGXA 5F08A 4XICA 1BW6A 2E1OA 4DYCA 2YS9A 1XS9A 2K9SA 2R5YA 2NS7A 1K83J 4XIDA 5EEAA 3ZQFA 2CUEA 2MGQA 2LTPA 2ID6A 3HB9A 4B1RA 3HOUJ 2HI3A 3S14J 3HOVJ 3CMYA 1S7EA 1GUUA 1WH5A 2FJ1A 2X9DA 4RBOA 5F27A 2XPVA 3Q3SA 4RDUA 2Y31A 1ITYA 3JRAA 4BY7J 1DU0A 3BG9A 2DJNA 2NOGA 3IV5A 1F36A 3JRGA 4DYRA 2R5ZB 1ZGWA 5EYRA 2CB9A 1I50J 2KT0A 4MIMA 2LK2A 4ABZA 1ETWA 1IDYA 2VKVA 5M5XJ 1LE8B 1HDDC 2CJJA 2JJ7A 3ZOBA 1X2NA 2K9QA 2ZB9A 1A6IA 1HDPA 3CQZJ 2IEKA 4W97A 1T33A 3MKLA 5J1YA 4EEFG 3BR2A 2R93J 2WV1A 5FKLA 2I10A 2JMWA 3QQAA 5IP6A 2W48A 4A3DJ 3DCFA 1OFCX 3A01A 1BL0A 2HOAA 3RKQA 2DMTA 2X48A 1PUFA 1QRYA 3OIOA 5EDNA 3JRBA 1ETXA 2K9NA 3GTPJ 1U9NA 1ETYA 4L5EA 1RPWA 2DA6A 4CYCB 2D5VA 1TC3C 1YRNB 5M3FJ 1HLVA 2DMPA 3O8GA 3G1OA 2M9HA 1NK3P 4NDLA 3PMIA 4M3EA 3LSRA 1F43A 1RKTA 4JX6A 1JUPA 1QVUA 4XK4A 5IYBJ 4JP0A 1TWFJ 1X58A 5C44J 1APLC 1U8BA 4FTHA 2E19A 1GV5A 1MSFC 3S1QJ 2VI6A 3BT9A 2R0QC 3S15J 5EGOB 3BR1A 5J3LA 2LD5A 1JKQC 2EZLA 3DEWA 2O7OA 1A5JA 2N8GA 1HF0A 2DN0A 1ENHA 4A93J 1ETOA 3NARA 3S1RJ 4GFBA 1SANA 1U9OA 5IOYA 2Y9YA 5C4XJ 2GLOA 1P7JA 4C2MJ 2MSYA 1JT0A 5HODA 2NVYJ 3PO3J 4QIWN 3QPSA 2EQRA 2ME6A 2R92J 1IC8A 3S17J 1MH4A 3S2DJ 4MFDA 3HM5A 3BR6A 2MG4A 4A69C 1BJZA 1AHDP 3JRCA 5IPAA 5F0CA 3BTCA 4M6VA 2X6OA 2XSDC 2JA6J 3ZQIA 1O4XA 1I6HJ 2DA5A 1FIAA 1TWHJ 2XGEA 3ZQGA 5EZHA 2DA7A 5E3MA 1HOMA 2COBA 2YU9J 1BW5A 4DZJA 3H0GJ 1IV6A 1FIPA 3HKZN 2H8RA 1I3QJ 5E3LA 4DZPA 5IYCJ 4X1EA 2QF7A 4UUSA 1TWGJ 2O9LA 3IH3A 1XG1A 5M5WJ 5E3NA 2DTZA 4M3DA 4IHYA 3PO2J 3M4OJ 2NS8A 3LNQA 3TP3A 3IH2A 4HNVA 2JA5J 2KNGA 4A3EJ 1VFCA 2TRTA 2DMQA 3A01B 3RZDJ 3E7LA 3GTQJ 3UKGA 4FCYA 4B4CA 1B72B 3S2HJ 1P7IA 4G12A 1W0UA 2DMUA 3GBGA 5DTDA 2OPTA 3G1LA 2FD5A 2LY9A 1ETQA 1ZK8A 4BY1J 3Q0VA 2OF7A 3HOYJ 3TW6A 4BBRJ 2Y30A 2NVXJ 2P81A 3A03A 3C2BA 4M3BA 1VNDA 2LFBA 1OCPA 1FTZA 4I76A 1ZR4A 5K7FA 3GWHA 1WH7A 4Y52J 5JLWA 2CU7A 3O8HA 2L0KA 4QSHA 1GVDA 4V2GA 4A3JJ 3GTGJ 1B8IA 3OSGA 1H8AC 5EG0A 2MW8A 3OOUA 2NVQJ 4DYQA 2PMZN 3S16J 3HOZJ 2TCTA 1JT6A 5EF6A 3JRFA 2JN6A 2IBDA 2E2HJ 2IAIA 1MBJA 1JJ8C 1ORKA 1IRZA 2L7MP 3BG3A 3WHCA 1IGNA 1AKHB 2CQQA 1GT0C 4A3KJ 5F04A 3LSJA 1JKRC 5E3OA 3A02A 2VUMJ 4W1UA 1ETVA 3HBLA 4A3BJ 4D5CA 1MBGA 3PM1A 2RAEA 5IOZA 1Y1WJ 3MVPA 1VI0A 2GBYA 1XC5A 5K7ZA 1Y1VJ 2HXOA 1U78A 3M3YJ 1MBFA 5GPCA 1H88C 1SFOJ 1DU6A 5IP7J 2XRLA 4QTRA 3VPRA 3HEFA 3GTLJ 2FQ4A 3Q0WA 4A3MJ 5F0HA 1X2MA 3GTKJ 2JWTA 1LFBA 2Y9ZA 4BXXJ 1ZKGA 2Y2ZA 3ZQLA 1JKOC 1WPKA 5EZGA 2R5YB 2XPUA 3BR3A 1OJLA 2E2IJ 1NK2P 4AYBN 4JX5A 5C3EJ 2AHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDD A;  3CCY A;  4IHW A;  2JA7 J;  1FEX A;  2VKE A;  1POG A;  1K61 A;  1IJW C;  1YRN A;  2L7F P;  5FLV A;  1ZR2 A;  2WAQ N;  1G2H A;  4J19 A;  3BTL A;  3BR0 A;  1JJ6 C;  2O8K A;  1UHS A;  2ECC A;  4AUX A;  5M5Y J;  4X6A J;  2DA1 A;  5DS9 A;  2LLK A;  2JA8 J;  2B63 J;  3F0C A;  2CRG A;  3FK6 A;  1HCR A;  5K7H A;  1OCT C;  2CQX A;  5EGO A;  2M34 A;  1Z77 A;  5GPA A;  2EZI A;  3BTJ A;  1D5Y A;  4FIS A;  4A3F J;  5BNG A;  2G0E A;  4JYK A;  3S1M J;  2ME0 A;  1NTC A;  5JLX A;  2GM4 A;  2HOT A;  3NAU A;  3BQY A;  3FIS A;  3HOW J;  4XRS G;  3ZQH A;  4LOC A;  4DW6 A;  5J1R A;  4D7N A;  5EG0 B;  1W0T A;  4B3A A;  1PUF B;  1BA5 A;  2CUF A;  3SDG A;  1MBH A;  2HXI A;  1H89 C;  1MBK A;  2L9R A;  1IDZ A;  1TWC J;  4JX4 A;  5FKN A;  1CQT A;  2KDZ A;  3Q0U A;  2LVS A;  4Y7N J;  3BTI A;  4MLO A;  4C3J J;  1AU7 A;  3K2A A;  1R9T J;  1JTY A;  1TWA J;  1JUS A;  1GDT A;  5F0F A;  3RQI A;  2DA3 A;  1JGG A;  3TW7 A;  3BG5 A;  2EZH A;  2XGC A;  2LP0 A;  3I4N J;  4IHV A;  3BR5 A;  1GV2 A;  9ANT A;  1QPI A;  1UG2 A;  1ETK A;  4V2F A;  3JRD A;  2M0C A;  5FKM A;  3D1N I;  4MFE A;  3HGY A;  3CDL A;  5FKO A;  4IHX A;  5FLM J;  3GTJ J;  3HOX J;  4XRS A;  3LOC A;  1LFU P;  5GP9 A;  2ECB A;  3HGG A;  3GTO J;  2DA4 A;  3LSP A;  1JKP C;  4BBS J;  2ID3 A;  1RET A;  1QVT A;  2EBI A;  1RES A;  2XB5 A;  4S0H B;  3SFI A;  1ZQ3 P;  2HYJ A;  1MBE A;  3RZO J;  3SJM A;  2H1K A;  1VF9 A;  1MH3 A;  1B72 A;  1JTX A;  3JRH A;  2E2J J;  2R5Z A;  1E3O C;  2ELK A;  3G1M A;  2EZK A;  1WI3 A;  1WCM J;  2YUS A;  4A3I J;  3L1P A;  1JUM A;  4D7M A;  3S1N J;  1LE8 A;  3IH4 A;  1FJL A;  5IP9 J;  1T56 A;  3JRE A;  4UUT A;  2WB1 N;  4UUS B;  3K7A J;  2EH3 A;  3BQZ A;  4AC0 A;  2L7Z A;  3B6C A;  2FX0 A;  5FKK A;  3H3V K;  4C3I J;  3TED A;  1ZTR A;  4A3C J;  4BKX A;  3LSG A;  4IEJ A;  3MN2 A;  4XRM A;  2LKX A;  3JRI A;  2M2E A;  2DA2 A;  2LR8 A;  2XB0 X;  1FTT A;  5C4J J;  1EF4 A;  3FIW A;  4A3L J;  2M8G X;  3QPL A;  4M3F A;  4CYC A;  3I4M J;  2DMN A;  2NVT J;  1IG7 A;  4A3G J;  2JK3 A;  2R7Z J;  5IYD J;  3B6A A;  1MNM C;  3FKI J;  3OSF A;  1MSE C;  1AKH A;  2QCO A;  2HOS A;  4FE4 A;  3ZQC A;  2Y0S N;  2XGD A;  1UMQ A;  3FK7 A;  2AO9 A;  4C3H J;  5M3M J;  4I6Z A;  1Z0X A;  1IUF A;  4M3G A;  2XPW A;  5F1J A;  4MO7 A;  2VPR A;  3HDD A;  2HQ5 A;  3GTM J;  5J1U A;  1RR7 A;  3TP0 A;  2K40 A;  4D5F A;  3JR9 A;  1B8I B;  1Q1V A;  1RKW A;  4FE7 A;  3WHB A;  5FJ8 J;  3W6V A;  1WGX A;  5F08 A;  4XIC A;  1BW6 A;  2E1O A;  4DYC A;  2YS9 A;  1XS9 A;  2K9S A;  2R5Y A;  2NS7 A;  1K83 J;  4XID A;  5EEA A;  3ZQF A;  2CUE A;  2MGQ A;  2LTP A;  2ID6 A;  3HB9 A;  4B1R A;  3HOU J;  2HI3 A;  3S14 J;  3HOV J;  3CMY A;  1S7E A;  1GUU A;  1WH5 A;  2FJ1 A;  2X9D A;  4RBO A;  5F27 A;  2XPV A;  3Q3S A;  4RDU A;  2Y31 A;  1ITY A;  3JRA A;  4BY7 J;  1DU0 A;  3BG9 A;  2DJN A;  2NOG A;  3IV5 A;  1F36 A;  3JRG A;  4DYR A;  2R5Z B;  1ZGW A;  5EYR A;  1I50 J;  2KT0 A;  4MIM A;  2LK2 A;  4ABZ A;  1ETW A;  1IDY A;  2VKV A;  5M5X J;  1LE8 B;  1HDD C;  2CJJ A;  2JJ7 A;  3ZOB A;  1X2N A;  2K9Q A;  2ZB9 A;  1A6I A;  1HDP A;  3CQZ J;  2IEK A;  4W97 A;  1T33 A;  3MKL A;  5J1Y A;  4EEF G;  3BR2 A;  2R93 J;  2WV1 A;  5FKL A;  2I10 A;  2JMW A;  3QQA A;  5IP6 A;  2W48 A;  4A3D J;  3DCF A;  1OFC X;  3A01 A;  1BL0 A;  2HOA A;  3RKQ A;  2DMT A;  2X48 A;  1PUF A;  1QRY A;  3OIO A;  5EDN A;  3JRB A;  1ETX A;  2K9N A;  3GTP J;  1U9N A;  1ETY A;  4L5E A;  1RPW A;  2DA6 A;  4CYC B;  2D5V A;  1TC3 C;  1YRN B;  5M3F J;  1HLV A;  2DMP A;  3O8G A;  3G1O A;  2M9H A;  1NK3 P;  4NDL A;  4M3E A;  3LSR A;  1F43 A;  1RKT A;  4JX6 A;  1JUP A;  1QVU A;  4XK4 A;  5IYB J;  4JP0 A;  1TWF J;  1X58 A;  5C44 J;  1APL C;  1U8B A;  4FTH A;  2E19 A;  1GV5 A;  1MSF C;  3S1Q J;  2VI6 A;  3BT9 A;  2R0Q C;  3S15 J;  5EGO B;  3BR1 A;  5J3L A;  2LD5 A;  1JKQ C;  2EZL A;  3DEW A;  2O7O A;  1A5J A;  2N8G A;  1HF0 A;  2DN0 A;  1ENH A;  4A93 J;  1ETO A;  3NAR A;  3S1R J;  4GFB A;  1SAN A;  1U9O A;  5IOY A;  2Y9Y A;  5C4X J;  2GLO A;  1P7J A;  4C2M J;  2MSY A;  1JT0 A;  5HOD A;  2NVY J;  3PO3 J;  4QIW N;  3QPS A;  2EQR A;  2ME6 A;  2R92 J;  1IC8 A;  3S17 J;  1MH4 A;  3S2D J;  4MFD A;  3HM5 A;  3BR6 A;  2MG4 A;  4A69 C;  1BJZ A;  1AHD P;  3JRC A;  5IPA A;  5F0C A;  3BTC A;  4M6V A;  2X6O A;  2XSD C;  2JA6 J;  3ZQI A;  1O4X A;  1I6H J;  2DA5 A;  1FIA A;  1TWH J;  2XGE A;  3ZQG A;  5EZH A;  2DA7 A;  5E3M A;  1HOM A;  2COB A;  2YU9 J;  1BW5 A;  4DZJ A;  3H0G J;  1IV6 A;  1FIP A;  3HKZ N;  2H8R A;  1I3Q J;  5E3L A;  4DZP A;  5IYC J;  4X1E A;  2QF7 A;  4UUS A;  1TWG J;  2O9L A;  3IH3 A;  1XG1 A;  5M5W J;  5E3N A;  2DTZ A;  4M3D A;  4IHY A;  3PO2 J;  3M4O J;  2NS8 A;  3LNQ A;  3TP3 A;  3IH2 A;  4HNV A;  2JA5 J;  4A3E J;  1VFC A;  2TRT A;  2DMQ A;  3A01 B;  3RZD J;  3E7L A;  3GTQ J;  3UKG A;  4FCY A;  4B4C A;  1B72 B;  3S2H J;  1P7I A;  4G12 A;  1W0U A;  2DMU A;  3GBG A;  5DTD A;  2OPT A;  3G1L A;  2FD5 A;  2LY9 A;  1ETQ A;  1ZK8 A;  4BY1 J;  3Q0V A;  2OF7 A;  3HOY J;  3TW6 A;  4BBR J;  2Y30 A;  2NVX J;  2P81 A;  3A03 A;  3C2B A;  4M3B A;  1VND A;  2LFB A;  1OCP A;  1FTZ A;  4I76 A;  1ZR4 A;  5K7F A;  1WH7 A;  4Y52 J;  5JLW A;  2CU7 A;  3O8H A;  2L0K A;  4QSH A;  1GVD A;  4V2G A;  4A3J J;  3GTG J;  1B8I A;  3OSG A;  1H8A C;  5EG0 A;  2MW8 A;  3OOU A;  2NVQ J;  4DYQ A;  2PMZ N;  3S16 J;  3HOZ J;  2TCT A;  1JT6 A;  5EF6 A;  3JRF A;  2JN6 A;  2IBD A;  2E2H J;  2IAI A;  1MBJ A;  1JJ8 C;  1ORK A;  1IRZ A;  2L7M P;  3BG3 A;  3WHC A;  1IGN A;  1AKH B;  2CQQ A;  1GT0 C;  4A3K J;  5F04 A;  3LSJ A;  1JKR C;  5E3O A;  3A02 A;  2VUM J;  4W1U A;  1ETV A;  3HBL A;  4A3B J;  4D5C A;  1MBG A;  3PM1 A;  2RAE A;  5IOZ A;  1Y1W J;  3MVP A;  1VI0 A;  2GBY A;  1XC5 A;  5K7Z A;  1Y1V J;  2HXO A;  1U78 A;  3M3Y J;  1MBF A;  5GPC A;  1H88 C;  1SFO J;  1DU6 A;  5IP7 J;  2XRL A;  4QTR A;  3VPR A;  3HEF A;  3GTL J;  2FQ4 A;  3Q0W A;  4A3M J;  5F0H A;  1X2M A;  3GTK J;  2JWT A;  1LFB A;  2Y9Z A;  4BXX J;  1ZKG A;  2Y2Z A;  3ZQL A;  1JKO C;  1WPK A;  5EZG A;  2R5Y B;  2XPU A;  3BR3 A;  1OJL A;  2E2I J;  1NK2 P;  4AYB N;  4JX5 A;  5C3E J;  2AHQ A; 
#chains in the Genus database with same CATH topology
 3CCY A;  1FEX A;  1BI1 A;  2V6C A;  4B09 A;  1K61 A;  3GX4 X;  2TDX A;  2RDP A;  5FLV A;  3HYI A;  2XRO A;  4HAM A;  4EV0 A;  2FA5 A;  1OYY A;  4HPQ A;  1G2H A;  3FXJ A;  5E1X A;  2QQ8 A;  3JSP A;  5LHH A;  5TIS C;  3TDZ C;  3OYG A;  4B3X A;  2DA1 A;  2DK5 A;  3N4M A;  1W7P A;  2CH0 A;  2QBY A;  3F0C A;  3SZG A;  2DW4 A;  3V7C A;  3OYB A;  3ELK A;  2GOM A;  1XPX A;  1OCT C;  4RAY A;  3OYN A;  4U88 A;  1RC9 A;  1V54 H;  4UB6 C;  4AIH A;  2DDA A;  5KAI C;  2ZJ2 A;  2G0E A;  4JYK A;  5E1W A;  1B6A A;  2HNH A;  1G3T A;  2HOT A;  3NAU A;  2CBG A;  2K5C A;  3OS0 A;  3CC7 I;  2BW3 B;  3WGG A;  5B3S H;  5EG0 B;  2XRN A;  1W0T A;  2LRD A;  5ICF A;  1BA5 A;  3PIO F;  1QHG A;  2IA1 A;  3SDG A;  3F6V A;  3F23 A;  1H89 C;  2L9R A;  1TWC J;  5FB2 A;  2W24 A;  2K4J A;  2W4S A;  3WTS C;  1DPR A;  2BZT A;  4JX4 A;  2P6S A;  4OWR B;  4II3 A;  4HF1 A;  4HDU A;  3H35 A;  2BY0 A;  3WTU C;  2KDZ A;  3OYL A;  3HC7 A;  1WWX A;  1AU7 A;  1TZL A;  1Z1D A;  3K2A A;  1G4D A;  1SD7 A;  1YQA A;  5GAD J;  3K1M A;  1YYV A;  2BEO A;  2EZH A;  1SAU A;  2Y0M A;  3HXL A;  3CDI A;  1XDS A;  1STZ A;  1ZGJ A;  2E1N A;  1IRG A;  1J0R A;  3BR5 A;  3RPQ A;  9ANT A;  4HX7 A;  3JRD A;  2M0C A;  1G59 A;  5FKM A;  1I39 A;  2RQP A;  3MKW B;  3E5X A;  4CYD A;  2AS5 F;  1YJW I;  1KU2 A;  1C0W A;  4B44 A;  2R7S A;  2IS6 A;  4LLG F;  1LFU P;  1S29 A;  2ECB A;  3HGG A;  3GTO J;  4II2 A;  4F91 B;  3A2K A;  1JKP C;  3HG9 A;  4N4O B;  3AFH A;  3E6C C;  3HTS B;  3J81 K;  2GXA A;  3DBL B;  4S0H B;  1MBE A;  3RZO J;  1LVA A;  3BWG A;  3J7Z I;  3FXU A;  1MH3 A;  5HS9 A;  5HLT A;  3MMY B;  1JTX A;  2GOX B;  3JRH A;  5ILU A;  2GXG A;  1ZN2 A;  2E5N A;  2EZK A;  5KNL A;  2HDC A;  3L1P A;  4RAF A;  3S4D A;  1V55 H;  4XQF A;  1BN5 A;  3TO7 A;  3S1N J;  1FJL A;  1U6G A;  2OZ6 A;  3GWZ A;  4MTD A;  5D5W B;  1BJA A;  2IGN A;  4UUS B;  2DT6 A;  3K7A J;  3BQZ A;  4U0V A;  4AC0 A;  3L2W A;  2FX0 A;  3JTG A;  3WG7 H;  2DFF A;  5LGU A;  1WQ2 A;  2ZC2 A;  4C3I J;  3IRR A;  3TED A;  1D1B A;  4CCN A;  5D6E A;  4A3C J;  2DXI A;  2EV0 A;  3BJO A;  2FSW A;  5JI6 A;  2R7X A;  4RGS A;  1S8N A;  2VBZ A;  4MGR A;  4XRM A;  4M73 A;  2LKX A;  2VPL A;  1T38 A;  1HST A;  2M2E A;  2P0W A;  5C4J J;  3FIW A;  1XN7 A;  3COA C;  2DMN A;  1T95 A;  3U9G A;  2M30 A;  4A3G J;  1U3E M;  2JK3 A;  4I0A A;  1WFX A;  2CQN A;  5IYD J;  1IN6 A;  1Z6T A;  2CMP A;  3P9I A;  1PP8 F;  1MSE C;  1WJ5 A;  3C7J A;  4OMZ A;  4M9X A;  2ZJR F;  3ESW B;  3ZQC A;  3F21 A;  1UAA A;  1BIA A;  2V6E A;  3HSR A;  4XLC A;  5M3M J;  1Z3X A;  5E8I A;  5CKT A;  3CCL I;  3OR1 C;  1Z0X A;  2H09 A;  2L5Q A;  4M3G A;  2VJ4 A;  3HDD A;  1ODD A;  3BLY A;  4A5N A;  3GTM J;  5J1U A;  1KU9 A;  3G4S I;  1PUE E;  3LMM A;  3TP0 A;  1LEA A;  5E20 A;  1NG7 A;  2EPF A;  3GVA A;  1RIO H;  1Z6R A;  2WTE A;  3H92 A;  3FMQ A;  2JZY A;  2LY2 A;  5D5U B;  2PN6 A;  3E3V A;  1O3S A;  1ZYR F;  2XGX A;  3FX3 A;  3W6V A;  4MQV A;  2VBX A;  5KVR A;  2O03 A;  4ESF A;  2WC2 A;  4ZH4 F;  1CF7 A;  3PL8 A;  4PFP A;  2DCE A;  5D4R A;  3FWE A;  1BC7 C;  2R4G A;  1R49 A;  2E1O A;  1R6R A;  1XS9 A;  4AWX B;  1LDJ A;  3H9J A;  2EFP A;  1K83 J;  5EEA A;  5GAE J;  2R7Q A;  2MGQ A;  1W4M A;  1IF1 A;  3L2U A;  2LTP A;  6PAX A;  4NBQ A;  3W3C A;  3I3L A;  3N97 A;  1GUU A;  2HVS A;  3LA3 A;  2ISY A;  5FRN A;  2D1V A;  2CW8 A;  2KIF A;  3GZ6 A;  2XPV A;  3DTK A;  3O3K A;  3RQ4 A;  3Q3S A;  4XRF A;  4FAS D;  2Z5U A;  3IWZ A;  4BY7 J;  4RAZ A;  3BG9 A;  2V1U A;  4DYR A;  1OR7 C;  4OIO F;  4PJ0 C;  1AOY A;  3IHU A;  1ZAR A;  1IW7 F;  2M8E A;  3U1D A;  1FPQ A;  4ENM A;  2FF4 A;  2UZK A;  2A5Y B;  5M5X J;  1WJD A;  2JT1 A;  2PMH A;  5J8C A;  1W7P D;  1HDP A;  3K70 C;  3CQZ J;  1T33 A;  2D1H A;  4EEF G;  1MMA A;  3SQN A;  4CZC A;  1LJ9 A;  2VQH A;  1P4W A;  4DOZ A;  4HZF A;  1WJB A;  2W85 A;  3T0Y A;  1S9H A;  2HOA A;  1B9M A;  4LIT A;  1P2F A;  4B48 A;  1K79 A;  1T98 A;  4S04 A;  1X3U A;  5CJ9 A;  1XGN A;  3U1K A;  4ANJ A;  1Z05 A;  3MKZ A;  1SFK A;  4L5E A;  1KGS A;  4AM3 A;  4LB6 B;  1DGW Y;  1HW5 A;  1R00 A;  2ZFU A;  3FF5 A;  3EDP A;  3KEO A;  2OV7 A;  4ZYD A;  4IKF A;  4ITV A;  2KIU A;  3L7W A;  1RKT A;  1U5T C;  2FNA A;  1QVU A;  4HA8 A;  3CES A;  2EFQ A;  4XSX F;  2E36 A;  2VC0 A;  2E19 A;  1GV5 A;  2QBY B;  3S1Q J;  3I53 A;  3BT9 A;  2R0Q C;  2B9S A;  2A6T A;  3BR1 A;  3GFJ A;  3I54 A;  4MNU A;  5J3L A;  2LD5 A;  5F64 A;  4S05 A;  5K5O A;  1IN7 A;  2O7O A;  3W6K B;  1J7K A;  3S4A A;  4NNJ A;  3B02 A;  4B8X A;  2P5L C;  1LDD A;  4PK4 A;  2KP6 A;  4GFB A;  1AA7 A;  3KE2 A;  3PQJ A;  4KIS A;  3K4B A;  3AG4 H;  5C4X J;  1FX7 A;  2J5O A;  2NNY A;  4XMY A;  2NVY J;  2M7A A;  4QIW N;  2PI0 A;  5HDN A;  3QPS A;  4HYE A;  3DQV C;  2EQR A;  1XMX A;  2ME6 A;  5ICG A;  1MH4 A;  1D8K A;  4KIC A;  2XAH A;  4DJA A;  2W00 A;  3JRC A;  4XON A;  2UXX A;  3FXK A;  1TQP A;  4M6V A;  2XSD C;  4YFN F;  3J7A Y;  3F6O A;  3PSI A;  5E8G A;  3OYH A;  2DA7 A;  3CP2 A;  1QQI A;  2DI3 A;  4IOA F;  1H9G A;  2LKP A;  4DZJ A;  2VT2 A;  2K85 A;  4BQQ A;  1FIP A;  2IA0 A;  2VQC A;  1M1E B;  5AIP A;  3ABU A;  5F6F A;  2P5K A;  1KZH A;  3M9A A;  1R2A A;  4XLE A;  2O9L A;  2WY7 Q;  3C3W A;  1LVK A;  2DLL A;  2NS8 A;  3QOD A;  3LNQ A;  1EH7 A;  2PG4 A;  3IP4 B;  1U5T B;  4UNO A;  4OIR F;  1BIB A;  2FNP A;  4A12 A;  4IF4 A;  2OA4 A;  1U8R A;  3ZMS A;  4XLP F;  3TKY A;  3G73 A;  1ON2 A;  3L2C A;  3QFZ A;  3FXM A;  4NC6 A;  3J80 Z;  2CV2 A;  2H8W A;  3K4J A;  1ZLJ A;  1J5Y A;  2CW0 F;  1OCO H;  3FZV A;  4FCY A;  2HKO A;  4BE2 A;  3OS1 A;  2EWN A;  1QZE A;  3L09 A;  3BG7 A;  2ZME A;  1FP2 A;  2DBB A;  2NOJ B;  3IRQ A;  4ESJ A;  1ZK8 A;  5D5V B;  2OF7 A;  5CVR A;  5L3G A;  3TW6 A;  5JHF A;  5HLI A;  1I1S A;  2QQ9 A;  1FMW A;  1DP7 P;  4YFK F;  3QP6 A;  2DPU A;  4JQF A;  3G36 A;  1FTZ A;  4I76 A;  2EZW A;  3I58 A;  3IM3 A;  3GWH A;  4GYI A;  1YJN I;  2WAE A;  2CU7 A;  2V7F A;  5IT9 Z;  3BY6 A;  3G71 I;  3DKX A;  3OSG A;  1B8I A;  2PJR B;  2UV1 A;  2BW3 A;  5EG0 A;  4AIK A;  2MW8 A;  3OOU A;  2OTL I;  2A3S A;  3S16 J;  2VE9 A;  3H3U A;  5HDG A;  2BY2 A;  1D8J A;  2IAI A;  1JJ8 C;  4A0Y A;  4E4H A;  1ORK A;  4P96 A;  3U2R A;  3LAP A;  3KYC B;  4I2O A;  2P6T A;  5H2F C;  2BE5 F;  1X3Z B;  4HNT A;  4QWQ A;  3BCA A;  4FX4 A;  3KLN A;  1Z67 A;  4IXA A;  4G8X A;  4CCM A;  2KHM A;  3H1C A;  4L18 B;  5F04 A;  5ILS A;  4N4N B;  4PCQ A;  3LSJ A;  4NUB A;  5E3O A;  5TGT A;  1ETV A;  1W36 C;  1LB2 A;  3DF8 A;  3LST A;  3HZJ A;  3RSY A;  1Y1W J;  3MVP A;  2GBY A;  4EJU A;  1JE8 A;  1R4N B;  2MC4 A;  1J09 A;  1X1D A;  2M87 A;  2PX9 A;  3HKZ A;  2QA4 I;  1H88 C;  2V9P A;  4XLF A;  2V9V A;  2RNG A;  2RC4 A;  1K4T A;  4QTR A;  1A6Q A;  2QWW A;  1LFB A;  3CMA I;  4BXX J;  3ZP5 A;  4AU7 A;  3S3N A;  4J00 A;  2JSC A;  3CMM A;  1J75 A;  3BR3 A;  2EIM H;  1YJ9 I;  1ZRF A;  1MKM A;  1WRJ A;  4CIC A;  3S8P A;  2FMY A;  2R7O A;  5DDG A;  2EK5 A;  2E2I J;  2R3S A;  1VTN C;  1W36 D;  5HVZ A;  1FC3 A;  1XSV A;  3WTX C;  5C3E J;  2HDD A;  3BPV A;  3PNT A;  2EB7 A;  2XDV A;  2JA7 J;  4BUP A;  4HG2 A;  4HNU A;  1IJW C;  2XF5 A;  2BY1 A;  4LLN A;  3CME I;  2RRE A;  2L7K A;  2OBP A;  3BCB A;  1VQM I;  3SYT A;  1FOK A;  2LYC A;  4EJW A;  2VAS A;  5CVV A;  3R60 A;  4I7H A;  1JJ6 C;  3OYJ A;  1UHS A;  2ECC A;  5DS9 A;  3TMO A;  1V4R A;  2HR3 A;  1L3L A;  5EEH A;  3MD2 A;  3ZQ7 A;  2LF8 A;  3IKT A;  1XGM A;  2CRG A;  4E7I A;  3FK6 A;  5K7H A;  1JI8 A;  2HTJ A;  1YTY A;  2CQX A;  4XLN F;  5EGO A;  2RQY A;  1O3R A;  4IQ4 A;  2R7D A;  3UFE A;  4XLH A;  2LSO A;  4ETS A;  3GUD A;  4CGZ A;  1OMI A;  1NTC A;  5JLX A;  2DYS H;  5AON A;  1X1A A;  2OUT A;  5IT3 A;  3FIS A;  4ZTJ A;  4XRS G;  5BOX A;  1P9Q C;  4LOC A;  4CO8 A;  4HQM A;  4YFX F;  4BGD A;  4B3A A;  4KT5 C;  3OYI A;  2CUF A;  1IRX A;  5L3E A;  3DXJ F;  3HOT A;  1QZY A;  4XSZ F;  2RKH A;  1IDZ A;  2DK8 A;  5DUK A;  3NRV A;  2IRF G;  1BOA A;  2MC3 A;  1GXQ A;  3VYS B;  2FOW A;  4BYY A;  2DDB A;  4P55 A;  5FKN A;  4E70 A;  1E17 A;  1YOV B;  2W7N A;  3CLO A;  4Y7N J;  3BTI A;  1K4S A;  2W82 A;  2XKO A;  2E35 A;  4I02 A;  2QYO A;  4OIP F;  1TWA J;  1SMY F;  3QG0 A;  5F0F A;  3R6S A;  3RQI A;  2MYS A;  1GVJ A;  3P9K A;  3CP8 A;  2XGC A;  3G6E I;  2OU2 A;  5HS8 A;  3I4N J;  1MJ9 A;  2ZO4 A;  3IAM 2;  2O6G E;  4IHV A;  2L9V A;  3R4K A;  4RGX A;  4EAT A;  2BXY A;  1OYI A;  1KA8 A;  4P1W A;  3JSO A;  3S3M A;  4L5I A;  3HSE A;  4HX8 A;  1WZ2 A;  1IAW A;  1O3Q A;  3FKJ A;  5FKO A;  1T2K A;  2ZXW H;  4N9H A;  2R7W A;  2DFI A;  3ECH A;  2ZME C;  4LIU A;  3REO A;  2JSP A;  5ILV A;  1F5T A;  4CDG A;  3E97 A;  2YSR A;  1IO2 A;  3DTE A;  1LQ1 A;  1QVT A;  1TNS A;  2DT5 A;  1FBQ A;  2FU4 A;  3GZN B;  3EYI A;  2XB5 A;  4U87 A;  3ASO H;  1QHH D;  5BS6 A;  2HFH A;  3QRF F;  1IUY A;  4I09 A;  2XUB A;  3BJA A;  4ON0 A;  4Y13 A;  4UV9 A;  4OIQ F;  3HRT A;  2IS1 A;  1ZLK A;  3F72 A;  2H1L A;  4HV6 A;  2IJL A;  4O6J A;  3LAJ A;  1WI3 A;  3G1M A;  1SMT A;  2QEX I;  1JUM A;  3OS2 A;  4D7M A;  2L4A A;  4RMN A;  3OR2 C;  2PMU A;  2QEN A;  3K2Z A;  3J7Y J;  1FLI A;  4G6Q A;  4EGZ A;  3GFL A;  2QSF X;  1VQ7 I;  2Y0S A;  3JRE A;  2W84 A;  4E7S A;  1X1B A;  3DEE A;  5E79 C;  2QLZ A;  2BVM A;  3DV8 A;  5FKK A;  2ZXJ A;  3KP6 A;  4RB3 C;  3S3O A;  1IXC A;  1YFH A;  4M6Y A;  3BZ6 A;  5DD4 A;  3MN2 A;  2L9S A;  5GTH C;  3QOP A;  2AQF A;  2DA2 A;  2QVO A;  3BPX A;  3LA7 A;  4Y33 A;  3TBI A;  5CVJ A;  4ESB A;  1A31 A;  2HQR A;  4XNF A;  3JTH A;  3ZXS A;  3T1B A;  4GYG A;  2M8G X;  3QPL A;  4M3F A;  4OMY A;  5B66 C;  2NVT J;  2IP2 A;  2V4J C;  3GXO A;  3DPT A;  4XN3 A;  3OMY A;  2WBM A;  3TDU C;  2VOO A;  3FBI B;  2ZME B;  1VQO I;  4I99 C;  2HOS A;  2Y0S N;  4AVP A;  2XGD A;  3FK7 A;  2W25 A;  4G6D A;  2A68 F;  2P4W A;  2C6Y A;  2P8T A;  2F5F A;  1H9T A;  3BP8 A;  5F1J A;  3SEQ A;  5LHI A;  2HEO A;  3QU3 A;  3V8L A;  2MD5 A;  1WJA A;  4A6E A;  3HUG A;  4BS9 A;  1BR2 A;  4D5F A;  1ZRE A;  3G2B A;  2WAD A;  2K7L A;  3K1N A;  1YIT I;  1ON1 A;  1HW2 A;  2OZU A;  2F4O B;  4L9V A;  1OR7 A;  3AG3 H;  5D4S A;  1B8I B;  4L9J A;  1RKW A;  4FE7 A;  2NNN A;  5FJ8 J;  1LNW A;  2CUZ A;  4BXF A;  3S4C A;  4XIC A;  4DYC A;  4D9J A;  2K9S A;  2NS7 A;  3MCZ A;  2KZG A;  3ZQF A;  2BOL A;  4FHT A;  2EV5 A;  3ULQ B;  1TT0 A;  2ID6 A;  4G6T B;  5KK1 A;  3S14 J;  4BEH A;  3CMY A;  2QZ8 A;  3DBR B;  5BPI A;  3W2W A;  2BY3 A;  3HHG A;  3LL7 A;  5HOO A;  4RBO A;  1KYW A;  2ESN A;  3M8E A;  2K27 A;  4P9F A;  3LSI A;  3CCV I;  2VOP A;  1DQU A;  1SC7 A;  4RDU A;  1YS7 A;  3OYC A;  2Y31 A;  1ITY A;  1QNT A;  3HPH A;  3LQR A;  2DJN A;  3RDI A;  3JRG A;  2R7V A;  2CB9 A;  4BJ6 C;  3ACT A;  1HQC A;  2IT0 A;  2KT0 A;  4MIM A;  2V1N A;  4ABZ A;  1SVO A;  1ETW A;  2LBF B;  2VKV A;  1LE8 B;  1RNL A;  2VXZ A;  1Z21 A;  3CJR B;  1AWC A;  1B59 A;  2JJ7 A;  4LIV A;  5LRS A;  2XF6 A;  1U5T A;  3PFI A;  4XKB A;  4R79 A;  3F8B A;  2GIV A;  2K9Q A;  2ZB9 A;  2DPD A;  4F92 B;  4EM1 A;  3BR2 A;  3VSK A;  2R93 J;  4PJM A;  1IN4 A;  2LH9 A;  1VQ4 I;  2MH9 A;  5L3B A;  4CCJ A;  4YG2 F;  1BL0 A;  1G8X A;  4HF0 A;  3J80 K;  4XKC A;  1TLH B;  1YW8 A;  4PZJ A;  2DMT A;  4HX4 A;  2CFX A;  1UG0 A;  2UUZ A;  1QRY A;  3JRB A;  1S5L C;  3F9K A;  3EPZ A;  4WXC A;  4BHC A;  2K9N A;  3FMS A;  3EYY A;  3F22 A;  3T8R A;  4KDP A;  1R1U A;  4NC7 A;  1RPW A;  2DA6 A;  2DTR A;  3F8M A;  4YEL A;  3CTA A;  3ROU A;  1TC3 C;  4X0G A;  2WV0 A;  3KZI C;  4QPO A;  1OLT A;  5M3F J;  4FET A;  2PQ8 A;  4BE1 A;  1XMK A;  2M9H A;  3KEY A;  1D3Y A;  5JHU A;  5B5E C;  5BQT A;  3GW2 A;  2ISZ A;  1SD5 A;  1S7A A;  2ACJ A;  1JUP A;  5IYB J;  4ZYE A;  4JP0 A;  4M6X A;  1WKM A;  1U8B A;  4FTH A;  1R36 A;  4L0Z B;  3L2R A;  4EGY A;  2VI6 A;  2GIZ A;  2ICW G;  3S15 J;  2QQA A;  5EGO B;  3H9G A;  2X0L A;  2PJR A;  1RI7 A;  2AXT C;  5CQE A;  4WX9 A;  5DEQ A;  5CVU A;  1FMV A;  1UJ8 A;  2N8G A;  3K4N A;  2DN0 A;  3PUF A;  3DLA A;  1ETO A;  1S7O A;  3KET A;  3S1R J;  2F4I A;  1ONV A;  1KQ9 A;  1MNE A;  1U9O A;  2PBI A;  5TJJ A;  4KIF A;  2MSY A;  2GA2 A;  1S72 I;  2R92 J;  2V1D A;  4IVN A;  2KLO A;  1SVM A;  2HU9 A;  5E1Z B;  4F55 A;  5IPA A;  1YHQ I;  1AHD P;  4YIR X;  2E5Z A;  4RS8 A;  1BBY A;  5F0C A;  4JK1 X;  2JA6 J;  2KIS A;  1FIA A;  3EUK L;  1TWH J;  3CJQ B;  4M72 A;  1VQ6 I;  3VWB A;  1HOM A;  3RRS A;  2KFD A;  3GCM A;  4HSR A;  2YU9 J;  1BW5 A;  4PDK A;  1SD4 A;  2Z2S B;  3RKX A;  1IV6 A;  2H8R A;  1I3Q J;  3RI4 A;  4UV8 A;  1FNN A;  5IYC J;  1B9N A;  3IKV A;  4A5M A;  3KP5 A;  3BZK A;  3V4G A;  3X2Q H;  1O57 A;  5M5W J;  4M3D A;  3KLO A;  4IHY A;  4XN0 A;  1P6R A;  1XGO A;  3DBH B;  3FHZ A;  1QZZ A;  3TP3 A;  4C2T A;  1NHA A;  3IH2 A;  3E6B A;  4MQ9 F;  2JA5 J;  4BQO A;  4A3E J;  2LMD A;  5HS7 A;  4M74 A;  2CQK A;  2XHK A;  2YX7 A;  2V26 A;  2DMQ A;  5HLG A;  2A05 A;  1N78 A;  1PYV A;  3RZD J;  3GTQ J;  4DBQ A;  1SEU A;  2YX4 A;  3RCO A;  3K9T A;  2F5C A;  3VSL A;  5FLX Z;  2OJE D;  2ZSI B;  3T5X A;  3WTW C;  4ZP3 A;  1XTA A;  3QWL A;  5LRR A;  3OWT A;  2OPT A;  2RV8 A;  4D0P A;  2E60 A;  3F3X A;  2L02 A;  1VQ5 I;  1WVR A;  2EA4 A;  2QKM B;  2VXD A;  4NC8 A;  4XL9 A;  1GHC A;  1UB9 A;  3MQ0 A;  3R61 A;  4U0Y A;  3IUO A;  3C2B A;  3A0B C;  3LQQ A;  1VND A;  3DFG A;  2F5E A;  2WAF A;  3ZMZ A;  1ZR4 A;  3RJP A;  4KFC A;  2Z1D A;  2K02 A;  4FQG A;  3JAM Z;  4Y52 J;  5JLW A;  2CS3 A;  1D1A A;  3GEZ A;  2O3F A;  3GTG J;  2X4H A;  1EH8 A;  2Q2E A;  1H8A C;  5JVG F;  3KPH A;  4DYQ A;  3E6M A;  3CCR I;  1KON A;  2TCT A;  5EF6 A;  1ZRD A;  2IBD A;  4AIJ A;  2E2H J;  4ZJZ A;  1Y0U A;  3JW4 A;  3K10 A;  1D0X A;  3CCJ I;  1HBX G;  1S6L A;  3WHC A;  1HA8 A;  3L2V A;  1IGN A;  4UB8 C;  2VN2 A;  4ZZD A;  1U0J A;  4KIB A;  3K70 D;  1SFU A;  2CGP A;  3VDX A;  3IC7 A;  4FX0 A;  3MAJ A;  4RGR A;  5DM7 F;  2VUM J;  4W1U A;  2NRA C;  4D5C A;  1X4O A;  2R7U A;  2EIJ H;  1DUX C;  3HUG B;  2E1M C;  4GRI A;  1VI0 A;  1Y1V J;  1MGT A;  4BE0 A;  1ZRC A;  1OIS A;  5GPC A;  2QSH X;  1OYW A;  4BH9 A;  2DOF A;  1V5E A;  1DU6 A;  4LG3 A;  5IP7 J;  5A2Q Z;  2CV0 A;  3SFZ A;  2FXA A;  1MMD A;  2ETH A;  2FQ4 A;  2K9M A;  5F0H A;  4RLF A;  5J8F A;  5J6X A;  2DYR H;  1DGR M;  1LUJ B;  1JXS A;  1DDN A;  4HBL A;  3ACS A;  5H6R A;  3NQO A;  3ZQL A;  2KMU A;  3WOD F;  5DV5 A;  1R5I D;  4LFU A;  4ZTF A;  2KKO A;  2LOO A;  3D5R C;  2COM A;  1NK2 P;  2OC6 A;  3UNG C;  4AYB N;  1E2X A;  3CJN A;  2K3P A;  4JX5 A;  1T39 A;  2AHQ A;  3BG6 A;  4BNC A;  2HOE A;  1YIO A;  4KN7 X;  4BEH B;  3WGI A;  1R5H A;  2VKE A;  4EJV A;  1U2W A;  4XKW A;  3V8J A;  3CO7 C;  2JA2 A;  3TO9 A;  1GXP A;  2FBH A;  2VL8 A;  3WTT C;  4J19 A;  3BR0 A;  1WJF A;  3PNY A;  4CH7 A;  2RQQ A;  3BZC A;  4AUX A;  5M5Y J;  2CO5 A;  2HTS A;  2UXN A;  2X51 A;  2DJI A;  2JA8 J;  4PJJ A;  1VQ9 I;  1HCR A;  3ONQ A;  1FWZ A;  1Z91 A;  3H36 A;  2M34 A;  1Z77 A;  5GPA A;  3E1S A;  1W5S A;  3I59 B;  1T8I A;  1D5Y A;  2DRN A;  2PFB A;  4LGW A;  3HSF A;  4FIS A;  5CQG A;  3QFY A;  5BNG A;  2KRC A;  2ME0 A;  2GM4 A;  1LFP A;  3FM5 A;  1EA3 A;  3BQY A;  2E1M B;  1ZG1 A;  4C9Y A;  3ZQH A;  4DW6 A;  1G6N A;  2EFO A;  3ABL H;  4NHJ A;  1TQI A;  3BOQ A;  3O6B B;  2HXI A;  3TOA A;  1MBK A;  1I6X A;  4BJT A;  4HLX A;  1XSD A;  4C30 A;  3RKW A;  4OU0 A;  1FZP B;  4ENK A;  2LY1 A;  1WJE A;  3VYR B;  1XDU A;  3J81 Z;  4R1H A;  3E5U A;  3LSH A;  2K4B A;  3KYD B;  2XAS A;  3CC4 I;  3M8F A;  1RUN A;  4EVI A;  4MLO A;  5KHD A;  5LEK A;  5DM6 F;  3ZN0 A;  1JTY A;  3L00 A;  2VBW A;  1G3W A;  1Y8Q B;  2DA3 A;  2QQB A;  2WA0 A;  1G3S A;  1JGG A;  3LFK A;  5FRM A;  2IZY A;  3BG5 A;  4HQE A;  1TT5 B;  2LP0 A;  1EH6 A;  1GV2 A;  5B1B H;  3QYE A;  4V2F A;  3M7G A;  1K78 A;  4R8H A;  3WU2 C;  1P92 A;  2ZKZ A;  3D1N I;  1YX5 A;  4MFE A;  3HGY A;  2K86 A;  4IHX A;  3SZP A;  1J9I A;  3FXR A;  2CW7 A;  5FFZ A;  2BVL A;  4U7B A;  3LOC A;  5GP9 A;  2Z99 A;  3DLL F;  2BGC A;  2DA4 A;  3DKY A;  4GXO A;  4GDF A;  4E7Z A;  4RT4 A;  3LSP A;  3J7A O;  4ZYH A;  2ID3 A;  5H20 A;  4Y3O A;  5LEJ A;  4BBS J;  1RES A;  1BI2 A;  1F1Z A;  3DU5 A;  1KU7 A;  4IL6 C;  2JPC A;  5AIQ A;  4BAY A;  2FEZ A;  3WU0 A;  1ZQ3 P;  5D8K B;  2HYJ A;  2K9L A;  2XSJ C;  2H1K A;  5FFX A;  2JUG A;  5DCM B;  4ZYA A;  1K6O A;  1B72 A;  4CCO A;  2A6H F;  4DNC A;  1K6Y A;  1E3O C;  4I01 A;  2ELK A;  2JUC A;  2G7U A;  1D0Z A;  5EEG A;  2XV4 S;  5BPD A;  1TW2 A;  2H9R A;  1WCM J;  4A3I J;  5CPR B;  5KAF C;  3GZ5 A;  2LBF A;  3DPL C;  5J47 A;  1LE8 A;  3IH4 A;  4DQ2 A;  5IP9 J;  5ED4 A;  2WWY A;  2D45 A;  2IPQ X;  1T56 A;  3S4B A;  3KCC A;  1PP7 U;  3B6C A;  4IRG A;  3A0H C;  3H3V K;  2FQ3 A;  2OTJ I;  1YLF A;  1RUO A;  2X1C A;  1ZTR A;  3TO6 A;  5BMZ A;  4RB2 C;  4F93 B;  4EMS A;  3HIF A;  1I3A A;  1Z3Y A;  2XB0 X;  2LR8 A;  1FTT A;  2HVQ A;  2HKX A;  1O7F A;  1N75 A;  2O0Y A;  5FRO A;  2PLY A;  4UVB A;  3HHH A;  4OOI A;  3AG2 H;  3WE2 A;  1IG7 A;  4LK1 F;  4WWC A;  3GYH X;  4LB5 A;  3FKI J;  3OSF A;  3SEZ A;  5D8L B;  1Y6I A;  2QCO A;  4MHG A;  4A0Z A;  3M1E A;  4E7L A;  3CO6 C;  3CJT B;  2KRF A;  3SHF A;  1UMQ A;  3RPU A;  2AO9 A;  4C3H J;  4IHS A;  4IRI A;  2F5D A;  3HRU A;  2L9N A;  2OCE A;  3H3Z A;  4MO7 A;  2VPR A;  3M07 A;  2HQ5 A;  1SD6 A;  2G9W A;  1UEL B;  3MZ8 A;  2F2E A;  3JR9 A;  4CXF A;  4XR6 A;  5LD2 C;  2CUJ A;  4WXH A;  1YW9 A;  2KRH A;  2Q2E B;  3DPU A;  1XX5 A;  3KEQ A;  2MBF A;  5HDK A;  3V42 A;  5F08 A;  1EJ9 A;  2VT3 A;  1BW6 A;  2OAZ A;  1HC8 A;  2VQL A;  4MEX F;  2A6E F;  2H6C A;  1LDK B;  1ZGA A;  4XID A;  1MMG A;  3PFY A;  2A69 F;  1R23 A;  4EJO A;  1TW3 A;  5EJC A;  4H0E A;  2HI3 A;  3B73 A;  3HOV J;  1WH5 A;  3LSM A;  2AQE A;  1R1T A;  4YII A;  2HZD A;  3I55 I;  4AD9 A;  2ZFW A;  3FBN B;  3FXQ A;  3ABM H;  5K5R A;  1MND A;  1MIJ A;  1DU0 A;  2R5Z B;  1W5T A;  2B7E A;  2XKP A;  4BQA A;  1BM9 A;  3PIP F;  1I50 J;  2ZNY A;  4PFO A;  2CSO A;  4IO9 F;  2I15 A;  2GXB A;  2LK2 A;  3CC2 I;  2CWE A;  4HW0 A;  2O61 A;  2KIM A;  1IDY A;  1LPQ A;  2W57 A;  4IRH A;  2IEK A;  2CQ7 A;  1R4M B;  4KUM A;  4LG0 A;  5J1Y A;  3ZN1 A;  1P4A A;  3U21 A;  3QQA A;  2KYG A;  2W48 A;  1HXD A;  3D5S C;  3LSK A;  2CFO A;  1OQY A;  1PUF A;  4L9T A;  2VJJ A;  5D5X B;  5EDN A;  4RIQ A;  1RRJ A;  3PNV A;  3R0A A;  1QGP A;  1U9N A;  2VJ5 A;  4I98 B;  1ETY A;  4IJA A;  4CYC B;  1YX3 A;  4OIN F;  1MJA A;  3ABK H;  4XLA A;  5FLX K;  1HLV A;  1L0O C;  1R58 A;  1JHH A;  4PSW A;  1TQM A;  3O8G A;  2NAZ A;  3BJ6 A;  4ZC3 A;  1NK3 P;  4NDL A;  1VQP I;  3LSR A;  1F43 A;  3Q9V A;  4JX6 A;  3F8C A;  3K4M A;  4XK4 A;  1APL C;  3KX2 A;  3K4C A;  1BI0 A;  5L3D A;  2HZT A;  1ZG5 A;  4ZDP A;  3FXL A;  3OYD A;  2Q8K A;  4RAG A;  3DWL E;  3P5J A;  5FGM A;  3SZT A;  4U0W A;  4XOR A;  3ABT A;  1JKQ C;  2EZL A;  1KU3 A;  3DEW A;  1MW7 A;  3MFK A;  2WY8 Q;  2JPB A;  1ACI A;  1SAX A;  4NQW B;  4H4K C;  1ENH A;  3AL0 C;  1DP3 A;  2L3D A;  1TTY A;  4KIT B;  3VOE A;  3NAR A;  3CD6 I;  2OUM A;  1V5G A;  3S93 A;  5L3C A;  2Y9Y A;  2GLO A;  2DO7 A;  1MMS A;  4KJZ A;  4PUS A;  5HOD A;  4N0B A;  4Z2Y A;  1JGS A;  1IC8 A;  3JCU C;  1IXS B;  2V1X A;  3HM5 A;  2ZXH A;  4XKV A;  2MG4 A;  2JTV A;  4A69 C;  1BJZ A;  2O8X A;  4HEA 2;  4JBA A;  4CHU A;  3RSN A;  3BTC A;  2KIQ A;  3ZQI A;  1O4X A;  1I6H J;  3R0J A;  3EET A;  3PUB A;  4PJN A;  3QYB A;  5EZH A;  1OKR A;  4A6D A;  1UFM A;  3ASN H;  5E3M A;  1WSU A;  4Q4Z F;  4KN4 X;  1RR8 C;  5CYV A;  1SVL A;  4HDV A;  1J59 A;  4DZP A;  4X1E A;  2QF7 A;  1K78 B;  1TWG J;  2Y75 A;  2M4K A;  1EKE A;  3OV8 A;  1VZ0 A;  4P5O A;  3GO5 A;  4UXN A;  5LGN A;  5E3N A;  2DTZ A;  4UY8 I;  3M4O J;  5A2Q K;  1FOW A;  3HJE A;  4G7Z F;  2AXL A;  2JRM A;  4P9U A;  3C2H A;  2KNG A;  2CYY A;  2DOA A;  2VC1 A;  1PDN C;  2TRT A;  2GAU A;  3A01 B;  3KIO A;  3UKG A;  3ZMD A;  4LJZ F;  3VFZ A;  3DP7 A;  2NYX A;  1B72 B;  3AL0 B;  3K6G A;  3S2H J;  1P7I A;  1BI3 A;  1YIJ I;  2VKD A;  1W0U A;  3K4K A;  2QGU A;  3G1L A;  1TL8 A;  5E17 F;  3OOP A;  1ETQ A;  4BY1 J;  1E3H A;  3Q0V A;  1I5Z A;  3HOY J;  3RTR A;  2LDU A;  1PJR A;  4A2U A;  1OCZ H;  3LFU A;  2GA1 A;  3H5N A;  2NVX J;  2KJB A;  4E7H A;  3K4L A;  5LBQ A;  4J01 A;  1TP4 A;  3RPU D;  2E7X A;  2LKS A;  2ZCW A;  3I59 A;  1SFE A;  4GGG A;  1XGS A;  2OQR A;  2FOK A;  2M4G A;  3O8H A;  2L0K A;  4G94 A;  4QSH A;  1H0M A;  1IV8 A;  1GVD A;  3E0J B;  4V2G A;  5ICC A;  4A3J J;  1OCR H;  4HRI A;  1J2X A;  2P7V B;  5K5Q A;  1LKX A;  2M7B A;  2HPM A;  2IXS A;  3EQL F;  1XMA A;  3S32 A;  3HOS A;  2IVM A;  1MDM B;  2M5W A;  4RGU A;  3JRF A;  1JT6 A;  2Q0O A;  1T0F C;  1HKS A;  1WI9 A;  2Z16 A;  1MBJ A;  2CG4 A;  3MEX A;  1VQL I;  3GFM A;  2QSG X;  2L7M P;  3V8K A;  5FD6 A;  1N25 A;  4FT8 A;  4M71 A;  5H6Q A;  1QA6 A;  4CA0 A;  2CQQ A;  3TGN A;  1GT0 C;  4A3K J;  1YG2 A;  1FSH A;  1R1V A;  4E6K G;  1TNT A;  2DFH A;  3CUQ A;  1JKR C;  4RB0 A;  2K3F A;  3A02 A;  3NEU A;  2E34 A;  2LC2 A;  3PSF A;  5F1R A;  3HRS A;  4RLQ A;  3H5R A;  1IN5 A;  3PM1 A;  2X85 A;  5IY5 H;  2DFE A;  2X6Y A;  2GQQ A;  4WXD A;  2MFZ A;  3GFI A;  2DT7 B;  5IT9 K;  1XC5 A;  3FMR A;  4PSX A;  5K7Z A;  1CGP A;  3I5U A;  1R71 A;  2QUF A;  4Z6Y A;  5JR3 A;  1U78 A;  4G9Y A;  3M3Y J;  2WAQ A;  1BR1 A;  2RGV A;  2EFW A;  1FOX A;  2MAB A;  2YR2 A;  1ZHF A;  2XRL A;  3K69 A;  3OIQ A;  4RTA A;  3VPR A;  3HEF A;  3GTL J;  2VOD A;  1YS6 A;  2JWT A;  3QOE A;  4ZDL A;  2Y9Z A;  3GME A;  3MZY A;  4CUG A;  2Y2Z A;  3CF5 F;  2X6X A;  1WPK A;  2HWV A;  5EZG A;  2PEX A;  4HF2 A;  4A0X A;  1OJL A;  3W2A A;  1B1B A;  1SFX A;  4ENJ A;  1UCR A;  1ZAO A;  3G1O A;  3DEU A;  4RB1 A;  5DCM A;  2I8D A;  4IHW A;  3ERM A;  2MLG A;  1HSJ A;  1V3F A;  1POG A;  1YRN A;  2Z3Y A;  2KQR A;  2L7F P;  4BHP A;  4YEJ A;  2IGM A;  3RKY A;  4O5V A;  2GWR A;  3MKY B;  1YW7 A;  1RZ4 A;  2A07 F;  1ZR2 A;  2WAQ N;  1KQ0 A;  3BTL A;  2O8K A;  2X1D A;  4IHT A;  4X6A J;  4ENN A;  3EUH A;  1G3Y A;  4D1Q A;  2CV1 A;  3BDD A;  3L9F A;  4WF2 A;  2LLK A;  1MJB A;  4HV5 A;  1B4A A;  2B63 J;  2JQ7 A;  2Z33 A;  4GCV A;  4UVA A;  2E71 A;  1IN8 A;  2HYF A;  2ZXI A;  4RA2 A;  3I4P A;  4B43 A;  4LK0 F;  2EZI A;  3BTJ A;  2F48 A;  4M9Z A;  1F4K A;  1IRF A;  4A3F J;  4Q48 A;  1XD7 A;  3NWS A;  4LG0 B;  3S1M J;  4IX7 A;  2VKH A;  2FBK A;  3VEP A;  3QAH A;  3Q9S A;  1ZEL A;  3I64 A;  3M8J A;  4NB5 A;  2VB6 A;  3HOW J;  3DTI A;  4MTE A;  3K1P A;  1REP C;  5J1R A;  3KZY A;  4D7N A;  3RIR A;  3T8T A;  2JRT A;  1PUF B;  3WTY C;  4TV7 A;  1Z7U A;  1Y56 A;  1MBH A;  4EM0 B;  3WG9 A;  2KJC A;  2MA3 A;  2MD0 A;  1XCB A;  4JOM A;  3BC8 A;  4HOB A;  3WTV C;  1CQT A;  1A36 A;  2NVU B;  1O7L A;  2EV6 A;  4LD5 A;  5HVQ C;  3Q0U A;  2LVS A;  4C3J J;  2ELJ A;  3ML6 A;  1R9T J;  3L2Q A;  3CDH A;  4EQQ A;  2VQG A;  3RYP A;  1L6E A;  2KDO A;  3H5A A;  1JUS A;  1GDT A;  2XAQ A;  3QP5 A;  3VYT B;  3TW7 A;  4B47 A;  1OPC A;  2ZBK A;  4EM2 A;  1YO5 C;  2VLA A;  1QPI A;  1UG2 A;  1ETK A;  2R7F A;  3AAF A;  3CCU I;  1YI2 I;  3F8F A;  3HPG A;  2EJR A;  2ELH A;  2XVC A;  4Y15 A;  2NS0 A;  3I9V 2;  2YPR A;  2GZW A;  2X1E A;  3CDL A;  4YIF A;  3KP4 A;  4AID A;  5FLM J;  1UST A;  1I1G A;  2WB1 A;  3GTJ J;  3HOX J;  4XRS A;  3IWF A;  5LFA A;  2OQG A;  4DGW B;  3O2P E;  2EIL H;  1RET A;  3QPH A;  3AG1 H;  2EBI A;  3IM4 A;  3BRO A;  5J40 A;  4ASN A;  2LG4 A;  4IOC F;  2H6B A;  2F5V A;  3SFI A;  1YE9 A;  2MLK A;  5DD8 A;  3SJM A;  4AYB A;  3P7N A;  1VF9 A;  2FBI A;  2HDW A;  1ERD A;  1X19 A;  2E2J J;  4EJT A;  2R5Z A;  1O3T A;  3TL4 X;  1KQ8 A;  2IS4 A;  3CUO A;  2YUS A;  2FRH A;  2Q1Z B;  2XF7 A;  3ZMT A;  2HVR A;  3C18 A;  2FUG 2;  5DYM A;  4UUT A;  2WB1 N;  2EH3 A;  2E7W A;  2L7Z A;  1W7P B;  1FYL A;  4LMY A;  3KZZ A;  3OYE A;  4BDY A;  1UZC A;  3A1Y A;  3C2G A;  4DIQ A;  2QKL B;  1A04 A;  2O5R A;  3D5L A;  3KFW X;  4WK8 F;  2HPI A;  2BHY A;  3OY9 A;  4BKX A;  1D5V A;  3CZ6 A;  3LSG A;  4I0B A;  3KP3 A;  4IEJ A;  2RNJ A;  3RYR A;  4E7K A;  1Y39 A;  3CUQ C;  3JRI A;  3V7S A;  3CLQ A;  1EF4 A;  2E1C A;  3H0D A;  4PGH A;  2EIN H;  4A3L J;  2CQS A;  4CYC A;  3I4M J;  1GLN A;  4GO1 A;  2KPM A;  3I71 A;  2R7Z J;  1Y8R B;  3B6A A;  4AVZ A;  1P4X A;  5LGT A;  1MNM C;  3D0S A;  1MMN A;  2ESH A;  3E5Q A;  1AKH A;  1EV7 A;  4RM2 A;  5TRD A;  1HW1 A;  4CCL A;  4FE4 A;  3WTZ A;  4F3Q A;  1W5C C;  5GAH J;  4I6Z A;  4QLC U;  1IUF A;  2XPW A;  3LA2 A;  3ZRG A;  3WGH A;  2OD5 A;  3QYF A;  1RR7 A;  2K40 A;  5J4Y A;  3CF2 A;  3FDY A;  3ZMU A;  4PJL A;  3QDE A;  1F9N A;  5HNH A;  2BBY A;  2KL4 A;  4NQW A;  1FYK A;  2IS2 A;  3PQK A;  2XC7 A;  1LEB A;  1X1C A;  2YU3 A;  2DQL A;  3WE3 A;  2M0M A;  5E18 F;  1Q1V A;  2ADU A;  2XAU A;  3WHB A;  1WGX A;  3M1C A;  1D0Y A;  4K2E A;  1S3J A;  1NH3 A;  2YS9 A;  2B0L A;  3KP7 A;  3VYU B;  3UR3 C;  2R5Y A;  1BOB A;  2M45 A;  3EUH C;  2CUE A;  2L54 A;  2DOD A;  3HB9 A;  4B1R A;  3VB2 A;  2D2W A;  3HOU J;  3ZGK A;  2RVC A;  2FE3 A;  4BU2 A;  4Y4R A;  4ZDO A;  1S7E A;  2FJ1 A;  2X9D A;  5F27 A;  3CUQ B;  4F7Z A;  5JVT A;  3OYM A;  3IAS 2;  3FHN A;  2RN7 A;  2NXN B;  3JRA A;  2NOG A;  3IV5 A;  1F36 A;  4G7H F;  3NWT A;  1ZGW A;  5EYR A;  1VQ8 I;  1HKT A;  4KA4 A;  1FBU A;  4KMF A;  2EA2 A;  4O3M A;  4G7O F;  2G7H A;  4M9S A;  3AKZ A;  1PVE A;  3G3Z A;  2DQR A;  2V9K A;  4C2U A;  1HDD C;  2UWM A;  2CJJ A;  5FD5 A;  3ZOB A;  3IL2 A;  1FP1 D;  5J4V A;  3OL3 A;  3MWM A;  1X2N A;  4W97 A;  1A6I A;  3CCM I;  2Y69 H;  3MKL A;  3GLL A;  3DKW A;  2WV1 A;  2A5W A;  2I10 A;  5FKL A;  2A61 A;  2JMW A;  5IP6 A;  4A3D J;  3DCF A;  4UHT A;  1OFC X;  5KCM A;  3VOD A;  2JVH A;  4CSW A;  3A01 A;  3RKQ A;  1X4P A;  4L5J A;  1QBJ A;  5HLH A;  1IXR C;  2X48 A;  4HLY A;  2EFN A;  1R5G A;  3OIO A;  2HQN A;  1ETX A;  1OCC H;  4ZYG A;  2ZNZ A;  3GLX A;  4KYW A;  3GTP J;  2R7R A;  3ECO A;  4KT6 A;  2D5V A;  1QO0 D;  1YRN B;  2STW A;  2EIK H;  2DMP A;  4XM3 A;  1VQK I;  3ZQQ A;  3PMI A;  4M3E A;  4F9K A;  1QU3 A;  2BYV E;  1UHM A;  1WHU A;  2V79 A;  1TWF J;  1X58 A;  2KZV A;  4CZZ A;  5C44 J;  2L2O A;  2CQT A;  1I27 A;  2IGO A;  2F6C A;  2Y48 A;  1KYZ A;  1MSF C;  2HYG D;  1WJC A;  4BL0 B;  2ZJP F;  2DAO A;  4ZZL A;  5LLQ A;  5GAG J;  2VJI A;  3SDB A;  1UHW A;  2MH2 A;  1E3P A;  3LWF A;  1A5J A;  2P7C B;  4RM3 A;  4HST A;  1T6S A;  1MDM A;  1HF0 A;  4A93 J;  1NG6 A;  3ZPL A;  3V7R A;  3N05 A;  1SAN A;  2J5P A;  5IOY A;  1P7J A;  4C2M J;  1JT0 A;  1CF7 B;  3TQN A;  1W1W E;  5JFR A;  3PO3 J;  4BAC A;  3S17 J;  5CLS A;  3S2D J;  3ERE D;  4XOT A;  4XBF A;  4MFD A;  2R7T A;  3BR6 A;  3MZH A;  2QM3 A;  2ZSH B;  2X6O A;  4YRV A;  1Y0N A;  2DA5 A;  1Q1H A;  2F4M B;  1Z9C A;  2FML A;  3FM3 A;  2XGE A;  4KMU X;  3ZQG A;  4MEY F;  2XIG A;  2ZJQ F;  3HL2 A;  4N9I A;  2COB A;  5B1A H;  2LRE A;  3H0G J;  1HKQ A;  3QPT A;  3HKZ N;  5E3L A;  1XCV A;  4BQN A;  5ICE A;  2HS5 A;  4UUS A;  4UUV A;  3QU6 A;  5DCF A;  3IH3 A;  2L01 A;  1XG1 A;  4KNY A;  1BR4 A;  2VBY A;  3PO2 J;  3OIP A;  3W2V A;  1ZH5 A;  4HNV A;  2H94 A;  2H27 A;  4BHB A;  1VFC A;  4Q47 A;  3OYA A;  3OYK A;  1MZB A;  1T08 B;  1ZG3 A;  1X3W B;  2IGK A;  3KYL A;  3KP2 A;  1A35 A;  3CCQ I;  3TOB A;  4CCK A;  3E7L A;  1R22 A;  2IA2 A;  2HGC A;  4B4C A;  5FO5 A;  4E7J A;  2PMZ A;  3FXO A;  1T0F A;  2Z9O A;  1K7A A;  3F8N A;  1XSX A;  4G12 A;  4OAZ A;  2DMU A;  2PJP A;  3GBG A;  5DTD A;  1MD0 A;  5CVI A;  3PJR A;  2FD5 A;  2LY9 A;  4BBR J;  1USS A;  1V5F A;  2Y30 A;  4IQJ A;  2P81 A;  3A03 A;  3HRM A;  5GTI C;  2LNB A;  4M3B A;  4Y17 A;  1D1C A;  2LFB A;  3I56 I;  1OCP A;  2I5U A;  2L4M A;  4XOP A;  4L9N A;  5K7F A;  4BJ5 C;  1BC8 C;  1WH7 A;  2OCC H;  4F52 A;  1IZ1 A;  2BV6 A;  4V19 K;  3C1D A;  3ZR8 X;  2VIX A;  1N77 A;  4Q5S F;  2NVQ J;  2PMZ N;  2XAF A;  3HOZ J;  2JVG A;  2DU9 A;  3CCS I;  1FYM A;  2JN6 A;  1FY7 A;  2IW5 A;  1ULY A;  3P9C A;  5L3F A;  4IZZ A;  1VQN I;  2HQA A;  1X1P A;  1IRZ A;  1XB4 A;  3GF2 A;  4BDZ A;  2VON A;  2LF7 A;  3A4C A;  3BG3 A;  4DBR A;  3OL4 A;  4IPA A;  4QPQ A;  3ISP A;  1AKH B;  3OYF A;  1E0E A;  5DUI A;  2M3A A;  3I0T A;  1DPU A;  1FOY A;  1JHF A;  3CCE I;  4PGG A;  5LHG A;  2BXZ A;  4OAY A;  2W1O A;  1TBX A;  5ERI A;  3HBL A;  4A3B J;  4WCG A;  3AFJ A;  1QPM A;  1MBG A;  3E6D A;  4U7D A;  4BXU A;  2RAE A;  3ZMV A;  5IOZ A;  4L0Y B;  3EUA A;  1R7J A;  3Q5F A;  2VE8 A;  3K0L A;  3JAM K;  3WU1 B;  1FT9 A;  3H9Q A;  2HXO A;  3SXY A;  2X6W A;  1MBF A;  5D6F A;  1SFO J;  2BHZ A;  4LLL A;  2P5V A;  2STT A;  3W6J B;  3DU6 A;  1FSE A;  4UVC A;  5HNF A;  3Q0W A;  4A3M J;  1X2M A;  3GTK J;  1Z7L A;  1ZKG A;  1FBS A;  2XAG A;  1JKO C;  3S2W A;  2R5Y B;  2DOE A;  2XPU A;  2XAJ A;  2M1B A;  3HTU A;  3ZCO A;  5K1Y A;  4KIG A; 
#chains in the Genus database with same CATH homology
 2HDD A;  3CCY A;  4IHW A;  2JA7 J;  1FEX A;  2VKE A;  1POG A;  1K61 A;  1IJW C;  1YRN A;  2L7F P;  5FLV A;  1ZR2 A;  2WAQ N;  1G2H A;  4J19 A;  3BTL A;  3BR0 A;  1JJ6 C;  2O8K A;  1UHS A;  2ECC A;  4AUX A;  5M5Y J;  4X6A J;  2DA1 A;  5DS9 A;  2LLK A;  2JA8 J;  2B63 J;  3F0C A;  2CRG A;  3FK6 A;  1HCR A;  5K7H A;  1OCT C;  2CQX A;  5EGO A;  2M34 A;  2RQY A;  1Z77 A;  5GPA A;  3UFE A;  2EZI A;  3BTJ A;  1D5Y A;  4FIS A;  4A3F J;  5BNG A;  2G0E A;  4JYK A;  3S1M J;  2ME0 A;  1NTC A;  5JLX A;  2GM4 A;  2HOT A;  3NAU A;  2CBG A;  2OUT A;  3BQY A;  3FIS A;  3HOW J;  4XRS G;  3ZQH A;  4LOC A;  4DW6 A;  5J1R A;  4D7N A;  5EG0 B;  1W0T A;  4B3A A;  1PUF B;  1BA5 A;  2CUF A;  3SDG A;  1MBH A;  2HXI A;  1H89 C;  1MBK A;  2L9R A;  1IDZ A;  1TWC J;  4JX4 A;  5FKN A;  1CQT A;  2KDZ A;  3Q0U A;  2LVS A;  4Y7N J;  3BTI A;  4MLO A;  4C3J J;  1AU7 A;  3K2A A;  1R9T J;  1JTY A;  1TWA J;  1JUS A;  1GDT A;  5F0F A;  3RQI A;  2DA3 A;  1JGG A;  3TW7 A;  3BG5 A;  2EZH A;  2XGC A;  2LP0 A;  3I4N J;  4IHV A;  3BR5 A;  1GV2 A;  9ANT A;  1QPI A;  1UG2 A;  1ETK A;  4V2F A;  3JRD A;  2M0C A;  5FKM A;  3D1N I;  4MFE A;  3HGY A;  3CDL A;  5FKO A;  4IHX A;  5FLM J;  3GTJ J;  3HOX J;  4XRS A;  3LOC A;  1LFU P;  5GP9 A;  2ECB A;  3HGG A;  3GTO J;  2DA4 A;  3LSP A;  1JKP C;  4BBS J;  2ID3 A;  1RET A;  1QVT A;  2EBI A;  1RES A;  2XB5 A;  4S0H B;  3SFI A;  1ZQ3 P;  2HYJ A;  1MBE A;  3RZO J;  3SJM A;  2H1K A;  1VF9 A;  1MH3 A;  1B72 A;  1JTX A;  3JRH A;  2E2J J;  2R5Z A;  1E3O C;  2ELK A;  3G1M A;  2EZK A;  1WI3 A;  1WCM J;  2YUS A;  4A3I J;  3L1P A;  1JUM A;  4D7M A;  3S1N J;  1LE8 A;  3IH4 A;  1FJL A;  5IP9 J;  1T56 A;  3JRE A;  4UUT A;  2WB1 N;  4UUS B;  3K7A J;  2EH3 A;  3BQZ A;  4AC0 A;  2L7Z A;  3B6C A;  2FX0 A;  5FKK A;  3H3V K;  4C3I J;  3TED A;  1ZTR A;  4A3C J;  4BKX A;  3LSG A;  4IEJ A;  3MN2 A;  4XRM A;  2LKX A;  3JRI A;  2M2E A;  2DA2 A;  2LR8 A;  2XB0 X;  1FTT A;  5C4J J;  1EF4 A;  3FIW A;  4A3L J;  2M8G X;  3QPL A;  4M3F A;  4CYC A;  3I4M J;  2DMN A;  2NVT J;  1IG7 A;  4A3G J;  2JK3 A;  2R7Z J;  5IYD J;  3B6A A;  1MNM C;  3FKI J;  3OSF A;  1MSE C;  1AKH A;  2QCO A;  2HOS A;  4FE4 A;  3ZQC A;  2Y0S N;  2XGD A;  1UMQ A;  3FK7 A;  2AO9 A;  4C3H J;  5M3M J;  4I6Z A;  1Z0X A;  1IUF A;  4M3G A;  2XPW A;  5F1J A;  4MO7 A;  2VPR A;  3HDD A;  2HQ5 A;  3GTM J;  5J1U A;  1RR7 A;  3TP0 A;  2K40 A;  4D5F A;  3JR9 A;  1B8I B;  1Q1V A;  1RKW A;  4FE7 A;  3WHB A;  5FJ8 J;  3W6V A;  1WGX A;  5F08 A;  4XIC A;  1BW6 A;  2E1O A;  4DYC A;  2YS9 A;  1XS9 A;  2K9S A;  2R5Y A;  2NS7 A;  1K83 J;  4XID A;  5EEA A;  3ZQF A;  2CUE A;  2MGQ A;  2LTP A;  2ID6 A;  3HB9 A;  4B1R A;  3HOU J;  2HI3 A;  3S14 J;  3HOV J;  3CMY A;  1S7E A;  1GUU A;  1WH5 A;  2FJ1 A;  2X9D A;  4RBO A;  5F27 A;  2XPV A;  3Q3S A;  4RDU A;  2Y31 A;  1ITY A;  3JRA A;  4BY7 J;  1DU0 A;  3BG9 A;  2DJN A;  2NOG A;  3IV5 A;  1F36 A;  3JRG A;  4DYR A;  2R5Z B;  1ZGW A;  5EYR A;  2CB9 A;  1I50 J;  2KT0 A;  4MIM A;  2LK2 A;  4ABZ A;  1ETW A;  1IDY A;  2VKV A;  5M5X J;  1LE8 B;  1HDD C;  2CJJ A;  2JJ7 A;  3ZOB A;  1X2N A;  2K9Q A;  2ZB9 A;  1A6I A;  1HDP A;  3CQZ J;  2IEK A;  4W97 A;  1T33 A;  3MKL A;  5J1Y A;  4EEF G;  3BR2 A;  2R93 J;  2WV1 A;  5FKL A;  2I10 A;  2JMW A;  3QQA A;  5IP6 A;  2W48 A;  4A3D J;  3DCF A;  1OFC X;  3A01 A;  1BL0 A;  2HOA A;  3RKQ A;  2DMT A;  2X48 A;  1PUF A;  1QRY A;  3OIO A;  5EDN A;  3JRB A;  1ETX A;  2K9N A;  3GTP J;  1U9N A;  1ETY A;  4L5E A;  1RPW A;  2DA6 A;  4CYC B;  2D5V A;  1TC3 C;  1YRN B;  5M3F J;  1HLV A;  2DMP A;  3O8G A;  3G1O A;  2M9H A;  1NK3 P;  4NDL A;  3PMI A;  4M3E A;  3LSR A;  1F43 A;  1RKT A;  4JX6 A;  1JUP A;  1QVU A;  4XK4 A;  5IYB J;  4JP0 A;  1TWF J;  1X58 A;  5C44 J;  1APL C;  1U8B A;  4FTH A;  2E19 A;  1GV5 A;  1MSF C;  3S1Q J;  2VI6 A;  3BT9 A;  2R0Q C;  3S15 J;  5EGO B;  3BR1 A;  5J3L A;  2LD5 A;  1JKQ C;  2EZL A;  3DEW A;  2O7O A;  1A5J A;  2N8G A;  1HF0 A;  2DN0 A;  1ENH A;  4A93 J;  1ETO A;  3NAR A;  3S1R J;  4GFB A;  1SAN A;  1U9O A;  5IOY A;  2Y9Y A;  5C4X J;  2GLO A;  1P7J A;  4C2M J;  2MSY A;  1JT0 A;  5HOD A;  2NVY J;  3PO3 J;  4QIW N;  3QPS A;  2EQR A;  2ME6 A;  2R92 J;  1IC8 A;  3S17 J;  1MH4 A;  3S2D J;  4MFD A;  3HM5 A;  3BR6 A;  2MG4 A;  4A69 C;  1BJZ A;  1AHD P;  3JRC A;  5IPA A;  5F0C A;  3BTC A;  4M6V A;  2X6O A;  2XSD C;  2JA6 J;  3ZQI A;  1O4X A;  1I6H J;  2DA5 A;  1FIA A;  1TWH J;  2XGE A;  3ZQG A;  5EZH A;  2DA7 A;  5E3M A;  1HOM A;  2COB A;  2YU9 J;  1BW5 A;  4DZJ A;  3H0G J;  1IV6 A;  1FIP A;  3HKZ N;  2H8R A;  1I3Q J;  5E3L A;  4DZP A;  5IYC J;  4X1E A;  2QF7 A;  4UUS A;  1TWG J;  2O9L A;  3IH3 A;  1XG1 A;  5M5W J;  5E3N A;  2DTZ A;  4M3D A;  4IHY A;  3PO2 J;  3M4O J;  2NS8 A;  3LNQ A;  3TP3 A;  3IH2 A;  4HNV A;  2JA5 J;  2KNG A;  4A3E J;  1VFC A;  2TRT A;  2DMQ A;  3A01 B;  3RZD J;  3E7L A;  3GTQ J;  3UKG A;  4FCY A;  4B4C A;  1B72 B;  3S2H J;  1P7I A;  4G12 A;  1W0U A;  2DMU A;  3GBG A;  5DTD A;  2OPT A;  3G1L A;  2FD5 A;  2LY9 A;  1ETQ A;  1ZK8 A;  4BY1 J;  3Q0V A;  2OF7 A;  3HOY J;  3TW6 A;  4BBR J;  2Y30 A;  2NVX J;  2P81 A;  3A03 A;  3C2B A;  4M3B A;  1VND A;  2LFB A;  1OCP A;  1FTZ A;  4I76 A;  1ZR4 A;  5K7F A;  3GWH A;  1WH7 A;  4Y52 J;  5JLW A;  2CU7 A;  3O8H A;  2L0K A;  4QSH A;  1GVD A;  4V2G A;  4A3J J;  3GTG J;  1B8I A;  3OSG A;  1H8A C;  5EG0 A;  2MW8 A;  3OOU A;  2NVQ J;  4DYQ A;  2PMZ N;  3S16 J;  3HOZ J;  2TCT A;  1JT6 A;  5EF6 A;  3JRF A;  2JN6 A;  2IBD A;  2E2H J;  2IAI A;  1MBJ A;  1JJ8 C;  1ORK A;  1IRZ A;  2L7M P;  3BG3 A;  3WHC A;  1IGN A;  1AKH B;  2CQQ A;  1GT0 C;  4A3K J;  5F04 A;  3LSJ A;  1JKR C;  5E3O A;  3A02 A;  2VUM J;  4W1U A;  1ETV A;  3HBL A;  4A3B J;  4D5C A;  1MBG A;  3PM1 A;  2RAE A;  5IOZ A;  1Y1W J;  3MVP A;  1VI0 A;  2GBY A;  1XC5 A;  5K7Z A;  1Y1V J;  2HXO A;  1U78 A;  3M3Y J;  1MBF A;  5GPC A;  1H88 C;  1SFO J;  1DU6 A;  5IP7 J;  2XRL A;  4QTR A;  3VPR A;  3HEF A;  3GTL J;  2FQ4 A;  3Q0W A;  4A3M J;  5F0H A;  1X2M A;  3GTK J;  2JWT A;  1LFB A;  2Y9Z A;  4BXX J;  1ZKG A;  2Y2Z A;  3ZQL A;  1JKO C;  1WPK A;  5EZG A;  2R5Y B;  2XPU A;  3BR3 A;  1OJL A;  2E2I J;  1NK2 P;  4AYB N;  4JX5 A;  5C3E J;  2AHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...