2CBGA

Crystal structure of the pmsf-inhibited thioesterase domain of the fengycin biosynthesis cluster
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
210
Chain Sequence
SAAGEQHVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITEIQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGIQTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNILDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FENGYCIN SYNTHETASE
publication title The Thioesterase Domain of the Fengycin Biosynthesis Cluster: A Structural Base for the Macrocyclization of a Non-Ribosomal Lipopeptide
pubmed doi rcsb
source organism Bacillus subtilis
total genus 69
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.40 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2cbgA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cbgA01
3QMWA 2CKMA 3AIKA 5K3FA 1ODSA 3UUFA 5CMLA 4W1SA 4AZ3A 4J3JA 4KE6A 1H2XA 4C4XA 1ORVA 3W9BA 3IUQA 1ZI8A 3VXKA 4CFSA 2CJPA 3SC2A 2IITA 3H2GA 1QTRA 4U2GA 2XQJA 4NVRA 3SK0A 2WKWA 1N5RA 4OYLA 1THTA 3VJLA 4E15A 5ALPA 2OAEA 3R3ZA 3WK4A 1BRTA 3I28A 1UK8A 2J3QA 1YB7A 3HABA 3V1KA 2ECFA 2CBGA 2PKYX 1UK9A 3R3YA 1XZIA 3M83A 1E89A 4JYMA 4F60A 3C70A 2C7BA 4DLNA 3EF3A 5IVHA 4L0CA 4AO6A 2HA5A 1EVQA 3R3VA 2DCMA 1ODTC 3KWJA 4IH1A 4AMZA 1XLVA 2XUQA 3Q8WA 1ORWA 4QLOA 2PU7A 2PSFA 1EDDA 2XE4A 3DKKA 4CIAA 4CG2A 2JGIA 1EA5A 1UOPA 1H2ZA 1CUAA 1UKCA 3BE8A 4ZI5A 1ZGCA 3G8YA 2O7VA 3HJUA 1QIKA 2Y6VA 2FX5A 1ZI9A 4UBJA 3C6ZA 4BC0A 1IZ8A 1U65A 1J07A 3IIIA 2Y2VA 2WTNA 1KU0A 3DNMA 1OILA 3GBSA 3C8DA 3MGAA 3DJYA 4QWMA 3W04A 2BAGA 2HRQA 4AB1A 1CUIA 4B85A 2C0PA 3WK8A 3IUMA 2WU4A 3BJMA 1CEXA 4H35A 1DQZA 4ZREA 1Q0RA 4RNCA 3IURA 2Z8XA 2WILA 5JD6A 3I2JA 5DWDA 1ZD4A 4E46A 5FKJA 3LLCA 1UZAA 1W6RA 5E4TA 4HRXA 2JEZA 2OLEA 5JD5A 1ISPA 3BIXA 1XRPA 2DQZA 5I8PA 3H1BA 2HU5A 4Y2JA 1EHYA 3W2TA 2EDAA 5ALDA 4BBZA 4X6YA 3A2MA 4ARAA 5A7FA 4WDRA 2X76A 1JMYA 3I6YA 4CG3A 1SFRA 1XQYA 3WZLA 3WK5A 4J0CA 5ALEA 2WUFA 3DD5A 4EB0A 2B4KA 2XMCA 1LPNA 4Q34A 2XUHA 1W75A 3DDUA 3W06A 1AMNA 1XRMA 2FUKA 2QM0A 3VVLA 1LBTA 1UWCA 3PUHA 4G8CA 1VE6A 2C5FA 2XMSA 4GWLA 4UBKA 2BKLA 1HQDA 5AO9A 4GW3A 4B80A 4MYSA 3QVMA 3WWDA 5AK6A 5IVIA 3MUOA 3N2ZB 1AGYA 1LPPA 4NS4A 4B84A 5CURA 4W63A 5K3FB 1F8UA 5T4EA 3L1HA 1TQHA 2PSHA 3GUUA 1H22A 3A2LA 4IO0A 4RGYA 4M0EA 1WM1A 2UZ0A 3SX4A 4B83A 3M81A 5H3HA 3E0XA 5J3JA 4HRYA 4KJXA 3IB3A 3PI6A 2ZJFA 2I3DA 4L9AA 3KWFA 4Y2PA 2HADA 5SYNA 2WUDA 2H9YA 4H7KA 3I1IA 1L7QA 4BTLA 4BATA 3C6XA 3NWOA 1YAHA 1MAHA 4M0FA 3F9CA 5LLSA 1QIGA 3ESDA 4GXNA 4UBMA 4B82A 1DU4A 1XKLA 4H7JA 4Z49A 2DQYA 3EBLA 4WDQA 2ZYRA 2BGRA 4BP8A 3H2KA 2BJHA 2CEKA 3V48A 1FFAA 2QUBA 2XUIA 4ZV9A 1QIMA 1CVLA 3STWA 3T4UA 2NW6A 2V96A 4N5HX 1XZDA 3OC0A 1GKLA 2ZSHA 4CG1A 2WIDA 4IQ4A 3ILSA 1XZKA 1J1IA 3RKSA 1R3DA 3PFBA 5A6VA 5EIHA 3WYDA 5AM1A 5AI4A 5EFZA 1MX9A 5CH8A 3QMVA 1LZKA 1WPXA 1X70A 1RP1A 2QZPA 1QIHA 1YSCA 5ALGA 5ALTA 2VQ6A 3GZJA 3AFIA 3H19A 4YPVA 1VA4A 1GXSA 4LKOA 1VZ2A 3HYSA 4Q3KA 2BGNA 3VJKA 5HKBA 1JU4A 4DMFA 4BE9A 4MXDA 1SCIA 3C45A 2OGZA 5ALUA 1LPMA 1QIEA 2XQFA 5KBYA 3KD2A 3M3DA 4J03A 4JH0A 3G0BA 4BYMA 1TRHA 3QM1A 1HDEA 1CPYA 3K2IA 4HZGA 3ZPXA 1WHTA 2G4LA 1KU6A 4N8DA 4A5SA 4BVLA 1IZ7A 2GBIA 4X94A 4X97A 4OYYA 1CUWA 2LIPA 1VXOA 3DOHA 1F0PA 5T4BA 1P0QA 1ZIYA 4GDMA 1K5PA 1FSSA 2HA4A 3AZOA 4FBMA 4F0JA 2YXPX 3ZV7A 4X6XA 1LPAB 5ALXA 5C8ZA 5C8XA 1TCCA 1MAAA 1UK6A 1K6EA 3IA2A 3OG9A 4BVJA 1J2EA 3FCYA 4ZGBA 3H2JA 3C6BA 5AKJA 2YASA 5ALSA 5D6OA 4EY4A 6YASA 5AK3A 5HF6A 2ZJ6A 1WB5A 4Q3OA 5IVDA 2B9VA 1SCKA 4F5ZA 4P9NA 4E11A 4QDOA 2JGKA 3STTA 1ACLA 4HXEB 4YX9A 2I3ZA 5ALMA 4QZVA 1Q0ZA 4WFIA 1AKNA 1ZOIA 1YASA 3MUNA 5JYCA 4G9GA 2OQIA 4UHCA 4OB7A 1U8EA 3WQHA 2RHTA 5KREA 4K6HA 3IVMA 3H17A 2EDCA 2XUPA 4HXGA 4OB8A 1YAJA 3DL4A 1CUYA 2WIFA 1WPRA 4G4GA 1WCYA 3HI4A 3K9BA 4TPKA 3ZWQA 3F67A 3R3XA 1EVEA 5AP9A 3B12A 2QUAA 4V2IA 5CXUA 5KWIA 4P08A 2WG2A 4OU5A 1E3QA 2OXEA 1QZ3A 2ZSIA 1R1DA 3GELA 5HQ3A 3BJRA 3CCBA 2Y1KA 2RONA 3F98A 5CT4A 1P0PA 2I78A 3HACA 2XMBA 3I2HA 1R9NA 1H2YA 3E4DA 4X3CA 4UBNA 4LIPD 2JGMA 1DWQA 1E8MA 2AJBA 1N8SA 4ZXFA 3CN7A 4WY5A 3TJMA 4EA6A 3H04A 1QJ4A 4X71A 5AKIA 3WA7A 5AK5A 3I1YA 4DSZA 3VDXA 5LKRA 1ZD3A 1ZGBA 3FSGD 1ODCA 3WWCA 2IIVA 4H7DA 1VA5A 1CR6A 2B20A 4JNCA 3JYHA 1T2NA 3P2MA 5AKEA 4W1PA 3QPAA 1P0MA 3WKCA 4N8SA 3WKAA 2Y6UA 2OGTA 5FXMA 5AI0A 3WWOA 4I19A 1E8NA 4XIIA 2VJAA 1Y7IA 5ALFA 5HCUA 4LXGA 4J0KA 2WFLA 4BZZA 2C58A 2HU7A 2RIPA 2VJDA 3FYUA 3RLIA 3GROA 4BDTA 1Q84A 4C4YA 2JGJA 1MO2A 2Z5GA 4QDXA 2OG1A 3QBJA 4BP9A 4X93A 3AILA 4EY8A 1R9MA 3DOIA 4I3FA 4ZRDA 4RE5A 2RAUA 5FPPA 3OM8A 2R8BA 3GA7A 3ZLTA 1DINA 5JZ9A 1GQSA 1VOTA 2PBLA 3R3WA 1LZLA 4PSUA 1MT3A 2VF2A 5EIAA 4DIUA 2VSQA 2HA0A 4GBGA 4X7BA 3WKDA 3AUKA 4QA9A 5A2GA 5AKLA 4EHBA 3D7RA 3DEAA 3WL5A 1EB9A 2BCEA 5AJHA 1L7RA 5AI8A 1E66A 2Z8ZA 3AZQA 1A8QA 2QRUA 2XUAA 3YASA 3R40A 1F0NA 4EY7A 5EI5A 2QXTA 3BF7A 1MN6A 4ZV7A 3UUEA 1DTEA 5AI6A 1BN6A 4YK7A 4Y7DA 3WK6A 3M82A 1HLGA 1YCDA 5ALIA 3VVMA 1J06A 4IH4A 5E2IA 2O2HA 5FLKA 5AKKA 2XUGA 1XQXA 4QLAA 4KEAA 2WQZA 1CUVA 4G4JA 1QO9A 2WHPB 2VAVA 3DYIA 4MYDA 1WB4A 3RK4A 5JAOA 1C7IA 4GECA 1LGYA 3AZPA 4DMCA 2XLBA 1W4LA 3PF9A 2FJ0A 2XQIA 2PSDA 4HTAA 3D0KA 4OSEA 2JBWA 1YB6A 1LPBB 5A71A 1DT5A 2VJCA 3H18A 4X92A 3STYA 2BUBA 4IHAA 3JWEA 3HRHA 3KSRA 4BCCA 5C8VA 3HXKA 2WM2A 5AIBA 1VE7A 1CUCA 5AM0A 1W1IA 5CT8A 4KR0A 2CB9A 3TEJA 3LP5A 3U0VA 4L3WA 1XZAA 5DTJA 1YA4A 4PSCA 5FV4A 4KRYA 5IKXA 4UFNA 4BCBA 1XQVA 4X95A 5ALJA 3VISA 4UFPA 1N5MA 5AIAA 2GYUA 2HM7A 2PSJA 2O2IA 4OPMA 4Y2YA 3EIOA 3WLAA 1AQLA 1THGA 5ALWA 2OPHA 3WK7A 2WHRA 5CBKA 2QJWA 5K3BA 1CUZA 3GFFA 2W6CX 4FNMA 4BZWA 4C6HA 2XI4A 3D2CA 2CMFA 1GPLA 5EHQA 4Y2SA 2QR5A 3E3AA 4FKBA 3WZMA 3PE6A 4B81A 5T4FA 4F21A 1DT3A 3EQ8A 1Z68A 4UBLA 4OD0A 3OURA 3H1AA 2XB6A 3WIOA 2P8SA 3V9AA 4UHEA 4EZIA 1GPKA 3QMMA 1F6WA 1QO7A 5ALYA 5I9IA 1B41A 4QDUA 2WG0A 3QPCA 2WTMA 2HA6A 2J4FA 2QVBA 2QXUA 3FVTA 4UBIA 3DCNA 5BWBA 5BV7A 3JW8A 5ALHA 1MX5A 4RPCA 3C5VA 1CV2A 3T52A 2VATA 2H1IA 1XZMA 1OCEA 2WG1A 1DX4A 4UHHA 4HXFB 1LLFA 4WY8A 3IDAA 4CIBA 2XUDA 5SYMA 4QDTA 3WJ1A 2X5XA 2WFZA 1FJ2A 2PM8A 5AM5A 5FDFA 1O6GA 4DM7A 4FLEA 1ZI6A 4Q82A 5HFNA 3C5WP 1HL7A 4DMHA 4DNPA 3NGMA 4UPDA 4G5XA 5JALA 1U4NA 3A2NA 5LP1A 5C7YA 4AQDA 3ANSA 3DQZA 5AOCA 4U2FA 5EHNA 2VEOA 4K2AA 4UHBA 1R50A 5ALVA 5AI9A 3PDCA 2W22A 3WKEA 1JJIA 1XROA 1R4ZA 2WLSA 3ZI7A 1H2WA 1CUGA 5I7UA 3D4LA 1TAHA 2XDWA 3VKFA 4C87A 3I2KA 2DR0A 5D7BA 2ACEA 2RI6A 1JMKC 1YS1X 5K3AA 1NX9A 2C0QA 5JATA 5HF5A 4DSAA 1TCBA 4HAIA 1CQWA 3X3HA 4O08A 2PU5A 4HS9A 4KE8A 1JJBA 4FFWA 2QKYA 3RM3A 1NU6A 2DHCA 2WHQA 4G8DA 4GLBA 2XUOA 5T4HA 1EDBA 3CCCA 3WK9A 1IVYA 3Q0TA 1UOOA 5AKGA 1XQWA 4C89A 1LNSA 3LIIA 1CFJA 4MWTA 3FYTA 4KE7A 4Y2RA 1CRLA 2YH2A 3KDAA 5K3DA 3O0DA 4H18A 3C6YA 5JZSA 3STXA 1Q83A 3G0GA 5DYWA 2C4HA 4XX1A 1K8QA 4UHDA 3I2FA 4G1FA 2WSLA 3A70A 1UT6A 3F97A 3WYNA 1A8UA 3PFCA 1WOMA 1XZCA 2ZYIA 3QYJA 3G0CA 4TGLA 4Y2QA 4Y9SA 4J0HA 3O95A 4K5QA 4FMPA 1A88A 3ED1A 4J0DA 4Y2XA 5AM4A 5LZ8A 4EUSA 1XZJA 2HA2A 4JUIA 4PQEA 3QH4A 4W1RA 3G0DA 4UFOA 2D0DA 4QNNA 3D2BA 1TCAA 2VA9A 2JEYA 2GBGA 4FOLA 1SC9A 3QPDA 4BB0A 2RHWA 4KYVA 1USWA 2XT0A 5CH3A 1SCQA 4H7HA 3WL6A 1FFBA 2DFPA 2J4CA 4LHEA 3C8HA 4G9EA 3KXPA 1QTIA 3OPMA 3BL8A 4U2DA 1YS2X 3ICVA 4U2EA 3S2ZA 4CCYA 1XRRA 4X6UA 4AZ0A 3STUA 1G42A 2X8BA 2XUKA 3HLKA 4B7ZA 3WA6A 5DLPA 5DNUA 3WL8A 4RE6A 1FFDA 3N0TA 4JEIA 5A62A 5AKXA 1BCRA 1Y7HA 2I03A 3AIMA 4AMYA 4PV7A 3O4JA 5LYYA 3PUIA 5EIEA 4EY6A 2BUCA 3G02A 4J7AA 1B6GA 4ETWA 1TIBA 3O9VA 1BS9A 5KWJA 5JARA 5K3EA 1RYYA 2WJ3A 3FWHA 3AIOA 2PUHA 3VJMA 1XZGA 3BDIA 1QOZA 2HL6A 1QFSA 4ARBA 2HA7A 3L1IA 1BROA 3WWEA 4BTVA 5DTIA 1M33A 5E4YA 2Q0XA 2XUJA 4DMKA 2HIHA 4WFKA 3NOXA 2V97A 4PW0A 1VJ5A 5BWCA 2VT7A 5AM3A 1XZEA 2XUFA 3ESCA 1AC5A 1CUDA 4DGQA 3WWPA 5DNWA 2HFKA 2JGFA 3E1GA 2OCIA 2DHDA 1EB8A 1UXOA 3O4HA 2VTVA 4B9EA 4OB6A 4MJ3A 3TGLA 5ALKA 5CT5A 4ZWNA 1P0IA 3C87A 5AKHA 4DNQA 3PF8A 2GYVA 4LYEA 4B6GA 3G0IA 2J3DA 5JAHA 4DYHA 1MX1A 1XZFA 5D3KA 4AO7A 5JANA 4KACA 2HFJA 1RWQA 4WJLA 3IULA 4BC1A 1JI3A 2ROQA 3CXUA 4I4CA 1W76A 3FLEA 1JT2A 1MPXA 5ALNA 4W1QA 4AXBA 5FPQA 1A8SA 4FHZA 1AURA 2XQGA 3BF8A 3STVA 3S8YA 1ZD5A 5K3CA 4Q05A 2YYSA 2XQKA 2BFNA 1XLWA 1CUJA 4QEKA 5CXXA 3FLAA 3R0VA 1MU0A 4Q1VA 2H7YA 1O6FA 1YA8A 4Y2TA 3WL7A 1DWOA 4LXIA 3G9TA 4FTWA 5FP0A 2O7RA 3WI7A 5LZ4A 2QMQA 2PVSA 1ZIXA 3D59A 5DYTA 2XMGA 1N1MA 3NUZA 1XKTA 4BRZA 3V1MA 4PSDA 2B61A 1PFQA 1FFEA 1UKAA 1Y37A 3DL7A 4UUQA 4H77A 4X90A 5ALLA 3CN9A 1NU8A 2G63A 3A6ZA 4OCZA 1E8DA 4FNGA 3WKBA 1KEZA 2PSEA 2JGEA 3PICA 1DQYA 4INZA 1ZD2P 3OTQA 3W9UA 1BE0A 4X91A 5FRDA 5ALQA 5EHXA 1CLEA 1CUHA 1WB6A 3I2IA 5D3ZA 5CW2A 4H0CA 4JYPA 3O4GA 4BRSA 4KAFA 4LXHA 3ICWA 4BAZA 2WU3A 5EHZA 1VKHA 1JJFA 1LPOA 1UKBA 1EK1A 4K6GA 2C5GA 3H2HA 1QLWA 5CT6A 1CIJA 1XFDA 1XRQA 1GKKA 2WIKA 5EGNA 1GQRA 4G4IA 5HK9A 1HKHA 3I6MA 4L72A 1BEEA 5JZBA 2ZVDA 4EY5A 5C81A 1G5FA 1ZJ4A 1AUOA 3H0CA 4P92A 2OQVA 4NMWA 1R88A 2GZSA 2AJ8A 1JKMA 2HRRA 3FVRA 5K5EA 4AO8A 4K6KA 1IUPA 3L1JA 1XZBA 4BCDA 2ONCA 3EQ9A 5A7GA 3BDVA 5A7HA 4CCYB 4UBOA 1JFRA 4FLFA 4UHFA 5AOBA 5DNVA 4U2BA 4OUKX 4D9JA 3QITA 3ZLVA 4KAAA 4Y2VA 2CUTA 3B5EA 4QWWA 2PPLA 2PUJA 3FNBA 4G8BA 1GT6A 3BXPA 5LIPA 4C4ZA 7YASA 1C4XA 5AI5A 2HDWA 1OXMA 2AJCA 4X85A 5HQ3B 1S8OA 2XMDA 3G9XA 2V9ZA 1PJAA 5JADA 4Y2UA 1QGED 3D3NA 4DTCA 1VZ3A 1EDEA 1E5TA 1K4YA 2D5LA 4MWSA 4OU4A 1MNQA 5IVKA 1W52X 1GPNA 4H7FA 3AJAA 3OOSA 4N8EA 4MEAA 4BE4A 3UMJA 4CI9A 4ROTA 2HA3A 1UOQA 1X2BA 4BAGA 3V1NA 2OCGA 2G5TA 3LIPA 3H2IA 1EK2A 2JIDA 4FFVA 1IUOA 3IBTA 3KOOA 2WIJA 2WJ6A 3IUNA 2WFLB 3HZOA 2ORYA 2XMQA 5HFAA 3FYUB 5CH5A 4P93A 3G9ZA 4BDSA 1YR2A 5LZ7A 3DYVA 5BOVA 5DYYA 4KRXA 4AX4A 5AKYA 3R41A 2GBCA 2H7CA 3IUJA 1DX6A 2ES4A 3R3UA 1QIJA 4E14A 2WUEA 4U2CA 3BWXA 4WFJA 4MEBA 3O4IA 5HKAA 1EXWA 3B3QA 4PNZA 3BIWA 4C88A 2QOEA 2ACKA 4QE3A 3WIBA 2XLCA 4YASA 1UK7A 2G5PA 1EH5A 5LZ5A 1VXRA 4PO3X 2RGUA 3HSSA 2XMZA 5JASA 2DHEA 1VLQA 5LZ2A 4XVCA 2QJRA 5F4ZA 2XMRA 2AJDA 4J0IA 1QIDA 2OAGA 3K6KA 3RARA 3ESAA 1WHSA 4S0XA 1CUBA 1XZLA 2BUAA 2WUGA 1EINA 3FAKA 4GI1A 3LS2A 3TRDA 3FYUC 4DNOA 5JAPA 5LKAA 1I6WA 1C7JA 2ZJ7A 5ALRA 2QT9A 2K2QB 1QONA 1BCSA 1CUFA 2GYWA 2PL5A 4FWBA 4GHWA 1CUXA 3FCXA 3V1LA 3HC7A 1D07A 2IX9A 1QFMA 1PV1A 4XWGA 1QE3A 4BAUA 2AXEA 4EBBA 4TVKA 5CRIA 5AH0A 4QDZA 3DKRA 2HU8A 2JGLA 5YASA 2VAXA 2H7XA 4IH9A 1BN7A 1CUSA 2AJLI 1MTZA 5IH7A 5AKZA 5JAUA 4PF1A 3I6ZA 1QIIA 3FBWA 2VJBA 4DNFA 1MJ5A 3LCRA 5AOAA 1IUNA 2JF0A 3U1TA 1L7AA 3AINA 4Q3LA 4KAJA 5CTAA 5AHXA 1K63A 1ZJ5A 1HBJA 4ITVA 1FFCA 3DS8A 1EX9A 1AZWA 4N5IX 2HHAA 4BVKA 1EI9A 3FOBA 1CQZA 1CUUA 5FOQA 4MQLA 1XRLA 3G7NA 4WCVA 5HK8A 2FJPA 4W9RA 2WIGA 1AX9A 1G66A 5ALOA 4B0PA 1ZICA 2WHPA 1BEZA 1DWPA 4FBLA 2WFMA 1GGVA 4A16A 3FLBA 2OGSA 2OCKA 2DSNA 4H7IA 1G4HA 4B0OA 5ISMA 1XZHA 5FUMA 5HZGA 3SWWA 4B9AA 5AK4A 2PX6A 3ESBA 1LPSA 1GZ7A 4NZZA 1QIFA 2ZYHA 3MVEA 4A23A 1SOMA 3F96A 2GZRA 4HVTA 4C01A 5AICA 1UFOA 2R11A 2GBFA 1BU8A 3W05A 1TK3A 3WMRA 3D5EA 4FDMA 1H23A 4H7EA 1XRNA 2E3JA 3G9UA 4J0JA 5ESRA 1X2EA 4AN1A 5DJ5A 5CT9A 3ZLUA 5ALZA 1ETHA 5JIBA 3DLTA 1MNAA 3QZUA 4MQMA 4J0GA 4XJVA 5HF9A 1HPLA 5E4JA 2QTBA 1IMJA 4LYDA 2Z3WA 3F8SA 3I2GA 1U2EA 3D2AA 4M0MA 4FLMA 1TKRA 2CZQA 1ACJA 2QS9A 2ZYSA 1LBSA 3WJ2A 1CUEA 4AN0A 3EQ7A 5HF8A 1XLUA 3ANTA 4CCWA 2EEPA 2OCLA 2Z3ZA 2V98A 3C43A 2Y2UA 1T4MA 5AM2A 1A7UA 4X00A 3HEAA 5JD4A 4KE9A 2WJ4A 1JU3A 2VT6A 3O9MA 5LZ9A 3FSGA 2O2GA 4GEGA
chains in the Genus database with same CATH superfamily
1U2PA 2CMHA 2FP4A 3RVJA 4IIJB 1TTQB 4LPKA 1UBRS 1KI6A 2PFSA 3DP7A 3QXHA 3ZNPA 5JAMA 4G1BA 4ZA2A 2GM9A 5KJ6A 2PUCA 1CR2A 1C5KA 1JR3A 1EHCA 1P0FA 3BWDD 3DAYA 3QJYA 5K3FA 4REQB 3COWA 4A0HA 1OV6A 1W25A 1U2SA 1VL2A 2J9YB 3D7NA 4YRQA 5D8DA 5I3ZA 2RB5A 1PT9A 1USUA 3X1WA 3U6KA 1Q1ZA 2D4HA 2DBVO 4J3JA 4D96A 4EFKA 5C53B 1V35A 2I66A 3DG9A 4DLTA 1H2XA 2IZOA 5L4NA 4C4XA 1ORVA 4DANA 2FEMA 1XA0A 1W5AA 1LXCA 3QYFA 4B6FA 4R8SA 4YWHA 5JNRA 2ZGVA 3ZG6A 3JD1A 2HGSA 2K7FA 3JQFC 1R0RE 1L1EA 1G8SA 1Y1KE 3B1XA 5F9MA 3VXKA 1NUSA 1NC3A 4CFSA 4COOA 4IMJB 5B7QA 2WAMA 1ZOLA 2PX8A 2J6IA 2ZRMA 3BJIC 4UEQA 1SD5A 4EPXA 4MTLA 3PNYA 2IH2A 1WHSB 2L17A 4U2GA 2XKBA 3ER9A 4M7WA 5DBOA 1KSGA 5KOHA 2ZRAA 4YAGA 1PZXA 4ECEA 2W58A 2BEWB 3RRYA 3ES9A 1OD6A 1N7JA 1THTA 1XAGA 4LZOA 4RF2A 4L4XA 3GJTA 4ZTBA 3GV0A 5TJHA 3D0OA 2C9YA 4D8WA 3ADBA 1F7VA 3HI6A 3JD0A 1ISHA 3WK4A 1FF9A 2OXRA 2NU7A 2Z09A 3R3JA 1BRTA 1QYRA 4PU0A 3I28A 3OPNA 4F3CA 3S5JA 3N2KB 1PTJC 5EVCA 2OGWA 3OPYA 4J3FA 2PFKA 1GSAA 16PKA 1DC8A 1NE2A 3F6BX 1XCBA 2J30A 4GMGA 3MINB 3U26A 4Z49A 1A4UA 1ZCAA 4UU7A 4EO7A 3DTYA 3FPGA 2HAEA 3R3YA 1WXIA 4G0NA 4Y6OA 2XE8A 1I2ZA 4JYMA 4KWEA 2XXAA 3C70A 1W36C 3JQGB 1J24A 5JISA 1T26A 3Q9NA 5IANA 4C3ZA 3LDHA 5CA1B 4EF6A 5J9FA 4D56A 3WLNA 4O2LA 3CFYA 1NW4A 3KQOA 1RJDA 3KPWA 1SUPA 4GWGA 6AT1A 4ER3A 3ZJVA 1ESDA 4F4JA 5TC4A 4N41A 4ZAFA 1DG3A 2PL3A 1KYIA 2GBPA 3V4FA 5TQ0B 1XD2B 2HA5A 2QLLA 2WF8A 5LXTB 1FMTA 5AJUA 2D06A 4G1UC 3MD0A 4DCUA 1ADGA 1ORRA 4PAOA 4AMZA 4FFPA 3S7ZA 4G5YA 5DOVA 3B13B 3K8QA 2CUKA 2RGCA 7ABPA 2FPUA 4MUKA 3ZHVA 4C4SA 3GMTA 1KEPA 4XX0A 5EJMA 2OM2A 4M8IA 2XRFA 3AHFA 1KKMA 1EDDA 1KAHA 3A1SA 5KQRA 3DXZA 4CIWA 1NRJB 2ZIZA 2IP1A 5LN1A 2YZKA 4CG2A 4Y1RA 4YUZA 4Q4CA 2JGIA 2OYRA 2VF5X 1E4OA 4FYHA 3M33A 4I8IA 5LQRA 5JAQA 1SOVA 5ANRB 1QGOA 4EG1A 1LRKA 1UJ6A 4QPDA 1DC4A 3UO8B 1FDIA 4EUFA 1UOPA 1XNQB 3C3WA 3GK3A 1LI4A 1NHWA 4NAHA 1KE1A 3RNOA 3WLIA 1YB5A 4MO2A 2F4VB 2QV0A 4ZI5A 1VMKA 2R65A 2B4TO 1WV1A 4KQHA 4HFJA 2VQ3A 4URXR 2B1GA 3PNOA 4WGGA 3AI1A 1NOIA 4MVJA 1YCFA 3C4VA 4KXFB 2R1VA 3PXGA 2CL6X 4E5UA 1AM4D 1U0RA 4IZ6A 3GVCA 4H0FA 3RVKA 1QIKA 8LDHA 2ZLBA 2WC1A 1CG6A 1T3SA 2JI4A 2JS7A 1P4JA 4IGFA 4TN5A 3C6ZA 5CNKA 2PGNA 5BSMA 1D2RA 2P0EA 3IIKA 3EGOA 4WXMA 4BC0A 2IYYA 1BS1A 4L74A 4LHVA 1MV5A 3I42A 3SX0A 3U3DA 1IJKA 4GBJA 3IE1A 4V39A 5JFTA 3EIFA 1RAAA 5HGJA 1OXVA 1NXQA 1BZYA 2OO3A 3VOTA 2QN2A 1N3IA 2AK2A 3JTMA 3ZV6A 4IOKA 2CNWA 2IKQA 4JJGA 4YRJA 4GZLA 1A9XA 4B7AA 5FPSA 3HWRA 1FU8A 4JELA 2Z95A 3WGQA 3GEIA 1E2UA 3H86A 4KSCA 3II6X 4YI5A 4ZD6A 2RHGB 5B7NA 3GBSA 4AAYA 3ZHYA 4YAWA 2AE2A 3MGAA 3ZE6A 4EGAA 4ZHQB 2IIPA 1PD0A 4N3GA 4KQWA 4QWMA 4LFCB 3W04A 5C1OA 2BAGA 4LJ9A 5FWXB 4HWPA 4GOKA 1T0HB 5M34A 2H7VA 2H3EA 1VYUA 1O4WA 2ZUUA 4Q6BA 4WESA 5H70A 5ICFA 5J59A 4C0QC 2FW7A 1RI3A 4YC7A 3WK8A 1NFFA 1TEHA 2W6ZA 3BB3A 4Q1CA 1RBYA 3D9QX 3BIFA 3GCZA 1SKYE 2JAUA 4ERNA 2I9PA 4OBWA 2Z08A 2MSCB 1Q0RA 1JLSA 5CIWA 1UPAA 3KQKA 3FPLA 1TA9A 1B15A 1U7UA 4EFNA 1L7PA 1YKGA 1I0LA 1LDBA 2DSTA 2QQFA 3TVDA 3D02A 2ZANA 1KAOA 2A4MA 2PSSA 1ZD4A 2LRHA 4N49A 4XDGA 5G4LA 5FUVA 2PRZA 3FWZA 1W6RA 3HJNA 1IAQA 3MRTA 4W5QA 1XHFA 3FAZA 3OCCA 4LWOA 4Q3NA 2OLEA 4BVEA 3E58A 4K2HA 4WNYA 3BIXA 1XRPA 1UXKA 3VYWA 1P77A 2ZT7A 3K0AA 1ZUHA 3RC7A 5SY4A 3ZVNA 3KCNA 1RWVA 5E38A 1DO0A 1S02A 2KBFA 3LBIA 3VGPA 3LPNA 3OMXA 4PLYA 3QEBZ 2GVZC 1SKMA 3W2TA 3NHJA 3CVXA 4X1IA 1XF9A 3ZHXA 1CRQA 1XDBA 3GPCA 4YAJA 4BBZA 4X6YA 2QVLA 3U44A 2WIBA 4FU0A 2ZIUB 4MZDA 4Z2YA 5KJCA 4P5PA 1JDBB 1XL0A 2VSOA 1Z7WA 4IMPA 1KPIA 2Y3IA 2X76A 1BCRB 4IVPA 1SBNE 1XZQA 4ZYTA 3RJ9A 2IRWA 4GX5A 4QOJA 2M98A 3ZZ1A 1CW2B 2V9PA 2WFAA 2HMTA 5A3QA 4CG3A 1GKUB 2ZBRA 3A6KA 3EUEA 4CV3A 1VG9B 1ENPA 4GX2A 4N6GA 3WZLA 5C34B 3PA6A 1HRDA 4DIFA 13PKA 3WK5A 1A82A 1R9GA 5ALEA 2JZCA 1UBTS 2KB0A 2KM1A 1C29B 4BQNA 2XCRB 3W5SA 5AESA 3BWEA 1Z06A 2XMCA 3H11A 3OE4A 3EXEA 4ZOLB 4Q34A 3SJBA 5JH7A 3CZPA 5J43A 1EXDA 4UCXA 1T4DA 2FCRA 5JI2E 4BVAA 2FPSA 1ZCZA 1XRMA 4O4LA 1KYQA 5ICMA 2QM0A 5IT4A 2AFHA 3VVLA 2P6UA 3ITEA 1VKRA 2OZLB 1RCFA 1GWNA 1EK6A 1LBTA 2HF7A 3NC0C 2B5OA 1UWCA 4ER5A 3T1YB 1Q77A 4TSFD 3A3OA 4QJIA 1T5LA 4C0KA 4WXPA 2O8EA 2O2EA 2VUIB 4BPRA 4BBJA 4XVHA 1T1SA 2TMYA 4F5DA 3EF1A 2AD5A 2JZNA 3KPYA 1BW9B 3LUAA 4FFMA 4MJLA 1VE6A 4ERXA 3MFQA 4W9MC 1CP3A 1SUDA 3M3HA 3T3NA 3K09A 4G81A 4R1NA 4BFCA 3B2EA 3NM4A 4GWLA 4MYCA 2J9XB 3HLYA 5DNAA 2SECE 3ZBPA 1UAAA 2GCPA 4MUAA 1SBIA 4HNQA 1U2GC 3HG7A 3WIEA 1WBBA 1I5OA 4REMA 4XUCA 4PEVA 1VFPA 3MGGA 1I3OA 4HUJA 4DBLE 3JALB 1HQDA 5DF1A 5AO9A 4X1KA 1QKKA 2I1WA 1Q0TA 1GN8A 1TA4A 1TT7A 2P69A 2WYUA 1IEXA 1R8YA 3NIFB 3OX3A 1W88B 3GVHA 3GGGA 1IZZA 1YJ5A 2ONJA 3MQ2A 2QJTA 3AFGA 3P32A 4ND6A 4PC6A 3MUOA 3N2ZB 1AGYA 4MCIA 4WCFC 3EFHA 1LPPA 2C5AA 3FPBA 4NS4A 4AJKA 1X92A 3ZWOA 4NU6A 3I0ZA 4W63A 3PEYA 3ZKAA 1EEHA 3M4NA 1ZJYA 4I66A 2PJUA 3WFIA 3HDYA 4JI1B 1P17A 1H22A 4IO0A 3F4KA 2IOYA 3EYWA 3W9YA 4TTTS 2B30A 2OBMA 2C29D 4KCGA 4B83A 3M81A 1GADO 3FYDA 4RM3A 1D5CA 1U3DA 4CM6A 5CIYA 2ZUEA 4QM7A 4WZBB 3G2IA 2H06A 5DP2A 2EZUA 4NONA 3OESA 5J3JA 2BJVA 2DFVA 3A2KA 1ISRA 5DKFA 1NULA 1KS9A 1SHZA 3IRVA 4YJFA 1C8BA 5DGXA 2QG6A 2PVCA 1NNI1 3D3JA 4KJXA 2QHXA 1J8MF 3HNOA 2ZWAA 3CLHA 2O2DA 3F7MA 3K0CA 4UXHA 2FZ5A 1T6ZA 3AB7A 3SC2B 4LHYA 4TTJA 2FRXA 4XB6B 3ENNA 3TOVA 4N7MA 4EM6A 4PZZA 4AULA 1FNMA 3LYUA 3QELA 5ELXA 1VECA 3DXFA 2O5CA 2FUEA 4RVUA 4M6WB 1E4EA 1L7NA 4D0LB 3QU4A 2ZIEA 1OHHD 2H4XA 2X2EA 4H7KA 2UXCB 2AUTA 3NTOA 5BOVA 4BX3A 1T8WA 2DH5A 2XCLA 3QUAA 3M5PA 3RU7A 3UWKA 4BTLA 1I1QB 1JPUA 1O58A 1PUIA 3AR3A 3OICA 4WOBA 2X5NA 4Q15A 4CM1A 4W5HA 2JFQA 5JW6A 1RQGA 1X1AA 3CH7A 5CJ2A 3O3CA 5JJBA 4NXMB 1CEEA 1NBMD 2AJTA 2AKYA 1DZIA 3BOSA 3E3MA 5B58T 3MIIA 4RVNA 3PIDA 4C0AC 3C24A 5CVTA 1YAHA 2J3KA 3QVUA 3BRCA 4M9UA 1N4AA 3FSJX 1N57A 3F9CA 1NTOA 3ONFA 1QIGA 2GZ3A 2OUIA 4IUDS 3LV8A 4DDKA 2ZWMA 1XQ1A 1GNLA 4UU0A 1GZ6A 1XQ9A 3P5BA 2M6SA 3GA5A 5IJ0B 5JBNA 3H0EA 2WSSD 1NR7A 3HH8A 2WF5A 2A9KA 2IOQA 1L4GA 2DG2A 3TIGA 4DR3B 2BRUA 5KTKA 2G28A 3VNQA 1YR9A 2BGRA 2WAYA 1Y4SA 2BJHA 2CEKA 3H2KA 4MIYA 2CCKA 1SRRA 2FPIB 1ZW1A 2FR8A 3QPBA 4HWRA 1HEUA 3SBEA 3BHMA 1SRQA 2XUIA 3PHBE 3SM3A 1QIMA 3STWA 4EQ6A 3VJRA 1L8XA 1SC4A 2JLBA 2HCRA 3PNSA 3T4UA 4UUAA 3ZHUA 2PZJA 3MOIA 1WNFA 2BCGY 4P3OA 4GXQA 3VHXA 4BNNA 4CNQA 1GQYA 5LB2A 2CLIB 1ZP6A 2C2GA 4BO0A 1J0BA 2EKBA 4P32A 1GKLA 4O29A 1KARA 5C18A 2PLFA 1W4RA 3Q0IA 2FPOA 3I58A 3TCNA 4PZAA 1JA1A 1YS6A 2ORVA 3R6LA 2AIRA 3FNEA 3DLHA 1DQRA 4Q7JB 4HGQA 2EKPA 2XTAA 1F8XA 3CT4A 4LJ8A 2WVHA 3E8SA 4I4TA 4YJ3F 4B6RA 1RDFA 2CCGA 5A6VA 1ZSVA 3EY9A 1J23A 3A7EA 3WYDA 4ID9A 2XKAA 5AI4A 5FI1B 4RABA 5CH8A 2QVXX 3EN0A 3UK7A 3WYCA 3ZY5A 2O0LA 1NI5A 3DHEA 1J9ZA 1MAUA 4ZICA 1X1RA 1E3EA 1EFRA 3CLTD 2QPLA 5FUYA 3U31A 3ELWA 5B4TA 4BGIA 3QWHA 4BUCA 3JVUA 4ZYYA 5BV0A 3I5XA 1UXGA 3U5TA 5ALTA 3F6SA 1QGUA 3A9CA 3PP8A 2JCSA 2Y1LA 3QVGA 4AURA 4AY3A 3M3PA 4F11A 1V11B 3W1VA 4EJSC 1RQNA 1VA4A 2QMEA 4U63A 3SF8A 3X1ZA 3JVEA 4KBYA 1GXSA 4LKOA 4I5DA 2WNSA 4RWEA 5IUNC 3PHGA 2OHJA 3RUEA 2YXEA 4DG8A 1Q92A 4CKCB 3IB6A 3T5PA 2EV9A 1ESNA 5CP8A 4OXNA 4YECA 1C7ZA 2FZLA 4YUVA 4EA9A 5FUXA 3KU1A 4Z8XA 3VJKA 4QPJC 4DDWA 3I0NA 3IKTA 3L5KA 5EERA 5F7ZA 1AOXA 1JU4A 2YNMD 3IUBA 1JHMA 3AHGA 4TMTA 3QFFA 4OQFA 3RF6A 2IDKA 4Y1EA 1FPQA 1A98A 3L06A 5ED4A 2BGGA 4C14A 3H4VA 4NENA 1DCMA 1X7XA 5D87A 4Z4FA 1EDZA 4NEQA 2J9FB 4M0KA 3ELDA 5BYAA 1OVMA 1LPMA 1QIEA 1KVQA 3AJEA 3N8HA 1H05A 3I9V6 5BVHB 2RGYA 4CM9A 5KJ1A 2CQTA 3GIDA 4BYMA 3ENWA 4M87A 3CEMA 4CKZA 1Y3HA 1SCBA 3F6PA 4XM0A 2CXHA 3F5QA 1DIOB 4QHSA 5BPHA 4JC4A 3I62A 3CVYA 1CPYA 4HZGA 4BNJA 3D6AA 5TGZA 4Y1FA 4U5XA 1IQRA 1JTEA 1WZIA 5CAEA 5JNSA 2V03A 2V7TA 2G4LA 1RPNA 1UCFA 2PXAA 1KVSA 3CSSA 3VPSA 4BVLA 3KOYA 3Q5DA 2QDXA 2YFKA 3OY7A 1V7CA 4N54A 3KHSA 2XDQB 4K26A 4WXYB 3F7TA 2LIPA 3DF9A 3E9YA 2FLWA 4FQ7A 5E1BA 3ZIUA 4TS9A 1K86A 4OP2A 4D3DA 3Q7EA 2WAOA 4KPGA 4R1UA 4XYBA 5DBGA 1JAZA 5IYZF 1TW2A 2G06A 4FVTA 1K97A 1ZIYA 1B73A 3BTOA 4TRMA 1YZHA 3L6UA 4LJLA 5FNVF 1ZJJA 1FSSA 1J42A 1QO0A 2HA4A 3AZOA 1M54A 3AUSA 4FBMA 3R76A 1BGVA 4EH1A 1IM2A 4F0JA 2BMWA 3ZV7A 4D8XA 4PLVA 4OY3A 1E2KA 1JVNA 1LPAB 4D0SA 1A9TA 3V33A 2XOKD 4GLFA 5C8XA 3WLKX 2JFUA 5T7BA 4OHYA 4RIFA 1UP4A 1T36A 5F2KA 1SXPA 3BL5A 2Z4SA 3DOEA 3EVFA 3UQYS 3THWA 1UK6A 3EXFA 1C2YA 5FA6A 4QQRA 3OU2A 3U17A 4RPIA 4K28A 1KR2A 1CJTC 2AG0A 4ZGBA 3RUCA 5L6MB 1OPXA 3PC4A 4J1TC 4ALKA 2CV1A 1EXMA 3E61A 3NBQA 4K6MA 2E0IA 3DUFB 5B7GA 5EWLB 4INJA 3SJUA 5ALSA 4P80A 4BXOB 2E2WA 2BF4A 3UMCA 1NT2A 1OAKA 4EY4A 5DK6A 1S8NA 3QKRA 5K8UA 2QD4A 1RS0A 3KL2A 1Q3HA 4TV9F 3AC0A 5KTPA 5HF6A 5HE9A 3TZLA 3EUAA 4FE7A 1FYDA 2FRVA 3ZYCA 2XMPA 1WB5A 1YRAA 2OB1A 5IVDA 1SCKA 1ML3A 1GNRA 4F5ZA 4ZYUA 5HVNA 1JFTA 2FSVC 1B1AA 3A32A 3HV2A 1I7DA 4L2IA 4EF5A 5DLQC 1P1JA 1VIYA 4DF3A 4KKVA 2BZ0A 4DYDA 2FFRA 2JGKA 4TKMA 5DHQA 1JEQA 2WJGA 5K3SA 2W2XA 3SZMA 4YX9A 1ABEA 1KFEB 5LQMA 4HJRA 4YVFA 1QF7A 1QHFA 4IFBA 2EVWX 4WFIA 1QAMA 1QYCA 1TMOA 5KYUA 3EUWA 3B1JA 4MYRA 3D8UA 2Q9BA 2X8LA 3KQLA 1M73E 4L22A 1X80B 4G9GA 2NP6A 3NBAA 3V8EA 4WJKB 2Z1DA 4JLSA 2VR1A 1E1MA 2QUZA 3FUXA 5EN4A 3WQHA 1EIWA 4GBMA 2IE0A 1KYVA 2QB5A 1Q22A 1SGWA 3S68A 4R9SA 2DUWA 4R1OA 2XHZA 3HEMA 1VHQA 2XUPA 4HOYA 3EGCA 4RGVA 4ENSA 2O19A 4OB8A 4CMCA 2IS2A 1K88A 1OX5A 1PR4A 1CUYA 1IXKA 1TO2E 1HMPA 2CXTA 2PH7A 5PGMA 3ROMA 3IPRA 2MJLA 1RLIA 3L49A 9LDBA 4GR5A 4NPHA 2YWCA 4HV4A 4UMVA 1EVIA 2DTDA 3K9BA 1BDHA 3ZWQA 1T3TA 2X1LA 1HTTA 1VPEA 3F6CA 3R3XA 3ZC3A 4BNXA 2REBA 1FDOA 1ZUWA 3SMVA 4TYWA 2NU6B 4JVNA 2Q27A 4GZ6A 2NP7A 4QARA 2FVXA 4FX5A 5BQFA 4OHMA 2PUVA 4RHFA 4QNMA 4HVCA 1E60A 4PRYA 3LT1A 3OCZA 1OMOA 5J4LA 2WG2A 1G3IA 4OU5A 3R44A 1UC8A 5BSVA 4E5YA 2OXEA 4YV0A 3ZCUA 1JAHA 1QZ3A 4DCGA 3AL0C 5LJLA 3D3EA 1CDZA 3W4JA 1E9VA 4LE0A 1YGYA 2VYNA 1HZZA 3NRJA 5TGDA 3RFUA 5E1DA 2RGBA 2YVLA 4NP6A 2O2JA 1RHRA 2RHMA 2HPVA 4CF3A 2DUJA 3DZFA 4JS0A 3OHSX 3PD1A 4A1FA 1USKA 1NPTO 3O38A 1UBHS 3OPVA 4KQKA 3PWKA 4CMAA 3SVZA 1OZGA 2RK4A 3ITDA 4RA9B 1KH3A 1C1XA 3F5SA 2GX6A 1U3TA 1Q3TA 3TLEA 4M9XA 1PFGA 1W29A 1J2UA 1TX4B 2JGMA 4KFSA 5BWLA 1Y63A 2B4YA 3UOGA 4EJ2A 3SHQA 1IBMB 3CF0A 4PGHA 2G0AA 4JUFA 4MQBA 4ZXFA 4KMSA 5ETJA 4DRXB 1TUBA 3H8VA 3I5MA 3LQRA 4BV3A 4B3IA 2RB4A 4WY5A 3TJMA 3DJFA 4EA6A 4L57A 1UMDA 4XSHA 2CWWA 1EZ4A 2IYRA 4OXIA 1P7PA 4X71A 3E9NA 1D2NA 3P9YA 3VU8A 1FL9A 4CU2A 3LP6A 3GLFB 4FN4A 4L5AA 3L7JA 1WW2A 3AKCA 2VP6A 1VG8A 4EYOA 1UBUS 2L82A 1EBUA 1JSZA 1X1SA 3GLHE 1NP7A 3L4BA 1SB8A 1JIIA 1SQ6A 4PAMA 3RBAA 3TNDA 1ZD3A 1F2DA 3U4CA 3QFZA 4YUAA 2PBFA 1N5LA 5TMDA 1T2VA 1WWKA 2QX4A 3VNSA 4H7DA 1EP2B 1MJGA 2CL5A 5DBEX 4CM5A 4NWIA 5MF6A 4LXYA 3EOAI 3G9QA 3LDUA 3OOHA 4ZJYA 1BNCA 4JIMA 1KS2A 3WKEA 3LUJA 1KP2A 2H1RA 4HXYA 1MLDA 3WKCA 1C9DB 1ECFA 1E0KA 1Z6XA 3EGDA 1R6BX 1USIA 2IXTA 1OXKB 2IXFA 1I3CA 2QMOA 2ZKIA 4MR7A 3COJA 3K30A 4LC0A 1BX3A 1C4WA 4I19A 4E2WA 4WK2B 4JBGA 1SC6A 5JWOA 2VJAA 3ZE8A 1UPCA 1C2TA 3NHBA 4V0OA 5CDHA 1K3UB 2RIPA 1XQ6A 2FGJA 3A8TA 4G5QA 4GOJA 4X1YB 3FYUA 3UN1A 2UYCA 4BDTA 1G5QA 4C4YA 3JR7A 4GXRA 2XR1A 1CRWG 1H8ED 3AF2A 3QBJA 3VYRB 5K99A 5DYGA 2QAJA 4N7BA 3DVSX 1YCHA 4US0R 4V24A 5CYFA 1KDZA 4EHIA 1FP2A 4QULA 3CHYA 1NVGA 1NBAA 2YIJA 5DSZA 4PBTA 3W90A 4EL0A 3SVTA 1E63A 1VC2A 4RGQA 2C4TA 5F7JA 4WZAB 1N6IA 4XPZA 3SDBA 4A8JC 4ZJPA 6ADHA 3RJTA 4FWIB 4NCXA 1MV8A 4G36A 5TX7A 5E6SB 3KR2A 3OM8A 2R8BA 3GA7A 1MORA 5ERYA 3WC4A 1XU4A 5B4VA 4AK9A 4DCJA 1CNFA 1U9JA 2D0PB 2LWIA 2VZLA 2I6TA 5JS7A 1RU3A 1XVTA 4EKDA 1AQJA 1T8TA 3MWLA 2VF2A 5CDFE 4EGSA 2HLNA 3BS4A 1DB3A 4P36A 3CRVA 3MCUA 4ZAYA 3IP1A 4MVJM 3L40A 1HDYA 1SWVA 3UGKA 4BUJA 1U3VA 3VDNB 3HEBA 1T34A 4ZO6A 3WKDA 4HDRA 1PF7E 1OTXA 4NESA 4X3PA 4Z0PA 5A2GA 3CO0S 4RXUA 5AKLA 3QVOA 2RH4A 2FH5B 4C9BA 1II8B 2CVZA 5JUWA 2P9JA 2KLHA 3I9JA 4UARA 2HWXA 2DRIA 3ZE0B 3DTVA 3D7RA 5KYWB 4YRNA 3THXB 1N4DA 3NIGB 2WWVD 1EB9A 3I9NA 1CERA 2BCEA 1L7RA 2JGDA 4NDZA 5AI8A 6CHYA 1FYEA 2REOA 2XGMA 3CLRD 4DWOA 5K45A 2D1FA 2Q45A 2BD0A 2ZRKA 2ZSUA 2Z8ZA 2NU8A 1IK6A 1AGNA 3ILHA 4IJVA 3AZQA 4BP1A 4DLSA 4JV5B 4B74A 1A8QA 2XUAA 4QRIA 2C31A 2I6GA 1F0NA 3H9GA 3R40A 1C3LA 1A2QA 1GARA 1G8HA 1MDBA 1ULHA 1E3WB 1YS9A 2WVAA 3CB4A 2QXTA 2ZWVA 1T0UA 3DE2X 4LJ7A 3JATA 1DOZA 4LI0A 3A1DA 4MR9A 4D57A 5BR1A 5M04A 4LF9B 4M55A 4P3XA 4QKQA 1GCUA 3BZUA 3Q2KA 5LQAA 1WJGA 2LCFA 2V6IA 1T5BA 3GLTA 3FHLA 1EM8A 2RAPA 4Y7DA 1W44A 4O5AA 1VBMA 4XJSA 2BHSA 1IHOA 3BC1A 4ADSG 1JDSA 4PYLA 4DRYA 4Z1OA 2G8LA 4MINA 4FGWA 1ZQ9A 5BW4A 4H4CA 5CR9A 4DY4A 2O48X 3RTDA 1YCDA 3GZ4A 1ZM7A 4ZI2A 1WBDA 1H8HA 1ZWKA 2YX1A 1VCHA 1Z63A 5TRTA 1CDEA 3NUQA 4BWVA 4MS1B 5TR9A 1BX1A 2V3WA 4QUJA 5HCIA 4QLAA 3FTDA 2CJWA 1LD3A 3X1DA 1FNCA 1PJ8A 1TYAE 3HFJA 3FW1A 4UVEA 2EL7A 5E7JA 2FWMX 3M6XA 1XEXA 1RRVA 2DQSA 2BTQA 3DYIA 4CQJA 5CG1A 1J09A 3R24A 3CSUA 3WJ7A 4DRZA 3OLQA 1C3JA 5H02A 2BMFA 4ENWA 4CLRA 2B9EA 3IMEA 4MUBA 3KKQA 3IC5A 2PLNA 1GEGA 1LGYA 4LQLA 4RH1A 1QHXA 4NBSA 3G5TA 3BH0A 3HJGA 5EE1A 1ZVKA 1W4LA 4JK3A 4RIQA 5GVRA 4TRJA 4EVQA 5IKMA 2XAUA 1RRGA 5LBTA 2XBUA 2FOLA 2PSDA 1JJVA 2PKRA 4HTAA 2EP7A 3D0KA 2JBWA 1RLMA 3PLNA 3VSDA 4X7PA 3PCRB 4ZT7A 4NMHA 3J81A 1PJ4A 4KO8A 3ZKWB 5LZ7A 2VJCA 1Z37A 2H0QA 3STYA 4AFNA 2BKXA 2BUBA 4TL9A 3KSRA 4YNBA 3E5NA 1IN8A 5EE3A 4HAOA 1M8GA 2V58A 4IIDA 1E32A 3HXKA 3BTVA 5DU2A 5JNUA 5KQGA 2WM2A 5AIBA 5H83A 1GNVA 1L3IA 4UPEA 1W1IA 3IVXA 1QZZA 3OLYA 4B75A 2B7BA 2IUUA 2CB9A 1HDIA 1VRCA 2AK3A 2H4YA 2PZAA 1TUIA 3HRIA 4JUAA 1XZAA 4M46A 2VPYA 1Z36A 5SY9A 2X0DA 4TYNA 3DHNA 5KKCA 3HCBA 1T43A 1AKWA 1P8AA 1FBTA 3QMPA 3UK1A 1YR1A 4BMVA 1NMYA 2GHRA 1KKLA 3LXMA 3OJWA 4KRYA 4IXNA 5IKXA 1KEEA 1ZOOA 4UFNA 1XQVA 2W2VA 2WPDD 1LFDB 2ZQ5A 2HN9A 2IYPA 2JAPA 2ZT5A 2FSPA 3VDXA 1N5MA 2VTBA 1V8DA 2IA5A 4HDSB 4OPMA 2WVJA 1W93A 3D31A 4Y2YA 5IP5A 5HSGA 3EIOA 4MQ4A 1AZSC 5HILA 5GGYA 2OCXA 4CKBB 3FMOB 5IAOA 1F2VA 1THGA 1B23P 1X7YB 2WWWA 5LMZA 1L1RA 3L8DA 4OI2A 3P2KA 1XWWA 1ZG3A 3FCAA 1G19A 2WJIA 1W5FA 4MKRA 4S1NA 3W6ZA 2BDTA 4A2WA 2YR0A 3NC1C 4YV2A 1UBJS 4WLUA 4QODA 2Q99A 2XEXA 3DFKA 2WYIA 4BHTA 2GM3A 2JD0A 2VUTA 2SHKA 3KD3A 3V7FA 3FKQA 1Z5OA 3WMEA 4BGEA 5ITVA 1Y7PA 1RPAA 3KEQA 4GC5A 1QTNA 2ZBQA 1A76A 4KREA 1GPLA 3V4OA 3FFTA 3PFNA 1JIUA 2QVYX 5BV1A 3WTBA 4B81A 3NXSA 2FSUA 2X14A 4W5OA 5B64A 4H1TA 4XB1A 2EW2A 1YL6A 3WGKA 1O3YA 1SXJC 1WS6A 2XVYA 1M6HA 3RRJA 3U3MA 4BVBA 1CETA 1SNYA 2DJIA 3HP7A 3NDJA 1RWWA 1OLUA 5IDWA 3E48A 1PG5A 2QROA 2PZLA 3HB4X 2FN7A 3OZVA 2H5IA 1MA0A 5AHOA 2PO5A 3EXHA 4XE5A 3BE6A 2RGEA 5CM9C 2CFCA 1EESA 1O6ZA 4HFMA 3OD1A 4J49A 3G82C 2YINC 2O3RA 4A6EA 3WDMA 2VG8A 3DO8A 1I1OA 1WBJB 3CX7A 4ZCQA 3TR0A 1WZ2A 2PUWA 4F56A 4KXYA 3HCAA 5C5IA 1KMMA 1KK2A 2QRZA 2MSNA 3ETHA 3DKPA 3RGWS 5DULA 1E6WA 3WIOA 2P8SA 3JSXA 1VHLA 1T15A 4LCJA 4EZIA 3RVSA 2R96A 4KNWA 4YQZA 4F8JA 7MDHA 1T91A 5KYUB 3ISVA 3WRYA 4Z2AA 2FXVA 5DRYA 1DQNA 1T9BA 5I9IA 3OOYA 4QDUA 2DR3A 2WG0A 2VHZA 4BLTA 3QPCA 4OV6B 4QVKA 2HA6A 5G3ZA 5I7RA 3I5YA 3BM5A 2N1MA 2QVBA 5CFOA 5IM4F 3FVTA 4N3AA 3AMVA 3MXTA 2PUAA 4JC8A 4UBIA 2R751 4WXRA 4IDAA 1MHPA 3GEMA 3H6GA 1XOIA 5DE3A 3N2EA 1R6AA 4YLEA 3UJ6A 4DC1A 8OHMA 2DULA 3IAHA 1VPTA 3K4HA 4RPCA 5KKAA 5JVDA 1KJWA 2CBZA 4P0PB 1Z7BA 3I9KA 1GRRA 3HU5A 2F3SA 1FK8A 4TS3A 1K8YB 4KFRA 3QG0A 3DZKA 4EKNB 1S1CA 2FWRA 3D6FA 5D2CA 3HVHA 2BFFB 3UJNA 5CDGA 1CZLA 3LTEA 4B4UA 3BIOA 3IXMA 3VR5D 3LI2A 4XUDA 2D2IA 5L3QA 5K2MA 4UHHA 4NBWA 1BGXT 1CZOA 4WY8A 3EDCA 3V32A 1ODIA 4J29A 4FMDB 4L95C 2VNAA 1N2XA 1E1QA 1XTJA 3JQ8B 4FYIA 4MNTA 3VC2A 4EYSA 3ZU3A 4GI2A 4DCCA 5SYMA 3QU9A 5KX5F 3SXPA 1HLDA 1DJQA 3TCXB 4R7ZA 2IS6A 4CXMA 4LSMA 5JCJA 2D3WA 2GRUA 2SCUA 1FJ2A 1Z0JA 3D3QA 4HHEA 3ZHSA 2A5FA 2P91A 2ZI7A 3UOAB 2YJZA 2F55A 1Z5ZA 3NHFA 5F2OA 3D4PA 1WLYA 3BSFA 3KJFA 4Q82A 2OV1A 3C5WP 2IHYA 2AW5A 3WHPA 1HL7A 1YVRA 3KNZA 2P27A 5TEWA 2A33A 4K3UA 4MQFA 5EZQA 1NAHA 1OLXB 1X7WB 4W5TA 1CVIA 2JI6A 2ZJOA 1B8PA 3PFKA 4DUPA 2FSGA 2X9LA 5LP1A 4INAA 1J4AA 2JHFA 9MHTA 5SV2A 4C03A 4AQDA 1TYCA 1HNZB 4TLEA 4R6XA 1FNNA 3SYLA 3V55A 1TF7A 1A9QA 1S2MA 1M6EX 1QC5B 5EHNA 1PNRA 2VEOA 5BSUA 2IOHA 2IZ5A 3MPUA 4HFRA 1YZLA 4MS3B 4NMMA 4YRMA 4DA8A 1OGYA 1Y0BA 4GPTA 3AWDA 3WGVA 2EGUA 4GX0A 4F3YA 3RIMA 1P2TA 4IMIB 1V45E 3QVWA 4I1IA 3Q12A 4JYBA 5FLEX 2VHYA 2JLYA 2IEZA 3OQ6A 1TC1A 3HV0A 3OC6A 3PDCA 1W87A 2OOSA 4MUIA 1KRWA 3VTAA 2AZTA 4E5VA 1N5DA 2QENA 2QRGA 1XNGA 1NQTA 2JAXA 3BD9A 3N87A 3HPRA 2VXBA 1JKJB 1SKYB 2WD7B 3LZ6A 2NIPA 4OJTA 4PAWA 5IM5A 1QS0B 1ZVJA 4IY1A 1Y9DA 3H13A 4Z4EA 5EIFA 1KSHA 2H1HA 2DWCA 1TU4A 1QVWA 2GN0A 3L3BA 4QXAA 4Q18A 1IN4A 3PENA 1P0CA 1II9A 1V1MB 2H4JA 3I2KA 1I5EA 2W71A 4MPDA 2EKLA 3PEUA 1TZBA 3IBSA 3QU7A 1VLHA 2I0FA 3VR6D 1E5QA 2B6NA 4Q9NA 1JAXA 5HMLA 3QF7A 2C0QA 3L4SO 2PV0A 3DMTC 1AD2A 4KO4S 2FF5A 5HF5A 3WGGA 3ZY4A 4BO2A 1PEDA 1CJBA 1GG8A 1E6CA 2BEWA 3IP6A 3IMGA 3SEQA 1RC0A 3ECSA 2UZAA 4HAIA 5SY6A 3ORFA 1PSDA 3ITNA 3PC3A 4NC9A 1KDYA 4B47A 4PYJA 4LW8A 4ZTZB 1VQ1A 1YUMA 1N77A 1ABBA 3DUWA 1GKIA 4WT7A 1O95A 1I1NA 1JPJA 4BP3A 4ETNA 3E2IA 3N2KA 3LQ1A 1T5TA 4D0RA 1T2EA 4B2IA 2EBUA 4FFWA 2B7CA 4EI7A 3CW2A 2P9GA 5EOVA 5TLSA 3PKJA 2BM8A 2NWQA 4HQRA 1NU6A 2HRCA 2ICAA 4JI3B 4OHVA 1HL3A 5IC5A 1V0JA 1ZD1A 2WHQA 4EPYA 3BHIA 3R9XB 4G8DA 2Y1DA 4DR2B 1TVCA 2BSQA 1P31A 3WGOA 3B51X 2QMZA 1E2FA 3G8AA 4C22A 3JQGA 2AUMA 1L5LA 4EYKA 1N92A 3SU8A 1W0CA 2J0EA 3UC5A 4B6OA 2Q1TA 4UTVA 3RROA 1X0XA 1XQWA 5C1DA 3KHTA 4FYVA 4G07A 1F20A 1CFJA 1N1EA 1BHJA 3E3NA 4NPCA 3SCZA 1U8ZA 3AHHA 1V1RB 4MWTA 3QFSA 2QQGA 3FYTA 5AOVA 4MI3A 4Y2RA 3A9TA 3EZLA 1CRLA 2WWRA 3OE5A 4LXQA 4P4SB 4H2DA 421PA 5K3DA 3WRVA 3O0DA 3ZTYA 1SULA 1Y5RA 1XD2A 5HJ5A 4ZDWA 5LXTA 3STXA 3CVUA 2O8DA 1Q83A 3JD4A 3PXCX 2ID9A 1PNVA 1YB4A 2C4HA 1H2RS 3EEQA 4DG5A 4N01A 4O2AA 1A8IA 4PAGA 2JASA 2FPMA 4XAQA 4DJJA 1M2JA 2P8JA 1B43A 2PKXA 3DQQA 4UAGA 2WSLA 2COUA 4ZQFA 1MKYA 1PGPA 2GJKA 3IO5A 3A70A 5FEUA 3JAMA 2JJ2A 1DC3A 2G25A 2ZSJA 3O8LA 5A5EA 2FG7C 4JODA 3F97A 2RGDA 3RGGA 2ZULA 3WL4A 4UUNA 3LCCA 1I6KA 4YAUA 5K0ZA 2DBRA 1WOMA 8ABPA 3OUZA 1GR1A 3H1GA 4JOSA 4D1YA 5L3ZA 5JMWA 3UJ3X 3FKJA 4DS3A 4ZVNA 3G0CA 2MSWA 2ZB8A 4EENA 4TGLA 1OAOC 1O96B 2GM5A 5KVQA 2HO5A 3PYMA 1WTCA 4J0HA 3K5WA 1K3TA 4WAUA 3ZEIA 5B4UA 4A8HA 1QP4A 2QD5A 3BXXA 3LQKA 3WGUA 1H4TA 3GG9A 4HQKA 2Q8NA 4K5QA 1E6MA 2BZ1A 3G88A 4YMIA 5SYAA 3VYSB 3VU1A 1JA0A 2IE8A 1BMFD 3M6WA 5E3JA 2CDRA 2IY7A 1THZA 1XJWA 3OJCA 1VPWA 1FMFA 2CFIA 4J2TA 1N2CA 4TYMA 3PUJA 3BA1A 5L51A 3RRSA 3PD7A 4B7CA 4G9BA 1PGJA 2ECQA 4BKUA 3RODA 3V00A 2VKTA 3MOSA 3P2YA 3LLSA 3RG2A 1NVXQ 3QH4A 5IDYA 3BQNB 3H2BA 3D6VA 1L9XA 4AKIA 4B87A 1PEKE 2P7HA 3U81A 3GVXA 3VDMA 2ZAGA 2XBLA 1L4FA 1SEVA 4UFOA 4QNNA 1NVVR 5A0TA 3KIPA 1E1RA 1RXWA 4MWOA 3HL0A 2F9MA 3D2BA 3BAFA 2PQ0A 3M1IA 4PYKA 4ZVTA 3SR0A 4AZVA 5KDDA 2XRZA 3RSOA 5IJXA 4M8LA 3Q3GE 3EXIB 4QBGB 1EFDN 5FWXA 1AA6A 1JVSA 1JLLB 1NBHA 2GFIA 2GO1A 3D6TB 3HXPA 5CU7A 2RC6A 5EEGA 5AR1A 3AXTA 1ZX1A 2WAAA 3EVNA 4XCXA 1O97C 2HHJA 5CVJA 5BSWA 2XGSA 3AVTA 3G5MA 5TPZD 4RV5A 1SBYA 1RMYA 4KR3A 4GLJA 4L07A 3RVNA 5K51A 4AWBA 4CE6A 3PVZA 2QP3A 4A0FA 3DKVA 2QY9A 1FFBA 2DFPA 2J4CA 4PZDA 1DBRA 2VWHA 1AO0A 4LHEA 1JXQA 2ZXFA 4YHBA 1EE2A 1QTIA 1XUOA 4RTSA 5J2TA 3BL8A 3D6UA 5WRFA 4IIVA 3RRXA 4U2EA 4ZQIA 3HYNA 4HQNA 1XRRA 1UBFA 1TCVA 4KOEC 1GLVA 3FGZA 1DKLA 4YWJA 5A02A 2O54A 1X3SA 1NUPA 5E9JA 1I24A 4GX1A 2YJGA 4UE6A 3SIXA 3UFXA 3IDZA 5DZSA 3MTJA 4HGYA 2VAWA 3LT4A 3Q85A 3FZGA 2X8BA 5EZ5A 3P4UA 5FF9A 5DLPA 4KUEA 5DW0A 1BXGA 3WL8A 4ZI7F 2OCBA 3UOWA 3VZQA 4EPVA 1SXQA 2W43A 3KX2A 3MA0A 3ROZA 1I2AA 2PZGA 4JKYA 1PJSA 3QYPA 2EWMA 3OZXA 3GJ5A 4G67A 1P5RA 1Z8HA 1L5GB 3INGA 4X24A 2W70A 5A62A 1J1UA 4EDFA 5F52A 1BCRA 2I03A 4LJRA 1BJRE 2J31A 1ABFA 3O4JA 4PV7A 4ZYLA 2CJFA 3KVYA 1YR7A 2WNIA 4AIRA 1KTIA 4LJYA 4BRUA 5JTUA 4QYSA 3AJDA 3G02A 2QL9A 5JAIA 3GUYA 3UJ9A 4I2NA 5B3JC 2D1SA 2VH2A 3IEIA 5JARA 5K3EA 1ANKA 5KNDA 1E2MA 1MENA 2PQ6A 3O4FA 3LLUA 3QBVA 1MH9A 1N2HA 3TLJA 2ODNA 4JU9A 1ZDMA 2J3MA 2VIIA 1I5RA 4NEGA 2NNWB 3RSSA 1DRJA 3DMRA 4ZOLA 2X77A 1J8FA 5DIFA 3WHIA 4M22A 2DLNA 3NCTA 4BNTA 1DPGA 4PZPA 1Y5NA 2NYUA 4DJTA 1QFSA 3WIDA 1WSBA 1X7ZB 2C5EA 3L1IA 4PS1A 4X8LA 1J90A 2FPGB 2HPZA 5TB5A 1TECE 2Q0XA 3IDFA 3FCEA 5CCXA 3VVCA 1OFUA 4F97A 2QE7D 4O0LA 5B6PA 1WTAA 1QKIA 4G0MA 1GO2A 5GPBA 2VP0A 3DE3X 4KQ6A 4UM7A 3TZQA 1BW9A 3NALA 1R37A 3Q5EA 2Z04A 2JC3A 1UJNA 5KSWB 5J4YA 1W47A 4L8WB 2VT7A 3P1JA 2ZTHA 3CVWA 4YXWA 2Z8YA 1NX6A 4MRNA 2VK2A 4IHJF 3WYBA 1NAIA 1AC5A 4CMHA 4BY9E 3OF5A 4DGQA 4DCSA 3NJRA 4LF8B 3WWPA 3JALA 4MP6A 3QFTA 1A2KC 4OM8A 1I2MA 1V39A 4LOKA 4FT2A 3VOAA 2R5FA 2ZRJA 5EJEA 5B55A 2IZ6A 5IXYA 4LBVA 5F77A 1XTBA 3OWXA 1ICIA 5DH9A 1V8FA 2QYHA 3E1GA 2KW5A 1IC6A 2DHDA 4TYQA 5EP4A 5T57A 3E5HA 3AOGA 2HB6A 1DSSG 4XGRA 3Q7RA 4RFSB 1PRYA 4UAJA 1MG0A 1F7UA 2VTVA 3NETA 3WNDA 3M2PA 2ZQZA 2VS1A 4HWTA 4TZ0A 1JI0A 1P0IA 3E9DA 2VRNA 3PRJA 1IOLA 4H27A 3ROGA 1TTPB 5AKHA 1N7HA 4LWQA 1DLJA 4WZBA 2MINB 5HG0A 3I01M 3Q9SA 3V34A 1AKUA 3LC2O 4DV1B 3FETA 1UT8A 5EQDA 3AF5A 3EZNA 5KSZA 3G0IA 4F91B 3RADC 2D3TA 2XA9A 3HR8A 1BMTA 4QUKA 5CG2A 1C3OB 2DFDA 3CZMA 3ZD6A 2B8TA 3OH8A 5K9ZA 1HRKA 4LS3A 3E03A 4XUGB 1OC4A 1NNUA 3BXFA 1MX1A 3CINA 2JK1A 4CMBA 1PAUA 4DYHA 5BW5A 1HQCA 1DPFA 3CE6A 1GTJ1 2GJSA 2HPAA 4FPXA 1JH9A 1B6RA 3CEHA 1KI9A 3GW8A 1V6SA 4BQQA 4M6WA 3X1XA 3COYA 3T7JA 4EMTA 2P4SA 5BY2A 3ZUPA 1GTL1 1COWD 1NN1A 3A3NA 2GPAA 2HJVA 3JWPA 3SQOA 3UMSA 4RXTA 1W76A 1JT2A 2E1RA 2VTKA 1DZ3A 1SOWA 2R8YA 1DBVO 1L4EA 2ZUTA 1P6QA 1FVOA 3AUYA 1A8SA 3NBMA 5FPQA 3RRNA 4YJGB 3LLVA 1AURA 1T0PA 1O0CA 2FLKA 3BF8A 4GO1A 2ETVA 3STVA 3R0IA 4FYMA 3G6KA 3S8YA 1JXAA 5K3CA 2H1LA 2G17A 4JEHA 2ZE5A 1E2EA 4NG4A 1D1PA 2YYSA 3MMNA 3AG6A 2XQKA 1KWKA 1JQ3A 2B7LA 1FDRA 1M0TA 2PX5A 4IGEA 2RGRA 1FVHA 1UIMA 1EAMA 1XLWA 3AERA 4IYRA 2H4FA 2G9QA 1IULA 4UHJA 3FLAA 3R0VA 4MCHA 3RIEA 2AL7A 1MU0A 2BGUA 5H5JA 1P6XA 2WSYB 1ULBA 1U3FA 3EQ2A 3K15A 1YA8A 3KZVA 3L9XA 4Y2TA 4A92A 5IJ0A 4P1ZA 3OA0A 4FZRA 3B1KA 2FEAA 4F72A 4XWKA 2XF2A 2ZRFA 5FP0A 2O7RA 1O94C 5LZ4A 1U8YA 3AEUB 1VI2A 3N2LA 1U8UA 2BDUA 1UJBA 5DYTA 1TL7C 2W8ZA 4L4RA 2ZIAA 1E59A 4A6XA 1K5GA 1N1MA 2FPIA 1GV1A 3FDIA 3QVTA 4HGZA 3RBVA 5BUSA 1DDIA 1XKTA 5AXBA 4BRZA 2LIVA 3IDQA 2HRDA 4PSDA 1DAHA 2FQXA 1RE1A 1VHJA 4FFSA 4WMLA 1QFJA 3HCCA 4DQKA 1YBVA 2GO7A 4LCEA 1ZZGA 1P2VA 3ENVA 1S9DA 2K5UA 1G7RA 3SQMA 1VMDA 4N7RA 1I9CA 1WHTB 3UAYA 1YH3A 3CN9A 4G0QA 1NU8A 3VPFA 2X5JO 4KWIA 2G7ZA 3VA7A 4O8CA 3MPOA 1XALA 4JT9A 3SD7A 3R3SA 2FYTA 3DBHB 4ZP1A 2ASVA 5E1MA 3BTUA 4R4JA 3WKBA 5KC9A 1ODFA 3GLIE 3L0PA 3PICA 3G6WA 4JUDX 1DL5A 3A9UA 4XDZA 3OIGA 5AQ1A 1IBLB 2Y1OA 3AIIA 1T6YA 1M7BA 1F3LA 2F1HA 3W9UA 3S4DA 2I22A 2ZSKA 3RKRA 5EHXA 1CUHA 1NUQA 3I2IA 4YYZA 3ANLA 3ZVLA 5CW2A 5IG2A 3L4EA 4Q5IA 4BRSA 3SS9X 4CWAA 3A14A 4NCNA 1IN7A 1GCGA 2X7XA 5HZMA 4CM7A 1DQPA 1WXEA 4OAQA 1FU7A 1MOZA 5IPFA 1VIVA 2UUPA 5K8VA 2BFDB 3TD9A 5EHZA 2FDXA 4HWGA 3L7CA 3PZRA 1NMZA 4UUPA 4IF6A 1UKBA 4BZPA 1EE1A 2C5GA 2F1KA 4CKCA 3H2HA 1QLWA 4MKHA 1JZSA 1CIJA 1TU0A 5CT6A 4BN5A 3OX2A 1ZRHA 2J3JA 2W2KB 1J5PA 2WUWE 2GZDA 1PE0A 1AQYA 1DTWB 3AESB 3ANYB 3NX4A 3IDOA 4WW0A 3L7BA 5EKXA 1NVVQ 4Z99A 3H3FA 1RJEA 1U6JA 4KX5A 3HCFA 4NFSA 4G4IA 4PLHA 1AS0A 1C8LA 3HE3A 3L6EA 3ZNQA 4DIOA 1HKHA 2P6RA 5EJ2A 4PPQA 4JLVA 4FFOA 1J0XO 2PS3A 3HO6A 4IO1A 1HDXA 4KK4A 1SOUA 4R84A 3BREA 4DLUA 2F17A 2X8JB 1EGMB 2E55A 3E7WA 3N70A 4EY5A 5JZ9A 1E0AA 1WKCA 4ZAVA 4JLOA 5IFLA 2O52A 5BVHA 1R2QA 3SP1A 4EVRA 1ZRNA 1CZRA 3GCDA 3DDCA 3NPMA 1JWLA 5JJLA 2HR1A 4GI3A 2XZDA 4AECA 1JSRA 1GP2A 3TW6A 2OQVA 3TRKA 1WVIA 2UYYA 2QRPA 1W48A 2C82A 2WE7A 4H0NA 4MI6A 1AHNA 1JHPA 3U5ZB 3IERA 4OQZA 5GP1A 3KFLA 1A4RA 2OHFA 2J7PD 4JOQA 2AJ8A 3DZGA 3T34A 4ZZ1A 3CRRA 1WXWA 1YB2A 3N8KA 3RS2A 5IKOA 4HH3C 1H3EA 3HDVA 3ASYA 5GONB 2WKQA 3CNBA 1WLSA 2XDQA 4IGAA 1JFLA 4D4JA 1DAFA 1XZBA 3GLHB 3P2IA 2NXWA 3OIVA 2ZTSA 4M86A 2ONCA 1LW7A 4GOLD 2VJNA 5JMPA 4JXZA 4NH0A 5A7HA 2P1ZA 1QB7A 2F48A 4RYLA 5I4IA 2CC2A 4FJ0A 3QE0A 3J7TA 1Q7BA 2D1TA 2W7TA 2BGKA 1WXDA 3RS8A 4EIWA 3OP1A 5FIUA 4AZ0B 1KMNA 4FR5A 4EKEA 1XCMA 1BEUB 4D9JA 5LLDA 2ECOA 1KRXA 1K6XA 4C2BA 1DG1G 4A8PA 3IBFA 1Z17A 4O2BB 1KYZA 4KAAA 4ILKA 4MVJE 4Y18A 2C9BA 3LGXA 4TTAA 1SK9A 3LNCA 3IIMA 5J40A 3THSA 4TL8A 2QN8A 4KLRA 1ZNWA 1KAEA 2IODA 4NJMA 4PE5B 4Y9RA 6PFKA 3BXPA 3TIIA 5CITA 2CXXA 3EZ2A 4RJIA 2Q3EA 4CKWA 5LIPA 5JY6A 2ZI3A 4AYWA 1HE1C 1JAYA 3ETLA 3BVPA 3K5IA 4C4ZA 4XIYA 4CETA 3EOBI 1AT1A 7YASA 5E9AA 2KS6A 1RNLA 3FWNA 3I1FA 2CXNA 4MP3A 1WF3A 3GFOA 3ZR4B 3DUFA 2CXUA 2XGJA 4QQKA 5EWLA 1JHQA 3AX6A 3HCRA 4BXOA 1Z5VA 2FPXA 1MBZA 3QXCA 2CNDA 3T3EA 1Y7LA 2QTNA 3O26A 4DSTA 2W4IA 1U5AA 3PHLA 2RGNA 3QLVC 1M0WA 1QYDA 1FYVA 2GVDC 1E6LA 2SBTA 4DQ0A 1HC7A 2WWHA 5IUKC 1S7GA 2JFHA 4LVCA 1OC2A 3NHYA 4MW1A 5TV2A 1ZINA 4DTCA 2DBYA 5FPHA 4EPWA 2OO5A 3M4ZA 3OAAD 3OZWA 4FFDA 1UAGA 4CFYA 3M6IA 1VZ3A 1YDGA 4D41A 1K4YA 1EGHA 1PR5A 4LRQA 4O3FA 2D5LA 2C9OA 1FSGA 3U40A 1IXSB 3W4KA 2VK1A 3AUUA 4MI9A 4YAEA 2YWBA 4UQPA 1MFZA 1GG5A 1W52X 4ZO9A 4D4GA 1YE5A 5KQMA 1GPNA 1ZH0A 2CLFB 3P0HA 3F5DA 4MZXA 3OOSA 3PNLA 1LS1A 3TOCA 4NHEA 4BE4A 5JHHB 1WZEA 5JEEA 3AU9A 1PWHA 4XWYA 2HSZA 4AG3A 1IYZA 1GQ2A 2AG1A 1G59A 2PRKA 2F6RA 3B53X 3VR0A 1P1FA 2SICE 4LMRA 3TO5A 1S3GA 3AR7A 1Z0ZA 1Z38A 3Q7QA 3PTLA 1AGXA 4OGGA 4HB0A 4C0JA 3R0XA 3V1NA 1DDOA 3PDIB 3DDSA 4E30A 3FDJA 1IUKA 1G98A 3TZBA 1R6UA 1TK9A 2G5TA 4JDUA 4BU0A 1KOFA 1DJLA 5HDBB 1OROA 4NS1A 3B48A 3H2IA 3ZHTA 4V1CB 4J16A 3RIGA 2NU6A 3G7UA 4KVFA 1K27A 2GEFA 3OT1A 4FFLA 4KIJA 3ZWMA 4BJ6A 3L43A 4KP7A 4JLKA 3N07A 4J4HA 2JBAB 4NYIR 3KOOA 2WIJA 1G6HA 2WJ6A 3E35A 3IUNA 4TVBA 5I8ZA 1GNQA 1ZJ6A 3ZHQA 2D7DA 5DIZA 1PWZA 4WKOA 5DSTA 2C9ZA 3PHHA 3VU9B 1DUSA 1EWRA 2B8EA 3CBQA 1DV1A 4BDSA 3QLTA 3QIAA 4RVGA 2OORC 3O94A 2NV6A 4OQPA 4W8GA 4XR9A 4B2YA 2Q2NA 3R41A 1C1YA 4P98A 2GBCA 3K1YA 3UAXA 5EJ5A 1U0BB 4PIVA 1GTG1 3LXXA 4PNEA 4OGKA 4DIEA 4HDKB 2ZPAA 5DXJA 1JQLB 2A1TR 2DKOA 1V4BA 5DGIA 3L2OB 4K1XA 4R2XA 4U2CA 4B44A 4RA9A 4WFJA 1YDEA 1YL7A 3IT2A 3NTVA 1FRQA 4J0FA 1LQTA 1WVGA 3DV0B 3Q1LA 1C0PA 3R6TA 3F9RA 4RUKA 3DE5X 5H4HA 2O50A 5I9TA 1RZRA 3JARB 4QJ5A 5FOQA 4RJJA 1PFVA 1GSOA 2A5JA 1CF9A 5CTJA 2G4VA 1VRVA 4FDUA 3RHTA 1IWPB 4C88A 1MB4A 3T7TA 2H8KA 1YS4A 4QE3A 2XLCA 3GLFA 4YASA 1JLKA 2QAGB 1UK7A 3JASB 3ZXUB 1OZAA 3ROPA 4D8YA 4MWGA 2I62A 4H6WA 3KE8A 5ADUS 4I7EA 3N58A 4AI6A 2WKSA 4NDNE 3T1VA 4PG4A 4ZARA 2R8RA 3HJHA 1BKYA 3VPDA 2F3PA 3W5JA 1GPMA 3VBCA 3HDJA 1YQ9A 2D1QA 3AM4A 5CLQA 1DIRA 2RGAA 3AI3A 3ME5A 1AA9A 2XMZA 5EE9A 4OUDB 1VLQA 1TA0A 5KYKA 3NKLA 2JEOA 3KJIA 3N7AA 3UTDA 1MR3F 4DCTA 1ZXXA 1GGMA 2EBWA 2WICA 4FHGA 4IS2A 3L6CA 5F4ZA 2JFBA 4JFAA 5DT9A 3RC8A 3HYLA 2D8MA 4QRDA 1RKVA 3KVVA 4J0IA 4R5HA 3L7OA 4NZMA 3ESAA 2P9HA 1NW5A 2TYSB 2Q41A 5CLFA 2WV7A 1QE0A 4UTXA 2R7NA 1TM3E 2H85A 2GAJA 2LBPA 1US8B 2I3BA 4U0JA 3VMMA 1XZPA 4BVFA 4X1YA 4CLDA 3WAGA 4B3SB 1EINA 1NVWQ 2I99A 3R4CA 5KQSA 1OA0A 4UPVA 3MWJA 2QPAA 3BA6A 1WF6A 3ORYA 3LS2A 4QO7A 3LRPA 3T94A 4IEEA 2H5JA 1ZAKA 5LIRA 3NJ4A 3AEYA 5A4IS 3E23A 5C7OO 4W9NC 5EJ9A 4JWTA 1FDVA 4QYIB 1C7JA 5I7AA 5L3SB 2J0VA 3AKEA 4WZAA 5CVDA 4C43A 3WMFA 4YALA 1M6VB 1NOJA 2QT9A 4NIMA 2CBXA 1U2DC 1QONA 1UZNA 2AXNA 5E6SA 3IM4A 1VP9A 1SU6A 1V8OA 1XLTC 1K1EA 4XJTA 3ETGA 1RAEA 3CPHA 4HC4A 1CUXA 2QBYB 1MX3A 3FCXA 3MXOA 1CZNA 5D01A 1KSJA 5FUWA 3I1JA 1WEHA 4E09A 2IX9A 2V5VA 3ZLBA 4BGUA 3UMMA 1L3BA 1PV1A 2YWJA 1M1YE 5E6RB 2GEBA 3K3PA 1DUIA 1MUUA 3FVVA 4ZEOA 3SI7A 2D1RA 3OE7A 3NVDA 4M2LA 5AH0A 2EW1A 1KIMA 3GLQA 5YASA 1Z3IX 2AQHA 2VC2B 4RLSA 1KZ1A 3D0RA 3SG0A 3MUFA 5I9SA 2H7XA 3OSUA 4RK1A 3JVDA 1II8A 2J5RA 5KYWA 4C08A 3THXA 2MT9A 2IIQA 2C5BA 3H5AA 3PIIA 1ZBQA 2JHPA 3RPEA 1Y8AA 2FNAA 3VNVA 1OWLA 3T95A 1F4VA 2FFQA 2HMAA 4HNRA 4KLCA 4ENPA 1HA3A 1PZFA 3UT0A 4CW7A 1BOFA 4M7PA 3BEOA 2CHEA 2CNKA 1E1YA 4ECAA 2CXPA 4LE2A 4DNFA 1MJ5A 2F8LA 3COVA 3PJGA 5AOAA 2A9PA 1WZUA 2DUMA 3O7MA 5DLYA 1KBZA 1E3WA 4BKPA 1M5RA 1R12A 2I54A 2IHJA 3GJ0A 4TMYA 2R44A 3NNDA 5CA0B 5A9SB 1VI6A 3GJ7A 2ET6A 5FYDA 2QW8A 4GC9A 3ZY2A 3EA4A 4O0MA 1K63A 1UC4B 1XVIA 4KQFA 3TSAA 5A4DA 1YV9A 1F5SA 1UIRA 1VCIA 2DM6A 2HLHA 2ZIWB 1O5IA 4DJ5X 4C7JA 3HSYA 3GJRA 2AX3A 4Q0MA 5GVSA 1VJDA 3D54D 3FOBA 4FOOA 3SSNA 2D74A 5C37A 1RWMA 1L5RA 5E2AA 1NLZA 1EUCB 2D1YA 2G80A 3FX2A 1E96A 5BT8A 1RWNA 2GT1A 3O8OA 4XCQA 1DUVG 3KEOA 1JJ7A 1P2UA 2PXHA 4NLLA 1YONA 4BFUA 2FJPA 4LHZA 1BWQA 4MS1A 4W9RA 5I7FA 1E5DA 2C77A 1I36A 2ZIXB 2VWQA 1AX9A 3H84A 4M9QA 4B45A 3KKEA 3GRZA 5ALOA 1TD1A 1G5TA 3IIEA 3IYLW 3RR2A 3BRWD 4YMWA 4B0PA 2VDVE 4BFSA 3SEFA 2LCIA 1F4PA 1X94A 3NYRA 1H9BA 3QKTA 1ZA1A 3ZWNA 3BB4A 3UJAA 2DPMA 3A10A 3PRHA 2O06A 4BPBA 3SBDA 3FHOA 4LFAB 2WFMA 3RSHA 5CFMA 3H16A 2JAWA 1OZ0A 3ET5A 4XQ9A 4C06A 4XH9B 1LV8A 3G7SA 5LNK6 4C4AA 2DSNA 4H7IA 1BQEA 2PMKA 1P1BA 4RO0A 3E7DA 4EHLA 2ATIA 2JLWA 1AGPA 3CUKA 5FLYA 1T4CB 3ZDBA 3KZ1E 1RLTA 4A0RA 4XLTA 1F6DA 5AK4A 4BWYA 4KQGA 3HGTA 4RSHA 1EWQA 3KKNA 5CCBA 1I8TA 1LRLA 1D1SA 1HSOA 3AUJB 1RRMA 3LFHA 4OJMX 5LWHA 2FPWA 3M70A 4IV8A 4K86A 3W3AH 3KYBA 5ICEA 3H4MA 1E1KA 1QIFA 1U7DA 2ZYHA 2VHEA 1XTZA 1QJCA 3IUSA 2EX0A 3Q1KA 3Q3EA 4NL4H 1JJAA 5DNDA 3GT0A 1C81A 4KVAA 4H08A 2BBOA 4R1PA 6REQB 1UADA 3E2PA 4OP1A 3T4XA 2D2FA 2XRYA 1JYSA 1NRWA 1OH6A 3GY0A 1MF7A 2E7ZA 2Z2IA 3TRJA 3AONB 1OXBB 1ZMTA 4W8HA 1L4UA 2R8ZA 4BNFA 2XCOA 4RQAA 4WXEA 4EYEA 2OBNA 1ADYA 1Z5NA 3WMXA 1YJ8A 1KMCA 4PVDA 4TUYB 3LBNA 4RD1A 5E6UA 4A8TA 5IJWA 5BPFA 5K6RA 1RVDA 5LWQA 621PA 3R7DA 3NB0A 1KKUA 2D2EA 4MICA 1YRQA 4H7EA 2WMNB 1XRNA 4RS4A 3SZUA 3VYTB 4EKGA 3RREA 2R00C 7REQB 3P0JA 2GPTA 4MV3A 3VFDA 2CDNA 2QN9A 3PXUA 3EPLA 4Z7QB 4K1LA 1M66A 5E2BA 3PZBA 1U0SY 4NH4A 4PHTA 2DFTA 4NZPA 5ESRA 4HUTA 5I6DA 4ZEVA 3L7YA 4HDSA 5DJ5A 1FTSA 4F2DA 2BGJA 1E6EA 2PV7A 4CKBA 4OO3A 3FDZB 1DV2A 4JJ7A 1SQSA 5ILQA 1MNAA 4UM9D 2Q1XA 1X7YA 5ES4B 4MLZA 1I0IA 1TM2A 4MOWA 4JY7A 4J0GA 3VKHA 1XYGA 2H1FA 2I6SA 1UM9B 2BHRA 2ISSD