2CBGA

Crystal structure of the pmsf-inhibited thioesterase domain of the fengycin biosynthesis cluster
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
210
Chain Sequence
SAAGEQHVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITEIQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGIQTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNILDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Thioesterase Domain of the Fengycin Biosynthesis Cluster: A Structural Base for the Macrocyclization of a Non-Ribosomal Lipopeptide
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords FENGYCIN SYNTHETASE
total genus 69
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.40 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2cbgA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cbgA01
3STWA 4UHDA 2OCLA 2X76A 3DL7A 5CT4A 3BL8A 5HF9A 2WFLB 4ZREA 2XLCA 2Y2VA 2WJ6A 3HACA 1CVLA 2BKLA 4CCWA 1K8QA 1E5TA 2O2GA 4AZ0A 4BDSA 1CUCA 4IH9A 5I7UA 1HL7A 2GYUA 2FJ0A 5ALWA 1QE3A 1P0IA 4PW0A 4JH0A 1HBJA 1XLVA 3H19A 3B12A 4LHEA 3G9UA 1XRMA 3SC2A 4LIPD 4Q34A 1C4XA 3G8YA 1QFSA 4HRYA 4Q3OA 2P8SA 1JMYA 4HXEB 5K3AA 4WFKA 1VZ3A 4PO3X 2ZYIA 4WCVA 5EGNA 3D0KA 1A88A 1BU8A 1CUEA 5AIBA 4FBMA 3KD2A 5BWBA 4P92A 5JZSA 1N1MA 3FSGA 5KWJA 2PSJA 4NS4A 1G4HA 2OPHA 3H04A 1J2EA 3VDXA 4X90A 4WY8A 2WIJA 5E4JA 1LZLA 1VKHA 5CH3A 4BAUA 1SCIA 4HRXA 4Y2XA 2BUBA 1BCRA 5DTJA 5DTIA 3QM1A 4AB1A 3WYNA 4IO0A 4C6HA 3WK6A 3IDAA 2ONCA 1XZAA 4KE6A 3I6ZA 1K5PA 1WPXA 1LBSA 5JD5A 1LPOA 1R3DA 5AI0A 1GT6A 1JU3A 4X7BA 1DX6A 3QITA 5LZ8A 3LIPA 1PJAA 4GI1A 4Q1VA 4PQEA 1NX9A 4XVCA 1S8OA 1U4NA 3F67A 2OGSA 2XUQA 5DYWA 2VSQA 3I2GA 2HA2A 4DNFA 2VF2A 4G8BA 3C87A 2CBGA 3SWWA 5SYMA 4KEAA 4Y2QA 1E8DA 3HYSA 2XUHA 3H1BA 5CT9A 4CCYB 3FOBA 4KRXA 2HADA 1J06A 3GFFA 2DFPA 4CI9A 2I3DA 4BZZA 2JGFA 2CB9A 4X00A 3OC0A 3STVA 3JW8A 3UMJA 2XMGA 5FDFA 1CUZA 2XQJA 2RONA 4DGQA 3D2BA 3KDAA 4U2BA 2G5PA 3F97A 1XROA 1SC9A 5AM5A 4UBMA 1LPAB 2O7VA 5DLPA 2G63A 3BWXA 4S0XA 3DOHA 2BUAA 4X94A 3RKSA 3VJLA 3IUNA 1JFRA 5AI4A 5AI8A 1LPPA 3BF7A 4KRYA 5YASA 5EFZA 2WHPA 1MT3A 1UK6A 4JNCA 5HFNA 3M82A 4Q82A 3FAKA 1XRRA 3I2HA 3AZQA 3D5EA 4W1RA 3HC7A 5HQ3B 1H2XA 3GA7A 2JGIA 3YASA 4Y9SA 1VE7A 4RE5A 1U2EA 5ALJA 4AMZA 2BCEA 2W6CX 5AOAA 1W52X 4EY4A 1CR6A 3IURA 3C5WP 5SYNA 5C81A 3MUOA 3WIOA 3C6BA 3OTQA 1Z68A 3T52A 3F96A 1BRTA 4U2EA 4DYHA 1WCYA 5AKXA 2JGEA 4DNOA 4M0FA 2R8BA 3R3VA 3O4JA 1AURA 1J07A 4NVRA 1B41A 3IUQA 2J3DA 4WY5A 5AKHA 3AINA 1YS1X 3RLIA 2WM2A 4ROTA 2FUKA 4A23A 2OG1A 4XIIA 1HKHA 1QZ3A 5JANA 1DWPA 2HRRA 3ZWQA 1TRHA 3W9BA 2HU5A 1GZ7A 3H2JA 3RK4A 4BCCA 4A16A 4X3CA 4B84A 3F9CA 1T2NA 2Z8ZA 1K63A 1AMNA 4QLOA 1GXSA 1MO2A 2XB6A 1VA4A 3A70A 4E15A 5FPQA 5ALDA 5K3FA 2GZSA 2JF0A 3C8DA 3P2MA 4G5XA 1XRNA 3VXKA 4DMCA 4FKBA 5I9IA 4OPMA 4DM7A 2RAUA 4B0OA 3QPDA 3F98A 1ACJA 2IX9A 5JAUA 3B3QA 1YS2X 4MWSA 4TVKA 4I3FA 3I2IA 1EDBA 2QR5A 4P93A 1CEXA 3M83A 2CJPA 2AJDA 2VAVA 5CXUA 1N5RA 2QZPA 3E4DA 5AM1A 4BC0A 4GW3A 1JT2A 4K6HA 4DTCA 3N0TA 3I6MA 4QDXA 1TAHA 4C87A 3VVMA 4OB7A 4OCZA 3K9BA 5AKZA 3O9VA 1GPLA 3U0VA 4K2AA 3V1LA 3WL5A 3FCXA 3IIIA 3O4IA 3FVTA 3OG9A 3G0GA 2OLEA 2ZJ7A 3L1IA 3R3UA 2C0PA 1ZGCA 3G9XA 1VXRA 2VJDA 1SCKA 5LP1A 1XQYA 2QUBA 4GXNA 1BS9A 3GELA 4X6YA 1UKCA 2JIDA 5ALFA 1IUOA 2PU7A 2Y6VA 3JYHA 4K6KA 3VJMA 1U8EA 4FFVA 1R9MA 3G0IA 4OYYA 5BOVA 4IHAA 5FRDA 4EB0A 2Z8XA 1LPBB 4U2DA 4ZXFA 4OD0A 3HSSA 5CTAA 5JARA 1H2YA 1EB8A 4W1PA 1E66A 3DKKA 4UHFA 2QKYA 1OCEA 3IA2A 4Y2UA 5D3KA 3C45A 2Z5GA 3CN9A 1ZI8A 5IKXA 2Q0XA 3FYUC 1A7UA 4HTAA 2QRUA 5JYCA 3NWOA 5IVDA 3HI4A 3D59A 4HXFB 2HA4A 3FYUA 3WJ1A 1NU6A 1DQYA 3WQHA 3V1KA 3S8YA 2GBCA 4Q05A 3C70A 4G9EA 3FLEA 2HFKA 3C6XA 5AK5A 4KYVA 2C4HA 1UFOA 3T4UA 3U1TA 3DS8A 5AKJA 3MVEA 1WPRA 1ZIXA 3WA7A 4X71A 3I2FA 2HA7A 1XZHA 5D3ZA 4JUIA 5A62A 1YA4A 4G4GA 5ALZA 1ZD4A 1B6GA 2DSNA 4FDMA 2DHCA 4JEIA 5CH8A 5DYYA 3N2ZB 4BP8A 2XMQA 3QVMA 3QH4A 4XWGA 4CIBA 5ALUA 4M0EA 4MQLA 4E14A 3E0XA 4CCYA 2WSLA 3Q8WA 1R1DA 2GYWA 3A2NA 2WUEA 1EB9A 1GPKA 2HU7A 2XUKA 3PFCA 4OB6A 2BAGA 5JAPA 5HF8A 4BVKA 1EDDA 1CRLA 2VTVA 3M3DA 2OXEA 3O0DA 3KSRA 2WU3A 2LIPA 5AOBA 2JGJA 2O2IA 1GQRA 5A71A 5JASA 4ZV9A 3G7NA 4QDUA 4N8DA 4C01A 5AM2A 1CUUA 5T4FA 3IVMA 1BROA 2OGTA 3ESAA 3VKFA 5AM0A 4G9GA 2DR0A 4INZA 1HPLA 2Z3WA 5DNUA 1Y37A 5JAHA 3I28A 4CFSA 2XMZA 4AN1A 3DOIA 5FV4A 1FJ2A 3DYVA 4B83A 2B20A 4FNGA 1EXWA 4H77A 4GBGA 1AZWA 3FWHA 3AZPA 1XLUA 1CFJA 4L3WA 5D7BA 1TK3A 3ZLVA 1K4YA 5CURA 1CLEA 4W63A 5A7GA 4MQMA 4UFNA 2HU8A 4DIUA 5CT8A 2HL6A 1G5FA 1FFBA 1FFDA 5CT6A 1CIJA 3AILA 2EEPA 5ALMA 2DQYA 3WK4A 2XUAA 2BUCA 3H2KA 1WM1A 3FYTA 4L9AA 4BB0A 2AJCA 2XE4A 3O4GA 3I1YA 4N8EA 4BZWA 4QDTA 4W1SA 1HLGA 1AKNA 2ACEA 1ZICA 1MNAA 4G4JA 1IZ7A 4NMWA 3E3AA 2XDWA 3Q0TA 2XMDA 3STUA 4C4XA 3IUJA 4BVLA 1AC5A 2ZJ6A 3G0BA 1UKBA 2HA0A 1MJ5A 4A5SA 4W9RA 4NZZA 2WIDA 4QNNA 5HFAA 5DNVA 4GWLA 4FOLA 4C88A 3D3NA 4B80A 2PSFA 1BN7A 2WJ4A 5AOCA 1EHYA 4H7KA 5T4HA 2EDAA 4B85A 1YB7A 3ANTA 2B4KA 4J0IA 2X5XA 1W75A 3EF3A 3DNMA 1K6EA 3D7RA 2ES4A 2Y1KA 2O2HA 5AM4A 3FSGD 1THGA 1X70A 2HIHA 4ITVA 1MTZA 4EY8A 3DQZA 1CV2A 3ICWA 5C8XA 4CIAA 4LKOA 2WTNA 4J0JA 2CZQA 1DQZA 4LXGA 5AK3A 4N5IX 5A7HA 5KWIA 3DKRA 1LPMA 2I78A 4H7IA 1QTIA 4QA9A 4HVTA 4CG1A 4BCDA 4J7AA 4B81A 4OYLA 1Y7HA 3QZUA 3NOXA 5T4EA 2WIKA 5C7YA 4KE8A 3ESDA 5CRIA 1ODTC 1DTEA 5EIAA 1A8UA 2HFJA 4EUSA 4OB8A 2C5GA 4K6GA 3R3WA 2NW6A 5J3JA 1OXMA 1GKLA 1EINA 1YA8A 4HXGA 5AHXA 4EZIA 1Q83A 5JD6A 4AX4A 1WHSA 1ACLA 1AQLA 1SOMA 1IZ8A 3HRHA 2WU4A 3CCCA 2R11A 5K3FB 1MNQA 2XUIA 3GUUA 3R3ZA 1JJBA 2DHDA 3VJKA 2HM7A 2RGUA 2HA6A 4UHCA 3X3HA 1UZAA 5ALRA 3ZPXA 3W05A 3H2IA 1UK7A 4Y2SA 3L1JA 4B0PA 3H1AA 4HS9A 3WJ2A 5LZ9A 5ALXA 4FLFA 1F0PA 1WHTA 3BXPA 1UOPA 2CKMA 4P9NA 1G42A 1RWQA 1TQHA 4IH1A 1ISPA 1MU0A 4UBIA 2CEKA 1VA5A 3ED1A 1AX9A 4QZVA 1UT6A 2XQGA 3NGMA 4PNZA 1DT3A 4AQDA 2I03A 4X95A 4L72A 5ALKA 4Y2TA 1WB5A 1MAHA 4E11A 4E46A 1CUXA 1WB4A 5AK6A 5AKGA 3AUKA 1BE0A 1QIFA 1QIIA 4OSEA 5JAOA 3WMRA 4IH4A 5HZGA 3R3XA 5JADA 5ALVA 2PPLA 1LNSA 1XZEA 1XZJA 3O9MA 4B9AA 4BATA 1YAHA 1MX9A 3PI6A 3R40A 3FLBA 3STTA 1QJ4A 1H2ZA 5LLSA 4FTWA 4C89A 2H7CA 4H7JA 5AKEA 1UK9A 3JWEA 2PSEA 1XRPA 4U2GA 5HK8A 1VXOA 4RNCA 2D5LA 2QVBA 4KR0A 4OUKX 1VLQA 4QWMA 7YASA 1L7AA 4UFOA 2C0QA 4ZI5A 5LYYA 4GECA 1P0QA 5JATA 1PV1A 5LZ4A 3WK8A 3OM8A 4YK7A 1YCDA 4LYEA 2WIGA 3PF8A 1CPYA 4G8CA 4X6XA 1UOQA 4U2FA 1CUWA 4DSAA 3QMVA 2ZSHA 5C8ZA 2Y6UA 3PUIA 5JZ9A 3ZI7A 5HKBA 3LIIA 3KWFA 2PUJA 2PU5A 4BE9A 1T4MA 5HF5A 3I2JA 2HA5A 3K2IA 5T4BA 1QO7A 4CG3A 1TIBA 3E1GA 1TCCA 1WB6A 1VZ2A 1CUDA 3PDCA 2WLSA 1EH5A 2XQIA 2YXPX 3W04A 1IUNA 4EBBA 4J0HA 2J3QA 2VJBA 2XT0A 2DQZA 2WUFA 4UBKA 3QMMA 5AP9A 3FCYA 3WA6A 1UKAA 1ZIYA 3G0CA 1QIKA 3TRDA 1JU4A 2WQZA 1FSSA 3IUMA 2XMSA 3RM3A 1W6RA 2XMBA 3ZV7A 2JEZA 4ZV7A 2XMCA 5C8VA 2AJBA 4B82A 4DNQA 3F8SA 1CUYA 3HXKA 3BDVA 3W2TA 5ALLA 3QYJA 4MXDA 3LP5A 2ZYHA 3PUHA 5JIBA 3MGAA 2ZYSA 3MUNA 5JZBA 2GBFA 1PFQA 3PE6A 1P0PA 1D07A 2YASA 4AXBA 4BP9A 2XLBA 3AFIA 5ALGA 4P08A 3I2KA 3C5VA 2GBGA 4FFWA 3AIMA 2X8BA 4EY7A 3DLTA 5CW2A 2YH2A 5ESRA 2ROQA 1JJIA 3DL4A 2VAXA 6YASA 2OCKA 4X97A 3DYIA 1XZDA 3M81A 5LZ7A 3D2CA 1GQSA 5FKJA 4BBZA 4CG2A 1L7QA 5BWCA 3IBTA 5EHNA 3WWPA 2QTBA 3A2MA 1QONA 2WHQA 5AI6A 1HDEA 3ICVA 4G4IA 5AH0A 3WL7A 2FX5A 4J3JA 3D4LA 1N8SA 3AIOA 3FLAA 2WHRA 1TKRA 4BC1A 3QPAA 4LYDA 4DLNA 4WFJA 1GKKA 5ALTA 4AN0A 4GEGA 1AUOA 5BV7A 2ORYA 1JMKC 1N5MA 4Y2RA 2PX6A 1FFEA 1QIHA 1MX1A 4MJ3A 1UK8A 4Y2PA 2WG2A 1CQZA 1XZFA 1DWOA 3TEJA 4H7FA 4KE9A 3BIWA 3TJMA 4AO6A 4Z49A 2K2QB 1XZMA 3WK7A 3H17A 5EIHA 4BTLA 4GHWA 1BN6A 3SX4A 5CMLA 4QE3A 4KJXA 2PSDA 3A6ZA 3WKBA 4GDMA 1CUJA 3R0VA 4V2IA 1ETHA 4QDOA 5CT5A 4BDTA 3WKEA 4FLEA 1VJ5A 2QXTA 4ETWA 1X2BA 1QGED 1XZCA 3WZMA 1KEZA 1W1IA 4UHHA 4X85A 4W1QA 1UOOA 4F5ZA 2J4CA 1CUGA 5K3DA 1F6WA 1UWCA 5HCUA 4BVJA 1A8SA 4H18A 4X93A 3STXA 1LBTA 4ZGBA 2C7BA 2OCGA 1CUHA 5AICA 3EQ7A 4JYMA 1WOMA 5ALQA 2PBLA 1E3QA 1QIJA 4FLMA 2QT9A 5HF6A 1JKMA 4J0GA 4Q3KA 4XX1A 4C4YA 1YR2A 4UBNA 1ZOIA 5LKAA 1L7RA 1XRLA 1LPNA 4WFIA 5E2IA 3WWDA 2QMQA 1QTRA 1QOZA 1RYYA 1O6GA 1ZGBA 3PICA 1THTA 5E4YA 5D6OA 2GYVA 2JGKA 3K6KA 2OAGA 3DDUA 4PF1A 1DWQA 1HQDA 4J03A 2I3ZA 1GGVA 3WK9A 5H3HA 3V1MA 1ORWA 1QO9A 3A2LA 4U2CA 1ZD3A 1SFRA 1E8MA 3G0DA 3AIKA 1QFMA 3WYDA 2RIPA 2XUOA 1F8UA 1EK1A 1X2EA 1MN6A 1W4LA 3WK5A 4DMKA 3BDIA 5HK9A 4RPCA 5AJHA 2Y2UA 2PKYX 1XRQA 4AO8A 3WL6A 1XQWA 2UZ0A 3AZOA 5ALPA 1NU8A 2EDCA 5ALSA 3LLCA 4UFPA 3BJRA 2PM8A 1XZBA 5AKLA 2G4LA 2XQFA 5ALHA 5FLKA 4WJLA 4BE4A 4FBLA 2B61A 4KAFA 4BTVA 4C4ZA 1ZD2P 4FMPA 1XFDA 5AKKA 2JGMA 2Z3ZA 1XQVA 5FPPA 2HA3A 2BGNA 3HJUA 4AO7A 2JEYA 2XMRA 2WUGA 2V96A 1EA5A 4BCBA 4UHEA 3BF8A 1FFCA 3KOOA 3BE8A 1LPSA 1Q0RA 5K3BA 5IVHA 5KBYA 5A7FA 2PL5A 3SK0A 4H35A 2OGZA 3V48A 4ZWNA 1BCSA 5ALIA 2QM0A 4DMHA 1EI9A 2IIVA 3LS2A 1MPXA 4WDQA 1MX5A 1TCAA 3KXPA 2C58A 4MEAA 2ZJFA 4LXIA 4IQ4A 4QEKA 1YASA 2WKWA 4X6UA 2QS9A 5E4TA 4GLBA 2B9VA 4DNPA 1XZGA 1BEZA 5HQ3A 5ALEA 2V97A 1CUFA 4TGLA 3R3YA 2WFMA 3EBLA 1QIEA 2RHTA 1DU4A 4AZ3A 3R41A 2J4FA 5K3EA 2WHPB 1USWA 2QXUA 5DJ5A 1EDEA 1SCQA 2QOEA 3DJYA 4HZGA 1R88A 4ARBA 4KACA 2BGRA 3WL8A 2XUGA 2XI4A 3L1HA 1KU6A 4Q3LA 5LIPA 1E8NA 5AI5A 3G02A 1IVYA 5EIEA 5EHQA 1OILA 1YSCA 4QLAA 2XQKA 1H22A 4B6GA 2XUJA 4F21A 5K5EA 1CUAA 4B9EA 5AKIA 3TGLA 4OU4A 3C8HA 5KREA 5FP0A 1M33A 5AK4A 3GBSA 1ZI6A 5ALYA 1LLFA 2H1IA 3RARA 5A6VA 1DT5A 1R50A 3WWOA 3WZLA 2IITA 1QIGA 2C5FA 1XQXA 4UBLA 3FBWA 1IUPA 2PUHA 1ZD5A 5IH7A 4Y7DA 5AI9A 1UXOA 4J0KA 1BEEA 4EY6A 3HEAA 3V9AA 3W9UA 4YPVA 1KU0A 2ACKA 4KE7A 2RHWA 5IVKA 2QUAA 4MYSA 3GZJA 1JJFA 1FFAA 2WIFA 4HAIA 4FWBA 2XUPA 1CQWA 5DNWA 4I19A 4RE6A 2ZVDA 1VE6A 4RGYA 2YYSA 2FJPA 2BFNA 1EX9A 2OQIA 1O6FA 4B7ZA 4G8DA 3GROA 1R9NA 3IB3A 4EA6A 3OOSA 4PSUA 3ILSA 2V9ZA 1I6WA 3H2GA 3CN7A 3I6YA 3PF9A 3ESBA 4KAJA 4H7EA 5IVIA 2VATA 2AJLI 5AIAA 4X91A 3WI7A 1Y7IA 5LZ5A 3EQ8A 3BJMA 4EY5A 5AM3A 3I1IA 5JD4A 4LXHA 3H18A 5CH5A 1P0MA 2AXEA 2WUDA 3OPMA 1Q0ZA 3LCRA 2HHAA 2VQ6A 4MWTA 4M0MA 3VISA 1C7IA 2DHEA 1YAJA 4Y2YA 5DWDA 3WKCA 4WDRA 4ZRDA 1ZJ4A 1IMJA 3IULA 5ISMA 2CMFA 1DINA 1RP1A 1EVEA 1GPNA 1G66A 3ZLTA 4UUQA 3H0CA 3G9ZA 3HZOA 5A2GA 1QIDA 2XUFA 4DSZA 1A8QA 3QBJA 5EHZA 5LKRA 4PV7A 2VJAA 2HDWA 2JGLA 3B5EA 1AGYA 4MEBA 4Y2JA 3OURA 3PFBA 1ZJ5A 2V98A 4BRSA 5FUMA 2VT7A 3FYUB 1Q84A 3ANSA 2O7RA 3EQ9A 1DX4A 3WWCA 4OU5A 4FHZA 4J0DA 4D9JA 5I8PA 3O4HA 4H0CA 4BAZA 1XZKA 5EI5A 5HKAA 3DD5A 2W22A 3FNBA 4UPDA 5ALNA 5FXMA 5AKYA 3CCBA 4L0CA 3G9TA 1CUIA 2VEOA 2WJ3A 3C43A 4UBJA 4YX9A 3CXUA 5CXXA 2H7YA 1TCBA 3H2HA 1XZIA 1CUBA 5CBKA 1R4ZA 3HLKA 2DCMA 4XJVA 1EK2A 4H7DA 1F0NA 3C6YA 3FVRA 5FOQA 3DCNA 3BIXA 3W06A 1ODCA 1U65A 4FNMA 3ZLUA 3WWEA 2ZSIA 3WKAA 4K5QA 3UUEA 4QDZA 4UBOA 1XKLA 2OCIA 1QLWA 2BJHA 2WILA 3NUZA 4YASA 4N5HX 1YB6A 2D0DA 2OQVA 1CUVA 2VA9A 1ORVA 3C6ZA 4O08A 1EVQA 4J0CA 3WKDA 3KWJA 4AMYA 1ZI9A 3AJAA 3D2AA 2GZRA 4H7HA 3HABA 1LGYA 1MAAA 1LZKA 4TPKA 1C7JA 1QIMA 3VVLA 5LZ2A 4MYDA 4QWWA 3EIOA 2ZYRA 5K3CA 2GBIA 4G1FA 4KAAA 5JALA 2E3JA 4BAGA 4PSCA 5ALOA 3STYA 1CUSA 2WG0A 3QPCA 3V1NA 1J1IA 4PSDA 2G5TA 1XKTA 2RI6A 2VT6A 4DMFA 1W76A 2JBWA 3S2ZA 3ESCA 4N8SA 2H7XA 1ODSA 2WG1A 2ECFA 2OAEA 4X92A 2PSHA 3O95A 4BYMA 1E89A 4Y2VA 4F60A 2AJ8A 4JYPA 5AO9A 1H23A 2WTMA 4BRZA 5DYTA 4ARAA 2XUDA 4UHBA 4F0JA 2WFLA 2HRQA 2PVSA 5F4ZA 4I4CA 2CUTA 3DEAA 3WIBA 1XZLA 3UUFA 2QJRA 2H9YA 2VJCA 4EHBA 1VOTA 1JI3A 3QMWA 2QJWA 3WLAA 1H2WA 5EHXA 1XLWA 2WFZA
chains in the Genus database with same CATH superfamily
4HWTA 4C30A 2FE4A 1PZEA 3Q10A 4RXUA 1E61A 3ZGVA 2UUOA 1Q1GA 2D5IA 4UHDA 1NVAA 4BB9A 2OCLA 3KT0A 5I4CA 1DV2A 5CT4A 5HF9A 1DADA 3AVQA 4M1SA 2WFLB 4LXQA 1NBHA 2PH5A 2AC7A 3D0RA 3T8YA 4UNRA 3M3HA 4UPEA 2XLCA 1U7WA 1Q3HA 5K8LA 3MELA 3IHTA 4S2EA 4QNMA 2I8AA 1Z0UA 3A4YA 4Z9BA 1E5TA 2O2GA 4UJ5A 4HWSA 4M49A 2SHKA 1NY6A 4YXWD 2GSDA 4NBVA 4P7JA 4BDSA 3NH9A 1A2OA 3DOEA 4RVHA 2QLBA 3LLSA 2FV8A 3G49A 3NETA 4N6NA 4QGGA 4YV7A 3EY4A 3IJ5A 1ZVVA 1GUBA 4RJLA 2OGWA 3CX8A 5ALWA 1NPTO 1QE3A 1Y3IA 2LZ0A 3AHHA 4QJBA 5E7MA 4B47A 3R9WA 3IVCA 1I6KA 4DCPA 1YVUA 3IIKA 3FZGA 4RQBA 1N9GB 3F7NA 2YTZA 3B12A 3LQKA 2A4MA 3S2SA 4CM7A 4XSGA 4A92A 5AVVA 3H83A 1RBZA 3TZLA 4MLCA 2WWRA 4DVJA 2R00A 4XDYA 4LIPD 3INYA 2XYRA 1ZM9A 3IJPA 3V8PA 1QFSA 3INNA 4HRYA 4U5XA 5I4IA 2BEWB 3HFRA 1CZRA 3ZDRA 1GA6A 3H13A 1CW2B 4Q3OA 1Z0DA 1T5HX 3X1XA 2R5NA 1UADA 1JMYA 5CGZA 3C3DA 5JQGA 2G28A 3WBBA 1VZ3A 3JRXA 4QVIA 4OQMA 1ECPA 4CMKA 4MA0A 2RD2A 2WK1A 2D8AA 3G13A 4A2CA 2NAPA 4PZLA 3FGNA 4PXYA 1NUSA 1A88A 1Q57A 5AMXA 2XA1A 5EMMA 3BWBA 1CUEA 1F17A 3FSJX 4R1MA 5DNCA 1BU5A 3SYRA 1XQ9A 4FBMA 4I55F 5HOEA 4A0HA 5K4GA 2YWGA 1N2EA 3E9DA 1YKFA 4AKIA 1L5WA 2G0NA 1GILA 2O7NA 1DZ3A 1DEOA 1M1NA 1JHQA 1F9EA 2I6TA 3ESYA 4H1TA 4IIGA 3VUEA 2I4MA 4UDNA 1F20A 1BXRA 4HEQA 1FMJA 1SC6A 3N8KA 4ZCTA 1Z56C 4FCVA 3OQ6A 4YRIA 4LJRA 4LMAA 1ES9A 3G0OA 1YQEA 2D5CA 2ODNA 3MTQA 2JK0A 1KEUA 5CYFA 4M22A 1GQOA 1I13A 3VDXA 1IWPB 4UEKA 5C18A 4P5EA 3ZJ5A 2QD2A 5A0TA 1E2FA 2XRMA 4RYDA 2A67A 4P31A 4DG9A 4MDEA 1CKEA 1R4NA 2Z8YA 4P0TA 1WPQA 1VIYA 3SR0A 4CG0A 5JW6A 4NIMA 5KB3A 4BMPB 1QAMA 1MOSA 4FKZA 1BHO1 1JPNA 5TF0A 4K6CA 1LBEA 4HQLA 2ODBA 4XR9A 3KQUA 1YRWA 4DKJA 3ZQ4A 1J22A 3OTWA 5DTIA 1VHLA 3K9QO 5BURA 1UBNA 4PAMA 4R84A 3BT7A 5FD8A 3L4BA 3IDAA 3IPXA 1HNNA 1V8PA 1CTQA 1XZAA 1JEQB 1RCUA 2C7VA 1ZGZA 3E82A 1C3LA 3L8ZA 3OPYI 4IM7A 3JALA 4ENSA 4ALKA 4WGGA 4EI7A 1G6OA 4ZC1A 2J87A 1E94E 2FUG6 4D0SA 4DR6B 1NVXQ 1LBSA 3SBEA 2CMDA 3KFVA 4GICA 1JAYA 3R5FA 1CSEE 1Q1AA 1T4CA 2XE7A 4LRXA 4UM8B 3MMNA 4CFYA 1MIOA 4HNHA 3STHA 5C51B 3GPCA 1RYZA 3C4QA 3P2JA 1JZQA 3RU7A 4AICA 5EPUA 3TOCA 3HO1A 2QM8A 2HPVA 1WDTA 3A4LA 2DT5A 1YR8A 1VB3A 1WLSA 1G9SA 2NACA 2Z57A 3JYQA 3KOXA 4QL3A 3RGGA 4Z51A 3RH0A 4ZTUB 1JXMA 2ZJ8A 4ZAYA 4C4OA 3RG2A 3UAWA 1SVLA 4TS3A 1GZHB 4N3GA 4Q4DA 4G0NA 1M75A 3PPXA 2H0RA 2X13A 4F2PA 4UNIA 4ZRMA 4UUNA 4NOKA 4PG8A 5BP7A 1KRHA 4F4CA 2JCSA 3O2QB 5I45A 1EU1A 2V3WA 3E2IA 4FU0A 4ODIA 3TGWA 4GT1A 4IQ8A 2W6MA 2P4QA 3I72A 3OT1B 5EJ9A 1U4NA 3HXMA 2FUEA 3O8OB 1SEVA 5AQEA 2I7DA 3L46A 2Q2OA 1ZG3A 1MABB 2YHSA 3D3EA 2IS4A 4DCNA 1FDSA 5A5FA 2O8EA 1GARA 1UBUS 2UZIR 3UAYA 4ZYXA 3BH6A 1DRKA 2QR2A 4JLAA 4MRSA 4DNFA 4PZEA 1KC3A 3TKLA 3ON5A 4KWHA 5A5VA 4NK5A 2Z56A 5SYMA 5JCPA 4HDRB 5KOHA 2X40A 1XWWA 2DKFA 2Y9PB 1PJBA 4XQ9A 1JWLA 4Y2QA 4CIXA 5L53A 1CJMA 3CZAA 3CVUA 5K8UA 3IAUA 5JYBA 2O23A 4F3TA 3TAHA 2GN6A 4QXAA 2GOYA 2P40A 5FI5A 1G7CA 3FOBA 4KRXA 3CHYA 5JPIA 3ZTTA 1XJ0A 3C6MA 4BKMA 4CI9A 2H54A 3U4CA 4BZZA 2JGFA 2O2XA 3WQRA 5F64A 2CB9A 1SBNE 1GFIA 2QQ0A 2R6FA 3R7LA 4ENPA 3STVA 4EG5A 1GTG1 4A3SA 4JI1B 2WU8A 2XMGA 3G1UA 4PEVA 5DTMA 3TTVA 3JQQA 5PGMA 4M9QA 4G1MB 1DKLA 4GL4A 2O54A 3B13B 3MB8A 2GVDC 2YY7A 4LS3A 4MKRA 5KQGA 3W5BA 2EYUA 3C7TA 4AUKA 3FI9A 5DU2A 3E3MA 1VPLA 4QQNA 4LFCB 5C9ZA 3KPYA 1HRKA 2Q4TA 3T35A 3L7YA 4Q24A 2G5PA 2PQ6A 4GOMD 5TC4A 4PGFA 1XEAA 1XROA 1GL3A 2Q21A 4X1YA 1II0A 4NPCA 3BIFA 1LPAB 3A0RB 1DDOA 4GGMX 1PR4A 2PZBA 1Q0HA 3CBQA 4FOOA 1GNRA 1TLFA 3F4KA 3OFNA 4HO1X 1JKIA 3PQCA 2G63A 2V0NA 2GBLA 2XB4A 1FFWA 1M83A 3DOHA 3OE5A 3QVJA 4ZAZA 5B3KA 1TAQA 2BUAA 5LFAA 3U6BA 2J30A 3IUNA 3N3BC 2LCIA 1AG9A 2FLVA 1A69A 4Y6RA 4G97A 4KRYA 3ENNA 2WHPA 4JC0A 1AGNA 5HFJA 4FS8A 1MT3A 3DE3X 1XMPA 5JNLA 4I81A 3BMOA 5HGXA 1P7VA 1NR5A 4KWEA 1TC2A 4Q82A 2VWQA 3LXUX 5U4QA 3T3HA 4CL3A 1N6NA 4LE1A 4BGIA 2YWXA 4HMQA 1OX6A 3P2YA 2FPOA 3E6AA 4TLLB 4EPWA 1KWGA 1RM5A 3GA7A 3IOMA 2IBMA 3CMMA 3OLWA 2E4ZA 3V3TA 5LQMA 3KLMX 2EIHA 5J59A 1TJNA 2Z04A 3DT8A 4XD7D 5FBWB 4RE5A 3S55A 5HVZA 2XTMA 1FU4A 1QG2A 3HY6A 5ALJA 3C41J 3Q2OA 2QPOA 2NVUA 1SQ6A 3W5CA 4IJUA 2BCEA 4RMJA 4KQEA 2DWCA 3GJ8A 2IXFA 2VQSA 3OQOA 4EY4A 2ZK7A 3Q72A 4QARA 4NYJQ 3PHJA 2FLKA 1EXNA 5GONB 4YIHA 5FADA 5TVKA 2CVQA 4MMZB 1FK8A 2VBGA 3B70A 4N7RA 3C3EA 3QEOA 4N39A 3LNTA 3SM3A 1QQAA 3ROKA 2OV1A 2YXDA 1QX4A 4CIWA 4YUZA 2LIVA 2VA8A 4ZVSA 5SYNA 3WTBA 1SBYA 1RNLA 3OTQA 2OBBA 2QTVB 4MNTA 2DPHA 2W4IA 5CCXA 4JLMA 3SMQA 1YZFA 2X8JB 4U2EA 2R6JA 1LDEA 1TYZA 1UDRA 3DE2X 3FGPA 1Y5IA 4M3NA 3V8QA 1WSBA 4ZU6X 4JCCA 2WPDD 1WE2A 2HRDA 2FFRA 2M9MA 2F2TA 4MLPA 4PVDA 2C4TA 1JDTA 1SZDA 1TJPB 1Z08A 2HHCA 1TGYA 1SKUA 5CDGA 4WCFA 4Q4CA 1BDIA 1BSVA 5DSTA 1MVLA 1U9ZA 1CHNA 3JXEA 4NVRA 4YECA 5L3SB 1B41A 3KZOA 3OLQA 1EQAA 3LW7A 5EJ2A 4D9BA 4GAEA 2Z6QA 3DZBA 3FNGA 5D6NA 5BSGA 4TYWA 1UP6A 3RRSA 1A76A 1PSZA 3BE5A 1HQYE 4D4IA 4AJ2A 5LQNA 1FP7A 2FUKA 5TPWA 2RJ3A 4C7OA 2BDUA 1KZ7B 2JVJA 5K99A 1YJ5A 3IOEA 4KVGA 3DUFA 1G20E 2AVDA 4D56A 4KPUA 2CE7A 2YOFA 2W4MA 4UAUA 3U1BA 1JSZA 1RQ2A 5D7NA 4CMBA 3LKDA 4E5YA 2J3MA 1OXXK 3CRW1 3OWXA 2HK7A 3AO0B 3GJRA 1TRHA 4B3FX 1Q2XA 3RHFA 5BNTA 2NZWA 4W5TA 3COVA 3UN1A 3ZCPA 4Z7QB 3A4IA 5EP3A 2E5FA 1ESMA 1WDMA 5K45A 2Y71A 3TLCA 4WN9B 4A16A 1ZRMA 1OFGA 1NJ2A 4TS1A 3PSAA 1L4KA 3OPXA 4PLZA 3UT0A 3F9CA 3RAEC 4ZAFA 3I6QA 1F2UA 1HTTA 2BI7A 3OT4A 3V2IA 1NMSA 2W83A 1SH7A 3ORRA 4XGNA 2R7AA 4QLOA 1GXSA 4GQBA 2WTXA 4WI1A 3NYWA 2NU9B 1JWBB 1UBSB 5GJBA 3JALB 1Z6QA 2HMTA 3AR4A 1IOVA 3I45A 2VHCA 4IF4A 4IVNA 1XYYA 1Q0SA 1TUEA 1US8B 3F71A 1WA5A 3T9AA 5K3FA 4BV8A 8MHTA 1PDOA 3VSEA 2F1RA 3LX6A 4XCXA 3M6WA 4IDQA 5DBGA 1S4QA 1XRNA 4BTEA 1ZSVA 4FKBA 4AF7A 4ZIRA 4FMDF 4H08A 3VFDA 1WMEA 1UBCA 4B0OA 2B98A 2C4NA 1FVOA 1TOAA 5HR5A 3GGPA 3HYTA 2F1IA 4XB6B 2V6IA 3B3QA 5DBHX 2RI1A 3R6GA 4QICA 1T0HB 3I62A 1P9RA 2O52A 3H86A 4MKHA 1R2QA 2HNKA 1A3CA 1ISIA 1ICEA 2EG5A 1BXZA 4FFDA 4LK2A 1P7WA 3HK2A 1G5QA 3CWZA 3DMYA 5AQ1A 2A9KA 2JZCA 3GLTA 1GU0A 1I0IA 4FDUA 4C4AA 2CJPA 5E0OA 2JGDA 1MABA 2AJDA 4LUCA 3VOBA 1OX5A 4MHSA 2QZPA 2V9PA 4OJYA 2GH1A 2F43A 4RKEA 1KQFA 1O57A 2X0KA 4UNSA 3FJYA 3QKRA 5GWXA 3F6BX 5E6UB 1A5AB 3L06A 6Q21A 2NZUG 3I6MA 2P77A 1AOXA 4KXLA 4MIKA 2P4UA 1TAHA 3E35A 5C4IA 1ZAYA 4G2TA 5KCMA 2MSKA 4Z2AA 1U2DA 2UVQA 4DKXA 2ISSD 5BN1A 2IZ5A 1VJCA 1J23A 2JAUA 3LBFA 2P9FA 1M9NA 1LLCA 2O3RA 2RGBA 3EVDA 5AKZA 4D8VA 2HLDD 1N6HA 7MDHA 3Q9NA 2ZSEA 4IPTA 4MYUA 3MQ2A 1D6MA 4A1OA 4DJ5X 4GMKA 3V1LA 1X8JA 4WXYB 1NM5C 1USKA 4YRLA 4CN8A 5KNCH 2HDHA 1NMYA 2AQIA 3PLNA 4HR7A 3TIFA 3WJAA 2DB3A 3S4DA 2OCDA 3I61A 1BWPA 1G64A 2Y0EA 2OLEA 1T3ZA 2EQAA 3NIWA 4BO2A 3MMPA 3UFEA 4QHYA 4Y98A 2AS0A 3R3UA 3GFSA 2LW7A 1ODKA 1QO0A 2P5UA 2PD4A 2W2XA 3R6TA 3P0IA 2G1PA 4HDSA 4CLOA 1ZGCA 2JFOA 3G9XA 1JXQA 3HWWA 3WQSB 3EQ2A 1JR3E 3DEKA 3MWLA 5LMNB 3I9JA 1K1EA 1SCKA 2NT4A 2PQ2A 1N92A 1MB3A 4EVQA 2I87A 4TSFD 2QUBA 1T8RA 4RS4A 1E6EA 4GXNA 3SC3A 2OOSA 3VAYA 3ZD8A 1A5SB 4N5MA 3DZGA 5BQOA 3SXUA 2PX2A 1W36C 2H4ZA 2E48A 1UKCA 3CRZA 1DEXA 4X1IB 2C5BA 5J5AA 1IUOA 3KTDA 5IFLA 5EPEA 2PMKA 2I29A 2DZDA 3HDTA 1V26A 3FGOA 4K6KA 4DMMA 2Q07A 5A5DA 4Z4EA 3QUTA 3FMVA 2HF2A 1SCAA 3BK1A 1WS6A 4MDHA 3UJ6A 2REBA 3VJMA 5KSZA 1R66A 4FMCB 4BE7B 2QP9X 3ROZA 4FFVA 1IE3A 1PVVA 2ADOA 4BO0A 3B1FA 4P84A 4Y9DA 1ZL2A 4IHAA 2XD4A 4OHRA 1E9FA 1LPBB 2QUZA 4ZXFA 16PKA 4OO3A 4D3DA 1AGXA 3NKFA 5JARA 3EJWA 3R7NA 3N07A 1JHYA 5JNRA 2DKOA 1XMXA 3ZUGA 4F4FA 4LF5B 2XEXA 3G8BA 3EMDA 4MQFA 2FWIA 2OBXA 1SXJD 2WD8A 1OZHA 1TTTA 3SNHA 1XL1A 1I3CA 3IA2A 4G85A 5E2BA 4JZYA 4YWHA 4Y2UA 2H4WA 4ASUA 3NPMA 1RM0A 2V59A 1B1AA 4G3XA 3SIXA 3C45A 1SC3A 1UEIA 1EFLA 2QX8A 5FWXA 4ZI7B 4MQEB 1FQOA 2WSIA 2P2CA 2H5LA 2Y9MB 2CJWB 2YICA 1ZI8A 3AEQB 3KLNA 4HAWA 1HQKA 5TX7A 1NQWA 2Q0XA 1ZISA 4LRSB 3GLSA 1E3EA 1LK7A 5ESWA 1CDDA 5DX1A 1QHEA 2R7KA 4GR5A 5JYCA 4YAWA 3H16A 2QPLA 1UBMS 3BBPA 3HI4A 3HBMA 1OTXA 1PZNA 2NWQA 3F6PA 3UAXA 4ZEMA 1LNZA 1Z4IA 1Q19A 3L7DA 1DQYA 2HCBA 2GBCA 5EWJA 3JS5A 3F7MA 1R0WA 3X2EA 4PU0A 1HDZA 3O3OB 3ZLBA 3PR3A 1KEVA 3DZFA 3K70D 4P0QB 1JAZA 1MORA 2NXCA 2VJYA 3CUWA 1J4AA 1G8JA 2HFKA 1XLTA 2CNNA 1C30B 4O6VA 4WKPA 3ZWYA 1JG3A 1KC1A 2Q46A 3M5WA 3VMMA 3PL1A 1N9KA 4K9OA 4KYVA 3RRMA 3ER8A 2PKQP 2GGSA 3AI7A 2XWPA 1PP4A 1GAJA 5AKJA 2M6LA 3ETEA 2BF4A 1TZKA 4RCVA 1PNRA 3AHIA 3DBIA 3Q3HA 2E5LB 3B9BA 5J63A 4BFUA 4DUZB 1WPRA 3SDBA 4XUEA 4INAA 3S8MA 3WA7A 2OESA 2SKDA 3PC4A 3VYSB 4X71A 3RVNA 3HBNA 3GLUA 3ZK8A 3CCFA 4EHKA 2Q9CA 2GEVA 3PDHA 4B34A 3ET4A 2QVYX 3OPNA 3QLTA 1NVBA 5ALZA 2HBZA 3B60A 4RAOA 2J5QA 2CUZA 2HK8A 3P1JA 1ZD4A 3KALA 1B6GA 1I3LA 1XMVA 3IPAA 4JX8A 4RHUA 3SZOA 2C5HA 2IX3A 2DRNA 3WJ7A 5CH8A 5DYYA 1X9HA 4LZNA 2VZEA 1ULSA 3KAPA 3QVMA 4HP8A 3WIUA 2O8EB 1FLVA 1TPZA 1EVJA 1RLJA 2DTXA 3G88A 4GBMA 2Q8PA 5CM8B 3WMXA 5LU9A 1PV4A 3BERA 4WN9A 1O54A 1K0FA 4E14A 4WZAA 3SGLA 4CCYA 4EHAA 4RJTA 4YMHA 1ILEA 1M6VA 3EZGA 4MEJA 5KNDA 4YT4A 2PXAA 3Q8WA 1H4VB 1NJSA 2C8JA 2DJIA 2EBFX 3DNPA 3SYLA 2OBNA 3T5GA 1SIBE 2XH8A 3K0AB 3V4ZA 2C5AA 1R00A 1C0IA 3ONDA 3IQZA 3DFIA 3VI3B 4DDMA 3ZWDA 1N5OX 2PA0A 4KQHA 4R71A 1JR3D 2XUKA 5IJ0B 1CZHA 2BMDA 4LRUA 1R6DA 2YKGA 4MB0A 1L2TA 3MK31 1Q1BA 3VNQA 4QQFA 2BAGA 4BHTA 1TXGA 4E5MA 1OFIA 4I4LA 4EVIA 3LPLA 4HYTA 4TLAA 1N2CE 2DH6A 4Z1MD 1YWGO 3QIAA 4PRKA 5HF8A 5LB2A 2INGX 4N65A 4POOA 2JJ8A 2DU8A 1XG5A 1NLZA 2JFPA 3IMGA 2TMDA 3R6DA 5JAIA 1FJXA 2J0EA 3KVRA 3LQQA 3Q2IA 1DFHA 3DLCA 3F5SA 2OXEA 1OQAA 3BQ9A 3OAAA 3BA1A 2OO5A 3LM8A 4Q6BA 4WXPA 1Y5LA 3D6FA 4GXRA 3W2HA 4CQJA 4OF4A 2QROA 1A4UA 3GRFA 1FRZA 1CF9A 1ZQ9A 1DBWA 3PC2A 4RQAA 1D7OA 2AI2A 5KYUB 2PGJA 4QFBA 3HKBB 3U2QA 4W8GA 2JGJA 4MUMA 1GQRA 2WWFA 4XWTA 3CX3A 2R1ZA 5JASA 3EXFA 4RTPA 3GLVA 3VX3A 1J24A 3UBMA 4C01A 2JGDB 3H2SA 2ZXEA 4FDLA 5AM2A 2DETA 2OGTA 2R97A 1CF2O 4HMOA 1JQ5A 4ZTBA 3VKFA 1ZN2A 4JBYA 4MV7A 4D80A 2I3GA 2QD5A 2XGGA 4WKOA 4C0XA 1IIBA 3CNNA 3HJCA 4WK6A 4YRDA 4HH0A 2VTDA 3VH4A 3O73A 1I1OA 1P60A 3R74A 4E5NA 2ZJBA 3LOPA 1E7RA 4HWGA 2BHTA 2PQ0A 3JZMA 4PZYA 3GRCA 3UA4A 1ESNA 1NN3A 3IC5A 4DDWA 4BXOB 3VV3A 5DK4A 2H17A 4TUYB 3RJTA 4FZ3A 3WLSA 2WJYA 2H2DA 3TD9A 4CWAA 4NV1A 2ZYAA 5DM2A 3RUEA 1U94A 3ZU2A 1R8XA 1XA0A 1XFAA 3I6BA 2XMZA 4AN1A 2EWMA 4OA8A 3DAFA 4QU0A 4D41A 3OHPA 5EESA 2X58A 3TR5A 5DYGA 4QT4A 3VPBA 3ONEA 1T4CB 1DKPA 1D2CA 2B1JA 3DTVD 4PYNA 3ZZUA 4Q9JA 5MN4A 3OLVA 2ZWAA 2ZS7A 3NTXA 4DJJA 3IEIA 3AZPA 1XLUA 2C2HA 4GXTA 2DQKA 3I3SR 1RRKA 4B8ZA 1AQNA 4G5GA 2R96A 4L3WA 3T7KA 1C2YA 2XMPA 3CJRA 3U9SA 3MTGA 4E12A 4J0FA 1P2DA 2YJ3A 3A05A 3UHJA 3AUXA 3ILHA 2DTDA 5A1JA 2PFKA 4PAQA 5CURA 5IT5A 4HLUA 2PE5A 1CY7A 4W63A 4WPGA 1YT5A 5A7GA 4CQMD 2X7JA 1EG2A 1FDRA 3PZBA 3D8SA 3G85A 1EFDN 4TV8B 4ATNA 3M2TA 4BB5A 5AVRA 1ORHA 4J75A 1SU8A 4NE2A 2PZFA 5ES4B 3G2QA 1YMUA 1RC8A 4EG4A 2D59A 5CLGA 4UMDA 1YXMA 3IQWA 1Y6ZA 2F59A 3QJYA 4KNYA 3DR3A 2XJ9A 4NDAA 5AWFC 2ZWOA 5EE0A 5GJVC 2NG1A 4AZ0B 2H6EA 3RIYA 2M1ZA 4TQAA 1XP5A 2EEPA 2QTWB 2UYYA 4TRMA 1CY0A 3L7KA 1O5IA 2UYOA 4Q4HA 2IIPA 4DZTA 2J9FB 4N0MA 1M6WA 4B6FA 1WM1A 3O31A 1JLKA 1HE1C 1QORA 3DAGA 2ZPAA 5L7WA 1FMLA 3AF3A 2IE8A 2XZDA 3CURA 4WD3A 5EJMA 4BB0A 4U7HA 2XE4A 4KQXA 4TM7A 5LP6C 2ZTMA 1W0JD 3MJHA 1O5OA 3ZE1B 1PG0A 1CD5A 4QDTA 1EQ2A 2WZDA 3PIIA 4L07A 1OREA 5ENDA 3X2FA 2H2WA 2BR3A 3IQXA 3PR1A 1AKNA 1BHJA 4G4SP 1QRSA 1ZICA 1KYVA 1DQPA 1IZ7A 2YIMA 3E3AA 3ID6C 2VWGA 4XB1A 1NNEA 2P91A 3CUUA 3HTXA 2HJVA 3ZXUB 1XCPA 4BQFA 3MGGA 3O1JC 1W0KD 4OFWA 5EJGA 2YY6A 5C5IA 1L8QA 3QOYA 3STUA 1NXSA 1HFWA 2X2FA 3KL4A 4I36A 4YCDA 4IDGA 1E4YA 1Y6QA 4PVCA 2Q5QA 1L5YA 3SY8A 1U0HC 4Z54A 4TYYA 1ADBA 4MUNA 2H8GA 3FDZB 4YV0A 2GAOA 3T5MA 2A30A 3A9TA 4O2BA 1MJ5A 5LA6A 3UPDA 3PT5A 2BI4A 3LRXA 3ZWAA 3T7IA 4BU1A 3RRYA 3TM4A 2ACWA 2IHVA 4IDBA 2P9HA 3GV0A 1KOFA 3PUZA 4KLNA 4YJ3F 2G06A 5E9JA 3JZAA 5IBCA 2KJQA 4KPEC 1U0BB 2BGLA 2RH4A 4TRRA 1XVUA 3ZKWB 3RS9A 5HFAA 1G38A 2BM1A 5GZ6A 1JA9A 4ZYZA 4B4WA 1H3NA 1ULHA 2XT9A 2UYCA 3HKCB 4C2UA 2GAAA 1BN7A 1XZPA 1ZBQA 1QAQA 3EEOA 3CRQA 5DHFA 5FJIA 3IODA 3G79A 2YV2A 1RXSA 2FUG1 1EHYA 1V6AA 3GJYA 5CDHA 4LZWA 1X87A 5T4HA 3TSOA 4J2TA 1X7YA 2YWHA 1AVTA 5A9TA 3ANTA 1SQGA 4PR3A 2B4KA 3JQFC 4C07A 1BHSA 4BKPA 1HG0A 2JZNA 1DTWA 4IFIA 3WLKX 1X86B 2O7SA 4BFSA 5C80A 2Z30A 4ZANA 5FBVB 4AW9A 3RS2A 1BXKA 3UC5A 3WADA 4DYVA 2CLCX 2GS9A 2YRWA 3CPJB 1LB1B 1W1UA 1SZCA 1GKUB 4JLKA 2JFZA 1E1MA 2EZ9A 4UEOA 5EQJB 3D7RA 4C03A 2ES4A 5EOVA 4W82A 1GRQA 1KZ1A 4JOSA 3JD4A 1X70A 5HZMA 4EY8A 5EWLB 2NT3A 5JMOA 3NUGA 1TYAE 3PXGA 1NW5A 3HJHA 5LDHA 1SQSA 6REQB 4X44A 3RSSA 5L3QB 2N9UA 1FDTA 5DBFA 2WTNA 4J0JA 2VYQA 3ABQB 4PZPA 3DHWC 3VYRB 4DWWA 1VJGA 2B1IA 2CZQA 1VHDA 5GONF 2GZHA 4A5OA 1I3KA 4D44A 4S04A 3VZBA 1I32A 3GYBA 5EMLA 4O4IA 4MO9A 4LHVA 3C16C 1YNSA 4KLZA 4D79A 5HIJA 3PUWA 2YWDA 3FHCB 2R1TB 4QOGA 5LOVA 4GGPA 4N5IX 2IEIA 1VJTA 3AEYA 2XGSA 4P54A 1EXVA 3RUHA 5KWIA 3ZHOA 2C4VA 5DDIP 3T99A 1HZZC 2W8ZA 5CBPA 4O5AA 4HAXA 3AF1A 3P7MA 3QVOA 2QMUA 4YV2A 1VE3A 4L5BA 1DG1G 3LY8A 1UMKA 3NOXA 1NP3A 1QGAA 4TVSA 4D8UA 3CIFA 1IJEA 1SHJA 2CNWA 2WIKA 1NLUA 2L19A 3F90A 4BUZA 5BV0A 4GZLA 3RTBA 2PH1A 5ADHA 1H2HA 1ZS9A 4KE8A 3FPCA 3JQ9C 4NC9A 4WEOA 5AW1A 1PU2A 2JIMA 3ZHVA 4BGUA 5BNIA 4ZJUA 4LRYA 3IT1A 1RKBA 3OIGA 2WOOA 3OU6A 4ZHQB 3RC8A 3FKSD 3PHCA 5D00A 3MCUA 4X20A 2VBCA 1Z39A 1NP7A 3S28A 4N41A 4GEKA 5J3JA 3H1FA 4O25A 2NMVA 3SHVA 1ZGGA 1VE5A 1O8BA 2W6ID 3A37A 4E94A 3LYHA 2OK8A 4C3UA 1NBEA 1YA8A 4HXGA 1SXIA 1K0UA 1E4OA 2F9LA 3B1WA 1WZEA 3ETGA 4IVRA 4OXIA 4EHDA 5C7OO 2YUIA 1KJWA 3LI2A 4IL5A 3ZE8A 4R2KA 4NYIR 5K0NA 1JI0A 1L8XA 3BVPA 1I5OA 4OKIA 3FPAA 4LGVA 5JD6A 3WB2A 1WHSA 4BFTA 3SKVA 5IXJA 4TUYA 5G0UA 1S89A 1XYGA 2QEQA 2ZBRA 3D6VA 3HRHA 4ZPJA 2Y0CA 2YIDA 3WYCA 4TQUS 2AZMA 1B26A 1VHWA 3W1EA 3CCCA 1AKVA 2X6TA 4R3NA 1HUQA 2A5JA 1US8A 5C5DA 2YJ5A 3IV7A 1KJQA 5K3FB 4E22A 2BGUA 1JLSA 4YGYA 3WV5A 4ZODA 2FW7A 2R2GA 3SZGA 1KH1A 1YBHA 4UTRA 2EFHB 3UT5B 1NJ5A 3NEYA 3VMFA 3DGFC 3L6RA 1QM5A 3I0ZA 3N8DA 2DQ4A 2C1XA 2DHDA 4DMRA 3LZDA 1DMRA 4A8JC 4EW2A 3KUXA 4HQOA 3IVGA 5KI6A 1X77A 1F0YA 4P1ZA 4YMIA 1YZHA 3WGTA 5K05A 4H3SA 3EXG2 2YJ4A 2ZR0A 3GXOA 1NY5A 1XCMA 2IYYA 2O2JA 3FDFA 3RK1A 3P0HA 4OP2A 3Q7PA 3E7XA 2CD9A 2OCYC 4DA0A 4HSEA 1ZZEA 1JWAB 4ZC8A 2VPIA 2W98A 1UZAA 5TVGA 5IZCC 3QI2A 4J29A 4EFMA 1DMSA 3IBCA 1SCDA 2WY2D 4YWJA 1PFVA 2VHVA 1W5SA 4ZAVA 1VIMA 1PYGA 3R7FA 4BMCA 3ZGLA 2WSSA 1XEWY 3WJ2A 3L8EA 2C7RA 3UVEA 4ND4A 4C7BA 3CBGA 2WYUA 1X92A 3QE3A 4C7MA 2H29A 1IDOA 2CLSA 2G67A 2I8LA 3DWFA 4UZFA 4LJAA 3RTCA 3VYUB 4RVNA 5FOSA 2JDID 4P9NA 4DNXA 1G42A 3DDWA 5J2TF 5JJKA 3EARA 4HT3B 1ISPA 4KODA 1XEXA 2IF2A 2RB4A 4KGXA 3K9NA 4UBIA 2ASVA 1GSHA 5CA1A 2QSJA 1K9VF 1GEGA 2YMMA 4MI6A 3KEFA 3MPOA 1ESCA 1V16A 3A28A 4CEHA 2ZQYA 4IY1A 3PC8C 2EHDA 1LLUA 2NXWA 1Y9JA 2VNKA 3ORYA 4OMUA 3VU8A 1QRAA 2ZE7A 1E1QD 2R8PA 3CMCO 1OKKA 3IPCA 2GF9A 4OIMA 4PYOA 3VO8A 2NIPA 4YJKA 4ARZB 1XNGA 5EL0A 1S0UA 1DT3A 4OQ4A 4JP3A 3K2EA 1BMTA 2CL7X 1MJGM 4RTLA 3EG9A 3QU9A 5COAA 5ALKA 1GLVA 1E2MA 3TJRA 3LUPA 1MAHA 3K0EA 1CUXA 3ZKAA 1WB4A 1CERA 2XWSA 3QOFA 2AFIB 4ES6A 5DXJA 1HFEL 5LQCA 3H0EA 2OHHA 5C3MA 1Y82A 2H2HA 3H11B 3N0RA 1LBHA 1QIIA 2GCEA 3V1TC 1QR2A 3TRHA 4F4DA 1I7DA 4RV5A 1BFKA 1FU7A 2KS6A 3K0CC 1M1YA 1XE3A 3WMRA 3LTEA 1QCCA 4BQQA 5JAOA 3R3XA 4MS1B 2AKYA 1JFFB 5K6RA 4CQNA 1E2KA 1PHRA 1GGMA 3IELA 3K1JA 3V8MA 4F9FA 1SQFA 1XZEA 2YS7A 3ND8A 3F6EX 2WFAA 5IT9A 2BFBB 4ZCPA 4JB8A 4BATA 1YAHA 4YXFA 3PI6A 3R40A 1SHLA 2GRUA 2BONA 1T2CA 2QW0X 4LX8A 4MKXA 2UVDA 3WLPA 5C31A 4P7GA 3WAJA 4OJKA 1M74A 1JNXX 2V7PA 4IZIA 4WOKA 5FUWA 1H2ZA 1T3TA 4F3NA 1PFGA 2NM0A 821PA 2CV2A 1VLHA 3WNBA 2R1VA 4FFBA 4A0QA 1UIRA 1CCWA 3L93A 1GSOA 1UK9A 1KJ9A 2PSEA 4RVDA 1RJ9B 3QV2A 2J07A 3L5OA 3PIRA 4U2GA 5BWLA 3FOCA 1ZSYA 1HK7A 1RCTE 3UMBA 4D9IA 3FHTA 1TCUA 5AW7A 3K3PA 4RNCA 3KK0A 2ZT5A 4UREA 4OUKX 1SB9A 1ST2A 1Y4DE 1A98A 3W5VA 3K72B 3MGCA 1L7AA 2RHBA 3HUEA 7YASA 1P72A 3EEIA 3UA3A 1IOZA 1POXA 1P4SA 5FWXB 3RT7A 4LZZA 3UNXA 1OBFO 4ZI5A 5I01A 1P91A 1U6JA 2K6GA 4XLLA 1P0QA 5JJLA 3F6CA 3PR2B 4JVNA 3LVBA 1KGSA 2V7XA 2H4XA 2GXSA 3TYXA 1E6LA 2V55B 1QKIA 2YS6A 3A1EA 3ZZTA 1GTRA 4DR7B 4O4LB 1X1SA 3EBPA 1SD1A 1GT91 1YCDA 3RNLA 2P7HA 3K09C 4KQ6A 4LYEA 4DL9A 4X63A 3LXXA 2BGKA 4LECA 1AQYA 1C1DB 5EIFA 3C5HA 3NDRA 2XGOA 3FZQA 5KS2A 2ZIXB 5KVSA 4Q1CA 4L78A 3GRPA 3HCPA 1W0KA 4EB3A 3QXHA 4LQ4A 1QANA 1UOQA 1JBEA 2IKSA 3MCAA 4E4TA 5C1PA 3S1SA 3EH1A 1PJQA 3ZWPA 3FPKA 2UKDA 3QENA 4RIQA 1FRVA 1RRCA 2QJOA 1CNMA 3G1WA 4DSAA 1EK6A 4E5VA 4DV2B 1JHVA 1XVLA 1KQ3A 4KMOA 2DAPA 3W8RA 1GU7A 4GMHA 4N12A 2FX3A 5BPFA 1ONOA 3CEJA 1C81A 3QEAZ 1J8YF 2J67A 3PQ2A 5K9ZA 1E0SA 1VYHA 3RRZA 5JZ9A 4M8SA 1DRWA 5MHTA 3ZI7A 1ECLA 2BBSA 1E2NA 4JK3A 2Q1XA 2C20A 3GWGA 2QR3A 2BGWA 3HP7A 4IMPA 4IBOA 1IN6A 5CM9C 4ND6A 1T4MA 5HF5A 3WB1A 3WNCA 4LBYA 1OI7A 3LDUA 2JIRA 2HA5A 4PS0A 4Q9NA 5U9CA 2GKSA 4JEMA 1FU8A 5B30A 3HXOA 4NS1A 3VBCA 2FSIA 4O2LA 3V33A 5CLIA 4UXIA 3TLMA 4LSWA 3VOAA 3EOBI 4AWAA 2YWFA 4WA8A 4QPCA 3L0YA 4IMIB 4P3OA 2MYNA 3OM9A 4PPFA 5BUZA 2Z6UA 1EGMB 1NW3A 1TIBA 3AERA 4ALMA 4H4DA 3V8VA 2ERYA 1MA3A 5B57C 2KYGA 1EH5A 3CUYA 1UEXC 4IJQA 1ENZA 2E1PA 4XDGA 1HDCA 3W04A 3X1ZA 4ESHA 2BFWA 2E55A 2O14A 1BKYA 1ZK0A 2QV7A 2WINI 3OQJA 2X9VA 5COBA 3K0AA 2G9NA 1A9XA 4XM2A 2ENWA 2A0UA 2QVGA 3QRWA 4WXEA 1XTZA 1R6XA 3E22B 3OJOA 5CLQA 1WCXA 1X1BA 1X1RA 2J3QA 1X3LA 2AR7A 1P2BA 2DQZA 1ZFNA 1JV2B 3GZ4A 4MUYA 2O07A 2Y1CA 1R4MA 3FCYA 2G1JA 2BFPA 3EXIA 4JJEA 5EG5A 1OYOA 2QZ4A 2YDYA 3GDFA 4HBGA 3SCZA 3G0CA 4GMGA 1AKEA 5B55A 2XZLA 2H18A 2RHGB 3OI7A 3AJDA 5G0SA 2QGZA 1HEYA 3G2HA 1JU4A 2HBQA 2IS2A 2LV8A 1DELA 2WQZA 1UCFA 3IUMA 4RGVA 4C1NA 3M5DA 2JFYA 3PUXA 3PQ6A 3W34A 3LRPA 4N5NA 5KNCD 2OKCA 4MICA 1R0XA 1P19A 2W2MA 5DNDA 3SQOA 3AY7A 4CU2A 1NUHA 2L42A 3A3OA 4YJ2A 2XMCA 3BORA 4TV9B 4UNQA 5HUJA 2CJYA 5C8VA 4EF5A 4B82A 4DR4B 2QT0A 4E5SA 1H93A 1X9GA 4P4NA 3QBEA 4CT4B 3LWDA 3OM0A 4RABA 3WGMA 1RXIA 3R1IA 2J3IA 1FDOA 1V96A 4YMVA 3U5ZB 3I1JA 1MH1A 3FMGA 1UZUA 3HADA 3TZCA 4E31A 2I7CA 4EL0A 4TV8F 1T9DA 1IBKB 4B3MB 1IB6A 2BTQA 2D2EA 2XOKD 1JJAA 2AK3A 2CBZA 3CIOA 3KUUA 4I5EA 4K3VA 4R1QA 4MKFA 5ALLA 1M2NA 3S8EA 2DHQA 4N49A 4MXDA 1TUIA 1Z4KA 4WBNB 1PJZA 3HSKA 2PT7A 3LP5A 5IXSA 1KK1A 3Q11A 1FMTA 3PUHA 5CFZA 1SY7A 4FOTA 4JLJA 4F96A 5LQKA 4URWR 1ZW1A 3T41A 1XGKA 4MJLA 3T7EA 3EFEA 3GF4A 1LTQA 1B0UA 1MGPA 4J1TA 4JCOA 3VH3A 4HNQA 3G2OA 5EP2A 2HMYB 4JVLA 5ICCA 1TU4A 1X7ZB 1EJ2A 1Z07A 2XNKA 13PKA 3BIJA 4Y1RB 2G1AA 3VH1A 3BSSA 2XLBA 4M99A 1QRRA 5ALGA 3ZQKA 2ESRA 2GBGA 3C5VA 3BKXA 4FFWA 4X6LA 3FKJA 5AHWA 3GW8A 4EKGA 4X8HA 3E0QA 4H3KB 2PMCA 1QMGA 1XZQA 1UKEA 4TYPA 3UJHA 4BV3A 3I5XA 2MMGA 1LJ8A 1FS6A 2YH2A 3AR8A 4QDKA 5SZIA 2VSNA 5F7OA 5K09A 2AMJA 4L75A 5GM2A 3OQMA 2VF7A 4PG4A 5T57A 3TQHA 1XPUA 5LCXA 4IIJF 1KI3A 6YASA 1LXCA 1VYUA 5LJLA 2CSUA 2IYLD 2OCKA 4FFOA 2BFFB 1OH6A 4YMLA 3M81A 3NYIA 3D2CA 5I7SA 5FH9A 4DC0A 2QD3A 4YUAA 4B3TB 1FE8A 4BBZA 4CTJA 3WAGA 1PGJA 1L7QA 1IXKA 4HVCA 3WWPA 4QPDA 3RS4A 5JZVA 3LL7A 2CC2A 1KORA 2X2OA 3DT9A 3H5AA 3MUEA 3FF1A 1COWA 5FEUA 4UQPA 1VB5A 2HD4A 3P0RA 4X8LA 5EJFA 4YP1A 5FL7A 4BECA 2WHQA 1VBKA 5J5VA 1YD7A 2J9ZB 3HJGA 3MD0A 4FFRA 4ID9A 1M6YA 3E9YA 4EG8A 1VHJA 3HRIA 3KBBA 4MA5A 3A1TA 2XWJI 3DULA 1ORRA 2W8BB 3AF5A 3ROGA 4PX9A 4ZVOA 4ZEXA 4J3JA 2Q4RA 1Y5NA 1N8SA 1E58A 1NQXA 2VNAA 3NAQA 4OFZA 2IYQA 4HMPA 1KAMA 2AC2A 3UWOA 5HXAA 1PTJC 1V43A 2JIBA 5F1OA 2HEGA 1AKMA 3A31A 4M0PA 2JFUA 3SJBA 2WP0A 2F8MA 3TDMA 4GEGA 2H2IA 4HVAA 1AXGA 4MUIA 2P6MA 3Q3EA 1NN1A 2PS0A 3WO0A 1QGOA 4II3A 3ICPA 3HBJA 4LWOA 3K9LA 4JT9A 4OOFA 1TAGA 5DOVA 3H9EO 5KYYA 3OQIA 3QTLA 4B6JA 5DFAA 4M1YA 1D2EA 2AMVA 2Q4BA 1QGDA 6GPBA 5L7TA 4Y2RA 5IF9A 1S8FA 5F78A 3T38A 4TYNA 4MUBA 5EINA 3EBOA 2CLOB 3GJ7A 1VDMA 2C2GA 3SS7X 5IJZA 1MX1A 4X60A 2B3TA 3U4IA 4P3PA 4ERXA 4XQCA 1JYFA 3HSYA 1Y4AE 4BWFB 2IUTA 2ONKA 3TEJA 5FLYA 2KB0A 2RGNC 2Y4NA 1VSUA 3B1XA 4K8OA 5DTRA 2B7LA 1QHHB 3QNWA 4ZO4A 4G5SA 4N0QA 3KBOA 1U3TA 2QDKA 5BSUA 3L40A 2IEDA 1DAFA 1YKGA 4HQ0A 3WK7A 1MB0A 2YW9A 5EIHA 5DBIA 2ZIUB 4ZRNA 1V5FA 3RANA 4E30A 4YH1A 2C2MA 3UWMA 4IUDS 4NBRA 4Z0NA 2ZIAA 2BGMA 5BYBA 3H8WA 1G2QA 3UEOA 1AKRA 5LUAA 1G6Q1 3SX4A 1A8PA 3K9FC 3TD2A 2O8CB 3V80A 4QE3A 4G1VA 4S35A 4GUAA 5JCOA 1IZ0A 2ZI7A 4TL9A 1O87A 4MR7A 5CM2Z 2V7TA 4LOAA 2BGIA 4KJXA 1KTIA 2KLHA 3MCVA 2JFVA 4JELA 3RVKA 4LXTA 3N7UA 3OMXA 3THYA 5CXQA 1E3WB 1WUTA 5CA0B 4R9VA 3NDJA 1KO5A 3UJAA 4IXNA 3KVVA 5KNCA 1GR0A 1QGUB 3A9WA 3IIJA 3M1LA 4MLZA 4JXJA 2QZ9A 5CT5A 3LWBA 4BDTA 5JNUA 4MO2A 3I5MA 4FLEA 1PWEA 4E1VA 3ZDQA 1UM9B 3DEFA 1ONNA 3QKIA 5K51A 1X2BA 1RIIA 1DEHA 1LU9A 3JTEA 1U28A 2FMKA 4P2BA 1QRUA 1N9GA 1DCKA 5L3QA 3ILYA 2H92A 3NPAA 4TKUB 1PFKA 4BY9E 5B4VA 2O4UX 5KAMA 1UOOA 1VTKA 4EKIA 5BRAA 1D6NA 1KVRA 3EEQA 3FUXA 2ZUWA 1C4OA 1CP3A 2ZU6A 5K3DA 1F6WA 3I1FA 3KOYA 3I8OA 1FLAA 3LUKA 1UWCA 2DH5A 2Q5HA 5EZYB 1FTWA 4H18A 4UEJA 1W96A 3FLMA 5HCUA 1OBVA 4YN3A 1PS0A 3PX2A 4HJRA 2QM7A 5FTKA 3TPZA 2OCGA 2IZOA 4XI9A 3KQKA 3EQ7A 4F93B 1T9HA 3N8IA 3PXXA 5D51S 2PBLA 1E3QA 7ABPA 1SULA 4MQBA 4F85A 1PG2A 3KSBC 1FYDA 4RHYA 4QPJC 3M9LA 5TF4A 1E2LA 2NU8B 2TMGA 4BNYA 1L9XA 2YJZA 3LLUA 2I6QA 3ECCA 4Q19A 4QUJA 1NPDA 3Q6IA 4YJ2B 1GTVA 2HO5A 1BS2A 3L02A 1RZRD 3C8UA 1X0XA 4CR6A 2XKKA 5MF6A 3BB3A 3TB4A 1BEUB 2H00A 1T6BY 2CHFA 1XDDA 2WAMA 5K20A 3DV2A 1QMPA 4F9EA 2EQ5A 2JEOA 1O96A 1KVTA 2ZW9A 1IATA 4FCTA 1ZOIA 2FRDA 4RKQA 4C05A 2WT9A 1L7RA 3MQ4A 1PS9A 3BZBA 1RMYA 4E13A 2PLAA 2QTHA 1LPNA 3QXGA 3TQIA 3SJCA 5TMPA 4EHJA 4WFIA 1NOJA 5D85A 3WWDA 3RV4A 1ZNQO 3VZQA 3V7UA 1EAYA 3ZOZA 1QTRA 2FB9A 1OU4A 3QFSA 4QODA 4Z9AA 3S5UA 2C9DA 1K3TA 2GZ1A 2PLRA 1TIKA 2Q3JA 1M0TA 2WB4A 2YYAA 3AR3A 3PICA 4OIFA 2QG9A 4FDTA 4KLAA 2ZUFA 2GHRA 1KDOA 1TF7A 1VPDA 2GN4A 4OGLA 1Z06A 3FOZA 2C2KA 2YJGA 1I80A 1A4RA 2BFEB 2PKRA 2WJZB 4HLNA 4WLFA 3RWBA 5BV8A 3W5IA 5IT4A 1MT0A 1YRHA 2OAGA 4PF1A 1K6JA 1JYSA 2HQSA 4J3NA 1HQDA 1N2SA 4W5HA 3IUEA 5IJ9B 1Q6ZA 1PR0A 1JLLB 2HX1A 4AUMA 3QEJA 3VH2A 3U0BA 3V1MA 4YI5A 5IKMA 1QO9A 2YQ4A 3BBLA 4GPEA 3A2LA 1B6SA 5FTWA 3V34A 2XCRB 1SFRA 4PZ9A 5CJJA 5SZHB 2ZANA 3UENA 1TEXA 1IG3A 2CEAA 5KSWB 3AIKA 3RS5A 2Z2KA 2RIPA 3QWIA 2JHAA 4W4TA 1F8UA 3GCXA 5IX8A 2C7QA 2RIRA 1EK1A 3T06B 5L45A 2AG6A 2OZLA 3UQYS 4W5JA 4LJ5A 1W4LA 5EE1A 3UJ3X 1JQKA 4DMKA 3NTQA 4MUKA 5AJHA 3NVAA 5EN4A 1IN7A 3EEBA 5TJHA 2PKYX 3GEIA 2C8KA 1XQWA 3EN0A 1UPXA 3CLSC 5ALPA 1WMAA 1EBUA 2ZAMA 5B36A 4GWGA 5DHTA 5DI3B 2IWRA 2LDXA 3A7DA 3UYKA 5TSDA 2DCUA 3FBGA 4OQEA 1H6DA 4DLTA 1AV6A 5ALSA 4QJ3A 1FMFA 2QMHA 5BMOA 2JAHA 3CZPA 1TQ8A 3A6GA 1XTBA 4L15A 1JS1X 3O75A 4UFPA 3BJRA 3QXXA 1C14A 2PM8A 1V2HE 3LMKA 5AKLA 2FN7A 2J08A 3AFGA 1KEEB 4FFNA 5DLQC 1DKQA 1V71A 3LL4A 4FYPA 4RACA 3OKFA 1APBA 2XTJA 1H0KA 1CNEA 1RHRA 2SCUB 3RAPR 5FPPA 4URVR 1Y1PA 5F2NA 4R1UA 2DMRA 3OE7A 4RAQA 2XB8A 4RVOA 3B52X 3JARA 3QUCA 1E1YA 4EENA 3EY9A 1V95A 4M1TA 3ZZNA 4C6TA 1KJIA 3EG9B 1N1DA 3I12A 3C2QA 4GI5A 3T34A 2DPXA 3FNRA 3PWZA 1IK6A 4M8IA 3PFGA 2RGWA 2NVBA 2WP8J 4L0MA 4QJ5A 3INRA 5FI3A 4GSKA 1EM8B 2AXPA 5JMWA 2KPOA 4FYHA 1SOUA 1YE3A 3W7AA 3NYQA 2VPQA 4BNJA 4MVWA 3G5TA 4JL5A 5D01A 1Q0RA 4DQUA 2JA2A 5A4JA 4KUGA 2JFXA 2QTZA 2F00A 2PLNA 4OG2A 1YC2A 4OKNA 2B5VA 3CSSA 5EKSA 1E0KA 2IY9A 3O8RA 3ZDAA 3HMKA 1OFUX 2PL5A 4NOMA 2X0IA 4BMOB 2XZOA 4CKWA 4R6WA 3HL0A 4DLBA 1PGOA 1GG5A 1C7EA 4GI7A 4REQA 4UDYX 1FUEA 2GFQA 2WF8A 3SFTA 4MRPA 1JP7A 2ZIGA 1RYNA 4ZWNA 3EQZA 2HSDA 2K7ZA 3M89A 4JUBA 1JE0A 4R51A 3R0XA 4ZKEA 1EI9A 4C21A 2NTVA 2WYWA 1W29A 2EJCA 3PFFA 4OXKA 4P7FA 4RSMA 4ZCQA 3G2KA 1O95A 4FFBB 1AO0A 1KYZA 2WAOA 2FMXA 3B6IA 1WSDA 5E3JA 4WZBE 2QN3A 5IHPA 4GR9A 5LMCA 5A4FS 5A3VA 1RE0A 2VAWA 2VLBA 3W77A 1A04A 3AUYA 4R9RA 3R7BA 3T3DA 2ZJFA 3HGTA 1UPFA 2YN4A 4LXIA 3ZY5A 5KNDD 2IHNA 2O59A 2WKWA 5HM8A 3RF7A 2QS9A 5E4TA 1LS1A 4K26A 3W3AH 3TE6A 1NVUQ 3V32A 2NNWB 3IEVA 1WCV1 1EE2A 3CSDA 4H6VA 1CUFA 4M1ZA 1PQPA 3RABA 4LZPA 4C20A 4MTCA 3H97A 1P1RA 3QW4B 3NHJA 3GT0A 3OF5A 4V0LA 1CQJB 2DTEA 5BW8A 3T1TA 2RHTA 2OQ2A 2V8BA 4QTXA 4HNTA 2ECOA 4TMXA 4FNOA 3QY0A 2XCOA 1RHQA 1WZ2A 4UTOA 3HP4A 5K3EA 3LVQE 2I22A 4WK0B 2JH9A 3PHIA 2VYNA 1KJNA 5BR4A 5K8VA 2M6RA 2PMDA 2VDQB 2F3UA 4BQEA 1EDEA 1O89A 2V6MA 1W5BA 4ENVA 4HZGA 1F06A 1JR4A 1L5LA 4U63A 1A9YA 1A7JA 1QFXA 3VPFA 3IGFA 1T8WA 1YNOA 2HK6A 2F1HA 3GWHA 4KACA 4WK2B 1QV9A 4C5BA 3I9FA 4DCGA 1XCBA 2NQTA 1W44A 2IHBA 1NZJA 1OLXB 2NXEA 5AVSA 3WL8A 4AUNA 3CEAA 2V4UA 4K05A 1UR5A 2XI4A 1T1JA 4KSYA 4AMUA 1GQYA 1ETUA 1YZUA 4H59A 2HT6A 1BDJA 3CF4G 3KR9A 4XWYA 4B7AA 5AI5A 3NNDA 1JQEA 5EHQA 1OILA 4LC9A 1U11A 3L8HA 1F1BA 1KFJB 2AFHB 1XN4A 5IW8A 1KA9H 2J09A 4M88A 1GNQA 2W2KA 1H22A 4D8TA 1S01A 3QA9A 5ADWA 3FX2A 1QJCA 1UJBA 3QPVA 1O96B 5I8ZA 5AKIA 10MHA 2BE9A 1ORDA 1IRXA 1NMEA 4U7TB 1A9OA 5HIKA 1M33A 3QTTA 1N2JA 1U04A 1TM4E 4G36A 3SYNA 3U48A 1GYQA 3VR4H 5ECDA 2Z4SA 4NBLA 5ALYA 3ZBTA 4BBAA 2BP7A 4E2WA 1LEHA 1DG9A 1JLHA 2Z4RA 1TMYA 4FT2A 4WLEA 4RC9A 4WLOA 5CFQA 1R50A 3HDJA 1HLPA 2J9XB 2VTBA 2GI4A 4F3CA 1FIUA 5DVZA 4BVHA 2IITA 3GLRA 5EKUA 3UJDA 4J4TA 3BFVA 4FK8A 1Z0IA 2VTEA 3GVPA 1QQBA 3QWAA 2JI7A 3A3NA 2QTGA 2D74A 2Z6VA 1KERA 1W9HA 3QU2A 4JBWA 2YRXA 3PPIA 4UBLA 3HCDA 1FPMA 1QH8B 3WXMA 3KZKA 2E5WA 3HJNA 1ZD5A 5TJ9A 1C3EA 1R4MB 3VR4A 4Y7DA 3TNLA 4CODB 3DE7X 3RNOA 2YNMD 4L2IB 2Q1TA 3BEOA 1H2BA 3MM4A 4JLPA 1KZHA 1PWHA 1QHSA 2JCYA 2PGAA 3CW2A 3JQGB 3R5TA 4KBFA 5KNBA 4YYEA 3V1UA 4Q21A 4DBVO 5GVSA 3A3YA 1DEAA 2GF0A 3CKLA 3KG2A 1PZXA 1T35A 4G01B 4U0JA 2QNRA 5BYJA 3CVJA 3H9JA 4KZPA 4Q7JB 1EGQA 2JK1A 2QRGA 4RFVA 3ZK7A 1GTZA 1OXBB 1QC5A 1EFTA 4P86A 1V1RA 4KIFA 4XTCS 3W9UA 3ZNPA 1EPUA 3P97A 2QLMA 1DFIA 1P5ZB 2CD7A 2ZRNA 3CKYA 1Y3DE 3C3JA 4RENA 5FBHA 4JQSA 3ZHTA 3RUPA 3ZGYA 4N47A 1ECFA 4M0CA 4OQPA 1A2BA 5EYPB 1TLTA 1E5QA 2Y99A 2ZRIA 4EJSA 4MW0A 2FR8C 4NECA 1EMDA 1ZKDA 4B2LA 3JASA 4P4LA 5AVUA 1YFKA 1FFAA 5DT9A 2WPDA 2JB9A 2P90A 1DX9A 2FDXA 4JT8A 5DYIA 2P41A 4HAIA 4FC7A 4FWBA 3TAXA 4DIFA 4URXR 1UWKA 1WKVA 3I9MA 1HSZA 2ZYTX 2Y1GA 4UVHA 4BZQA 2WT4A 3FB1A 3RT9A 2IGTA 3KKQA 4RGYA 4KFUA 4L7VA 4C5CA 3DBRB 5ARCA 2IYNA 3UJCA 3PUKA 2QD4A 2YYSA 3DP9A 3D4IA 4D3YA 2F43B 2IA5A 3EHDA 1RHKA 1LVHA 1JG4A 3MCWA 1I6MA 2ZEJA 1O6FA 4IIBA 1XDBA 2NV2B 2SKEA 1CY6A 2GM4A 3RPEA 2O5VA 5EUCA 4WNCA 1BAPA 1XTTA 5AJVB 4YCNA 4JQCA 1SKQA 3F6SA 3GPIA 3QFRA 2OM6A 4JASB 2OBFA 4NCHA 4XE5A 4IHJB 3T15A 3PWKA 4KO8A 3P9NA 4NLLA 1J0BA 3HJTA 1N8KA 4NWIA 3NHAA 3DVSX 1X1CA 4PAGA 5CCEA 3OOSA 1QH1B 4PSUA 4Q66C 1AQIA 1D7AA 3E18A 3I3OA 3LK7A 2JNWA 4K9QA 2X2PA 1Y9EA 2HHHB 4FCWA 1C9EA 1P61B 1ZWKA 3B9RA 1V6SA 1G20A 2MR5A 1Y7TA 5BVHA 3I6YA 2JLZA 2IY7A 3W8NA 4TL6A 4XCVA 2GAIA 4NJMB 3DZIA 2YL2A 1BNCA 4IWXA 5KMGB 4KAJA 3GPBA 1C8KA 3OUTA 3A36A 3FPGA 5G4KB 5LLTA 2VQEB 4P33A 1EVLA 1DOHA 5FWYA 3W5JA 3PJFA 2WA2A 2VATA 3JVUA 1E20A 4JITA 2AJLI 4P35A 1R6TA 4Q3BA 4OXRA 4WAUA 2P1DA 4FBGA 5AIAA 3X2SA 1M5UA 2FN4A 1JHXA 3CVYA 4X91A 1Q0TA 2YJNA 2BBOA 5KTSA 4JUFA 4XPIA 4DR3B 4KSCA 1MG0A 4GI3A 4LXHA 4EPXA 4UTNA 5I5EA 2O8DB 1N75A 3TZQA 2PBZA 4YVFA 3TRFA 4D8XA 2QUHA 2QW8A 4J8PA 1M2JA 1P0MA 2J85A 2HJHA 2OE2A 3HZHA 5DXAA 3WDMA 2ZSUA 4EY3A 1I2BA 4YMTA 3R5HA 4LBWA 4EUNA 3HBLA 5LYJB 2XYPA 3LLMA 3R3HA 3TXYA 3BXHA 3T1YB 4QUAA 4G0QA 4ZYVA 3T7TA 4DQDA 4M0MA 2BWJA 3DKIA 2VDWB 4CUKA 1X7DA 3VHLB 2YW2A 1WABA 4HQKA 1UWLA 2ZUSA 1NAHA 5F21A 1QP4A 2Y1OA 1ZJ4A 3GDOA 1YDEA 4ZRDA 3WMGA 3HN6A 4B1FA 4H60A 3V4PB 1GPNA 2JLYA 2W0MA 1J9EA 2O0MA 4P4SB 3OCXA 3GDGA 3IJRA 1N78A 3OVMA 1F2TA 3LXRA 4EUHA 4LSGA 3ZG6A 3LU1A 5BN5A 4MQFB 3OQIB 5BSRA 1SXQA 5JTUA 2DGDA 1PDVA 3ZS8A 4OMFG 3ZJYA 1JR2A 1R0RE 2AE1A 1WMBA 2XUFA 4RZQA 3JWGA 1SAYA 5BQFA 3IP3A 4TROA 3F3YA 1FRQA 4OLFA 2BSAA 4YPOA 4RTOA 3MW8A 5KJFA 2W2LD 4TX1A 4UHKA 1VKZA 1XXHB 1WTAA 4WGFA 3KO8A 1ONPA 2CLFB 2ZWMA 3PFBA 1KY3A 4DLAA 2P9TA 3N0XA 2J1LA 1SHKA 2JRCA 4PWZA 4F9KA 2CFOA 2VT7A 2P5TB 3DV0A 3JD2A 2EJWA 4JNKA 4YMGA 2YN2A 3LC2O 2NO6A 3FPEA 4O1MA 3WWCA 3GP5A 3MWEA 4O59O 4IICA 4FGSA 2P2DA 4PN7A 1YBAA 3AJ8A 3IH5A 3C4VA 4BNFA 1CRPA 2VCHA 1RYBA 5J4YA 3ORHA 1E2BA 3DOOA 4BAZA 2PX0A 4EFKA 1L7PA 2O6HA 5H3CA 4S12A 3J7AC 5HKAA 3OQNA 1PL8A 2W2KB 2W22A 2GN9A 3SX0A 1GPWB 3EFBA 3FNBA 4MW2A 4OQQA 1QX3A 3CF6R 4UPDA 5I48A 4PSAA 2D1FA 3I0NA 4D3FA 4H17A 4JBIA 4U2KA 3GZNA 4BUCA 4F56A 3G1TA 3TJMA 3THYB 2RH5A 2YWBA 4NBKA 5NULA 3CCBA 1AS0A 1L5QA 4LJLA 3UB2A 1U0LA 1ZJ6A 3G9TA 5I7OA 4P3YA 3AFNA 5CU7A 2VEOA 2ZPUA 3O3CA 3QLUA 4FQ5A 3NATA 3CONA 2H7YA 4JYAB 1EHIA 2E4WA 2B8JA 4WHMA 4ZYWA 1Q11A 4KCGA 1N0VC 1VCMA 4EYQA 3WBJA 2DCMA 4BMNA 3T1OA 2PVCA 2GD2A 3UAZA 5KNDH 2B4YA 3KJZA 4Z0TA 3JVVA 2CL5A 4ICIA 3A6EA 2O2EA 2OP1A 1EK2A 1VG9B 3NHMA 4FDVA 1QH8A 1W2WB 2X7HA 1RHMA 3HVUA 4MPDA 4YQZA 4X7MA 4QOHA 1BVRA 1U65A 2H2FA 2JLQA 2CDAA 2O1SA 4TKVB 3I9LA 1GFSA 5SZJA 2Q41A 3QDEA 5H81A 5BSTA 3WWEA 4WZAB 4QKQA 1Z0JA 3BXGA 4EL5A 2O0JA 5JWOA 1M6VB 4I8IA 1SPXA 3F7OA 1WXFA 3FUCA 4J7XA 2O7QA 4BGVA 3SVTA 4BEJA 4AJHA 1ELOA 4XH9B 2ZJYA 1XHEA 4G09A 3JQGA 4MAMA 1XKLA 4PXSA 3K0FA 1S3IA 3FFTA 4DIKA 1NQVA 4QPPA 2BJHA 1USGA 5CVUA 2WILA 3OZGA 3MMZA 3TZHA 1YB6A 2VA9A 3C3CA 3OZ7A 2F55A 4NBTA 4S1OA 1N9ZA 4QG7A 3URKA 3KKZA 3B5JA 1UIMA 3AUUA 3AJAA 4YROA 1W2GA 4EAQA 1NTOA 1I5RA 2IP2A 3VRHA 3IILA 3IP7A 1KSHA 1LGYA 4RJ2A 1JKFA 1SUWA 3LY9A 4OBEA 4PIVA 3NM6B 4G89A 3Q9LA 1L4HA 1OD6A 2WWWA 3KQWA 4KDRA 3UTCA 4TPKA 3LAWA 1C7JA 5CVCA 1WPGA 1CFZA 2VLIA 3JASB 3A1WA 4MYDA 1K08A 4GI2A 4B3XA 4EUKA 1VG1A 5EWLA 1BCSB 4C9BA 3N59A 4M21A 3IP6A 4JHLA 3OA2A 2GBIA 4JT4A 4XM0A 4B46A 3HYNA 3F5QA 1W5FA 2E3JA 4ECEA 5JRJA 1OI3A 3BCUA 4PSCA 5ALOA 1JIQA 3W79A 3WRXA 1K86A 3GH1A 3OZEA 1O6ZA 2QQ5A 2W58A 1GVNB 3V1NA 3W0LB 5B7GA 1WUIS 5JYEA 3JQBC 5BMVA 2CK3A 3NWJA 3GLIB 1BX3A 1OWOA 4PBRA 2VPYA 2BFEA 1L5ZA 1NXOA 4R1SA 3H3FA 4IF6A 3ZCRA 1A7KA 1P33A 3TLKA 5K0SA 1JXAA 1EBBA 3DE0X 3C5CA 3HKDA 4Q1BA 1Y9DA 4YHHB 2HSEA 3NHBA 4WNAA 2NO7A 4RWZA 4NZOA 3TSYA 1B0PA 4YRNA 1TUGA 2WIAA 3EIEA 3MTAA