2CBGA

Crystal structure of the pmsf-inhibited thioesterase domain of the fengycin biosynthesis cluster
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
210
Chain Sequence
SAAGEQHVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITEIQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGIQTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNILDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FENGYCIN SYNTHETASE
publication title The Thioesterase Domain of the Fengycin Biosynthesis Cluster: A Structural Base for the Macrocyclization of a Non-Ribosomal Lipopeptide
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 69
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.40 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2cbgA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cbgA01
3GBSA 4OB6A 4WDQA 3O4IA 4J0DA 2XUOA 2OQVA 1CR6A 1ODCA 2WUFA 4G1FA 4FDMA 1XZMA 4UBKA 4B7ZA 4X71A 4J0CA 5JYCA 1W4LA 2XUIA 3W2TA 4BYMA 4CFSA 1XZDA 5AI0A 2XUPA 1LPMA 3FYUC 2PX6A 5AKXA 5LIPA 3Q8WA 1CV2A 1YA8A 2J3QA 1TAHA 3R0VA 2WG0A 5C8ZA 3PFBA 5HKAA 4XVCA 1AMNA 5AM3A 3IUMA 5AKKA 1DWPA 4AMYA 1DTEA 1YR2A 1MTZA 2IIVA 1R88A 4AO7A 3WKCA 3A6ZA 4W9RA 2VF2A 4V2IA 4ARAA 2C58A 3MUOA 5T4HA 3LIIA 5E4YA 4FHZA 5EIEA 1CUCA 2WUGA 1TK3A 4H7DA 5A71A 2HA3A 1QIHA 2B20A 3HI4A 3WJ2A 3FVRA 5LYYA 3N0TA 1DWOA 4BE4A 2JIDA 1CRLA 2XMQA 4OB8A 2BAGA 5DTJA 4OCZA 1EHYA 4ZV9A 5EGNA 4FFWA 1SCIA 1XRNA 1ZJ4A 1H2ZA 3F97A 1XKTA 4Z49A 2B9VA 4BRSA 1BN7A 4YK7A 4UFOA 3ZLUA 4AO6A 4HAIA 5JATA 4FBLA 3G9ZA 3RK4A 2ACKA 1VA4A 4Q82A 3VJKA 2DHDA 1QJ4A 2PBLA 2JF0A 2Z8XA 3R3WA 2RI6A 3WA6A 3L1HA 3IIIA 2XMRA 5LZ4A 1ODTC 5HF8A 1GPNA 4EY7A 3WKEA 3O9VA 3W05A 4KE8A 4B6GA 2XMSA 3B12A 1NU8A 3GUUA 4E15A 5ALIA 5AM4A 3R3UA 4EUSA 3BIWA 3G0GA 4I19A 2WTNA 1ACJA 1UOQA 4ZXFA 4DLNA 4FLEA 2WFLA 3M81A 4KR0A 2WIGA 4A5SA 1S8OA 5HQ3A 1YB6A 2WFMA 4UFNA 1EVQA 2DFPA 4EY5A 2QRUA 3STTA 1CUZA 1G5FA 4QDOA 1KEZA 4J03A 4ARBA 1JJFA 3G8YA 4WFIA 1QTRA 1YS1X 4P08A 3GFFA 1MU0A 1OILA 1G4HA 2VAVA 5JAUA 3OURA 3WI7A 3WQHA 1X2BA 4J0HA 5EHZA 5C8XA 2WFZA 3WLAA 2QXUA 3C5WP 4Y2QA 4DNQA 5FV4A 1GPKA 1AURA 1LLFA 3BDVA 1Y37A 3WL7A 3AZOA 1F0PA 1XRRA 4K6KA 4JH0A 4EY4A 5JASA 5JZBA 3G0IA 2HFKA 1W6RA 2AJDA 3F98A 3QITA 3PUIA 1R1DA 5FLKA 5T4EA 4N5HX 1EB8A 2Q0XA 1DX4A 5I9IA 4EY8A 2OLEA 4RE6A 1CUSA 2XQJA 2YH2A 1WPRA 4XIIA 5JZSA 5LP1A 1USWA 3HXKA 3KWFA 1YS2X 4DMFA 4L9AA 4J7AA 1P0QA 1FFAA 2QJRA 4Y2YA 3TGLA 5FXMA 3V48A 1CPYA 1OXMA 1EK1A 4Q3LA 1ZOIA 4Y2JA 1L7RA 3B3QA 1QIIA 2WJ3A 1JU3A 5ALQA 2HU7A 1MAHA 5HZGA 3BDIA 3W06A 2OXEA 4L72A 4F21A 2VAXA 1K5PA 2PU5A 1N1MA 1CQWA 4KE6A 5ALZA 1Z68A 3EQ9A 4DMHA 2WHQA 3V1NA 1CUBA 3EQ8A 2XMBA 5HFNA 3WK5A 1AX9A 4QEKA 1YB7A 1YA4A 2X5XA 3G0CA 4H7FA 2OAEA 3WIOA 1DQZA 4IQ4A 4E46A 3D2BA 3QMWA 2QOEA 1O6GA 1BEZA 1VE6A 2QUAA 2I3DA 1NU6A 3GELA 4M0EA 2XQFA 4XX1A 3G0BA 3JWEA 1XLVA 3EQ7A 1AQLA 1CUDA 4ROTA 3I1YA 2ONCA 3HSSA 1DQYA 2WHPA 1QFMA 4H7HA 3CN7A 4BDTA 4BAUA 4Y2RA 3FLEA 1UK6A 2VJDA 3PI6A 1N5MA 4N8EA 5J3JA 3L1JA 1VXRA 4OYYA 1QIDA 1IVYA 4LYEA 4OUKX 2EEPA 3DNMA 4UBJA 4MYSA 4PW0A 4U2FA 4U2EA 1I6WA 4GXNA 2ZJ7A 4RGYA 1HQDA 5I7UA 1L7QA 3G9UA 1VZ3A 4C01A 2HDWA 3FYUB 1K4YA 5AIAA 5E2IA 1TCBA 3EIOA 4QA9A 2HL6A 2ROQA 4KE7A 3IB3A 3K2IA 2BCEA 1TCAA 5AI9A 1MJ5A 3X3HA 4FWBA 1A8SA 4AMZA 1CUWA 2VJBA 4N8DA 3RLIA 4CCWA 3CCCA 3T52A 4IH4A 5FOQA 4A23A 2G4LA 3WZLA 4X95A 5CBKA 3BJRA 1HL7A 1WOMA 4W1RA 3NGMA 4KJXA 2HHAA 5KBYA 1LGYA 3QBJA 2ZSIA 1K6EA 4W1PA 4EA6A 2XMGA 5I8PA 1A88A 1WB4A 2GYVA 4WDRA 1VZ2A 1U8EA 2OCKA 4X92A 2V9ZA 1LBTA 3CN9A 5ALFA 1JT2A 1W76A 1LPSA 1OCEA 2Z3WA 1IMJA 5CRIA 2PSEA 3QPAA 4Y2VA 3O95A 2BJHA 4PV7A 4KRXA 5AKHA 3C5VA 1AC5A 1GT6A 1XQYA 1CLEA 5CW2A 4J0KA 1CUJA 2XQGA 1Y7IA 4U2BA 5T4FA 4GDMA 5CMLA 4Q05A 4Y2UA 2XE4A 2J4FA 2RGUA 4G4JA 2OCIA 3BE8A 5K3AA 4DYHA 4BVLA 1TCCA 4MWTA 4H7IA 1FSSA 3NUZA 4B81A 3QH4A 5K3CA 1MPXA 1R9MA 1E5TA 2VJAA 2XQIA 5K3FA 4YPVA 2VJCA 1MX9A 5EHQA 5EI5A 2Y2UA 1U65A 4S0XA 2DCMA 3BIXA 4K6GA 2PUHA 1CUXA 4J3JA 3DL4A 5A7HA 4W1SA 3D4LA 3D59A 1ZI6A 5AKEA 4CCYB 1MX1A 1CUVA 3C45A 1VXOA 1EB9A 2RHTA 5AK4A 1P0IA 1EVEA 4EZIA 2WKWA 5A62A 4DM7A 3F96A 1QONA 3K9BA 1EH5A 3IUNA 5DLPA 3N2ZB 1CUGA 1QIEA 2JEYA 5IKXA 2XMCA 3PDCA 5D3ZA 1MX5A 2OAGA 3AUKA 1R9NA 4QWWA 2OPHA 3IBTA 4W63A 4QDXA 4PF1A 3R3VA 3FWHA 1GGVA 4DNFA 1FJ2A 2HA2A 1MNQA 2XI4A 3STVA 2O2GA 4LKOA 2QM0A 2ES4A 4UBOA 4UHEA 1HKHA 3GA7A 5EIHA 5K3DA 4X90A 2GZSA 5CT8A 1MNAA 2XB6A 1QE3A 1SC9A 3NWOA 4IH9A 1JKMA 3BXPA 3ZI7A 4F60A 5JAOA 4BP9A 3HYSA 2C0QA 2JEZA 4F5ZA 4DTCA 3WWEA 3ILSA 5FDFA 4JEIA 3KSRA 1BS9A 3WL6A 4ETWA 3D5EA 5BOVA 3FCYA 3R3ZA 2WHRA 1EDEA 2QS9A 5ALNA 1LPBB 4BCCA 3SX4A 3WK6A 4IHAA 2H7CA 4HXGA 4PQEA 4I4CA 4BDSA 3Q0TA 4HZGA 4BATA 1W1IA 2CZQA 4U2DA 3D2CA 5IVIA 5AM1A 5AOAA 4AZ3A 2XLBA 3FLBA 3EBLA 5CTAA 2AJ8A 4ZGBA 3OTQA 4X00A 1QIGA 1UXOA 1IUNA 2ZYIA 4WY5A 3QZUA 3QMVA 5JARA 2WIJA 4QWMA 1KU0A 3ZLVA 1A8QA 2CMFA 1KU6A 2HU5A 4GBGA 2WIFA 5C7YA 1RWQA 2EDAA 1ZGCA 4NVRA 3ICWA 4CI9A 3I2HA 4KRYA 4AZ0A 1ZD5A 1R3DA 5SYMA 1YAHA 2BGRA 2QR5A 1XQXA 5CH3A 1H2WA 1UFOA 1GKKA 4BTLA 2QMQA 2WFLB 2HRQA 1UKBA 1R50A 4LYDA 3DS8A 4Y2TA 3AZQA 1XRPA 5DYWA 5ALKA 1UKCA 4WFJA 3R41A 3H2JA 1ORVA 3WZMA 3H1AA 1AUOA 5D6OA 3C6BA 5A7GA 3QPDA 3P2MA 2FUKA 4M0FA 4FNGA 2G5TA 4LXHA 2WG2A 4G8DA 2YYSA 1D07A 3OG9A 3H2GA 3LLCA 1F8UA 1XZHA 1JFRA 4BRZA 4RE5A 2R8BA 5AO9A 3G7NA 2QUBA 2K2QB 3C87A 4W1QA 5HKBA 3MUNA 4FNMA 4ZRDA 2W22A 3LS2A 2X76A 4G9EA 1QOZA 3VVMA 1R4ZA 1UK8A 5HF6A 4DNOA 2VEOA 5DYYA 1WB5A 1YAJA 3H1BA 4MWSA 1DWQA 3UUEA 4KAAA 3KWJA 3IUJA 5ALMA 3E1GA 4X94A 1WHTA 1DX6A 3F67A 4GEGA 1LPOA 4Y9SA 4GHWA 2DHEA 3STXA 3V1MA 2AJCA 2JGMA 2VTVA 1UWCA 1WB6A 4U2CA 5ALYA 3ANSA 2DQZA 4PNZA 3FOBA 1QFSA 3DJYA 4QDTA 5ALUA 2Y6VA 4NZZA 4GW3A 4K2AA 3VJMA 5K3BA 3A2NA 5AKGA 1LNSA 4BAGA 2VT6A 1XQVA 4TGLA 5ALOA 2WIKA 1CQZA 3K6KA 2OGZA 5H3HA 5JAPA 5FP0A 1JJBA 1ZICA 1P0MA 4JYMA 5ALLA 4BB0A 3STUA 1ZD3A 1FFDA 2D0DA 2JGJA 3EF3A 4C6HA 5IVHA 2XUKA 2QXTA 2XUQA 3FCXA 5D7BA 4KACA 3F8SA 3I2KA 5C8VA 4UBLA 3HZOA 1TKRA 3TRDA 3O9MA 1QTIA 1Q84A 3A70A 4OSEA 2GYWA 4AX4A 4LIPD 2ACEA 4Q3KA 3AIOA 1UKAA 3ANTA 3I2IA 5BV7A 2C0PA 3I28A 5BWBA 1FFBA 3WWPA 3FVTA 5EFZA 5AI8A 4LXIA 5ALPA 1Q83A 3DEAA 1ZD2P 4NS4A 1VOTA 2LIPA 4MEBA 5AICA 1LPPA 5FUMA 4PSCA 2VA9A 4X91A 5AI4A 3C6ZA 4BTVA 3H0CA 4XJVA 4DIUA 1Y7HA 4Y2SA 5DYTA 4HRXA 2PSJA 4H35A 1B41A 3QMMA 4BC1A 1UT6A 3PICA 3BJMA 3C43A 4X85A 4PO3X 3W04A 5HF5A 2XMDA 3IUQA 2CEKA 1E8MA 3ZV7A 4EHBA 1EA5A 2WILA 3H18A 3IULA 1VLQA 1IUPA 4C4ZA 3FNBA 2HFJA 3H2IA 3STYA 1UK7A 3DYVA 3DOIA 5FKJA 1AGYA 1AZWA 1CIJA 2GZRA 2JGEA 4YX9A 1WHSA 1XZLA 3OM8A 5KWIA 1G42A 3KXPA 2XUGA 4X6UA 1XZGA 1XZCA 4UHHA 3C70A 4HS9A 1XLWA 2WUEA 3DKKA 5YASA 4X7BA 3WK4A 5AKJA 3H2HA 2WUDA 2H7XA 1XQWA 2O2IA 2VQ6A 2PKYX 1VE7A 3DLTA 3RKSA 2X8BA 3WWOA 4OB7A 3FAKA 1SCKA 4G4GA 1XZFA 3W9BA 3DOHA 2B4KA 3I1IA 1ZGBA 2IX9A 1XRMA 1GQRA 4B82A 3VISA 4C89A 1THTA 4QDUA 1CFJA 2VT7A 4QDZA 3WKAA 4C4XA 3HACA 3IVMA 1XZJA 3LP5A 5ALEA 7YASA 1Q0RA 2AJLI 1ZD4A 2WIDA 4DSZA 1E8NA 2XUDA 5K3FB 5IH7A 3QPCA 1A7UA 4IO0A 2XQKA 2J3DA 2AJBA 4E14A 2CBGA 5LZ2A 3R3XA 1JMYA 5AOBA 2XDWA 4X93A 3SK0A 1QO9A 3G9XA 2Y6UA 1DU4A 2UZ0A 1EI9A 3WKDA 5AIBA 5ALTA 5E4TA 3DKRA 4XWGA 5A6VA 4DMKA 4DNPA 3HABA 4C4YA 4C87A 1DINA 3W9UA 3WK9A 2ZYHA 2NW6A 5LZ9A 1XZBA 2IITA 1XZEA 3WMRA 1HBJA 3BL8A 5LKAA 2P8SA 5FRDA 4H7JA 3DDUA 2I03A 3E3AA 2O7RA 3PF8A 2FJPA 4M0MA 1E89A 5HK8A 4FBMA 4UBNA 5FPPA 5AHXA 2Z3ZA 2CKMA 2O7VA 4KAFA 1YCDA 4J0JA 1CUFA 3S2ZA 2I78A 4UBIA 1CUYA 1XZIA 1HLGA 1ACLA 1DT5A 5AKLA 2ZSHA 3M83A 3I2JA 1PJAA 3OOSA 4Y7DA 1ZI9A 3ESDA 3KD2A 4GLBA 3WWCA 1XFDA 4TVKA 4INZA 4BE9A 1SOMA 2HM7A 5T4BA 5EIAA 4NMWA 4DMCA 3PF9A 4FOLA 5JANA 2B61A 4CG1A 2GBFA 3VVLA 2HA6A 4PSDA 4Q1VA 5BWCA 1F6WA 2PPLA 1J07A 2C5GA 1J2EA 3RARA 3AIKA 1JI3A 2XMZA 5CH8A 5DWDA 1QIFA 3H2KA 2FJ0A 3I6MA 2OGSA 4B83A 4TPKA 2H1IA 1H2XA 4X3CA 3AIMA 3ZLTA 1GKLA 2HU8A 5AM2A 2AXEA 1JU4A 5LKRA 4OU5A 5E4JA 1BCSA 1UZAA 5ALXA 4HRYA 3FYTA 3ESAA 4AXBA 2JGLA 5JIBA 4B0OA 4AN0A 4Q3OA 2FX5A 2G5PA 2ZJFA 4P93A 3BF7A 4U2GA 1H2YA 1RYYA 1VJ5A 2HA0A 4B9EA 1AKNA 1WCYA 5AOCA 3D3NA 4GWLA 3IA2A 2QKYA 3V9AA 5AI6A 3JW8A 4WJLA 4QLAA 2RIPA 2WU4A 3QM1A 2XUJA 1M33A 1YSCA 2PVSA 1XRQA 4JYPA 3VXKA 2E3JA 4EB0A 4UUQA 2WSLA 5ALDA 1IUOA 2QVBA 2I3ZA 3KOOA 3UMJA 3O4HA 4GI1A 4CIAA 5DNUA 2OG1A 1XKLA 3CXUA 5K5EA 3I6ZA 1YASA 2BGNA 3AJAA 1A8UA 4P9NA 2RAUA 2RONA 4MXDA 4JNCA 5AKZA 2DHCA 2QZPA 1UK9A 3I2GA 4B85A 3I6YA 3O0DA 4UHCA 4IH1A 3WL5A 2HADA 3DD5A 3M3DA 1ISPA 5HQ3B 3B5EA 4HXFB 3G02A 1EDDA 4A16A 1BN6A 1CUAA 1E8DA 1IZ8A 4QE3A 3ESCA 5HFAA 2GBIA 5DTIA 2PM8A 1RP1A 3WWDA 3R40A 5ISMA 3R3YA 1XZKA 5LLSA 1QZ3A 2XLCA 4N5IX 2YASA 4H77A 5JD6A 3DL7A 4H7EA 4QNNA 1CUIA 2PSHA 4FLFA 2XT0A 1FFCA 2D5LA 4BVKA 4BZWA 2J4CA 1ODSA 3WJ1A 4ZREA 1FFEA 4B80A 2XUFA 4G8BA 2Z8ZA 4B9AA 3C6YA 1C7JA 5AJHA 3TEJA 4BP8A 4UPDA 3TJMA 2BFNA 4CIBA 2XUAA 2QT9A 4EBBA 4B84A 3AFIA 2WQZA 1G66A 4FFVA 3L1IA 3OPMA 4OPMA 2O2HA 1GXSA 1CUEA 2ECFA 1XRLA 4UFPA 2Y1KA 4BCDA 3F9CA 3BWXA 1EINA 2JGIA 3IURA 4QLOA 5K3EA 1K8QA 2RHWA 3KDAA 1QIMA 1F0NA 4LHEA 1K63A 1ZIXA 5LZ5A 2G63A 3E4DA 2HA5A 2Z5GA 4AO8A 2DSNA 4UHBA 3WA7A 4AN1A 5JD4A 1O6FA 1EXWA 3T4UA 4UBMA 3BF8A 1SFRA 3DQZA 3SWWA 4CG3A 5HK9A 1LBSA 5C81A 2OGTA 1MT3A 3HRHA 2H7YA 1VKHA 1T2NA 2CB9A 1BRTA 4K5QA 4X6XA 1BU8A 3C8HA 1CVLA 1LPAB 1E3QA 3H19A 2WJ6A 5CT6A 5JAHA 2DQYA 3DYIA 3MGAA 4G5XA 4WCVA 3A2MA 2W6CX 4G4IA 3WYDA 4BAZA 2WJ4A 4AQDA 4O08A 1JMKC 3I2FA 1QO7A 1ZIYA 5AI5A 1EK2A 4JUIA 5LZ8A 4KE9A 2EDCA 5ALVA 4Q34A 3DCNA 3D7RA 3V1KA 3WYNA 5LZ7A 5AP9A 3FLAA 5DNWA 2WHPB 2C4HA 1U4NA 4KEAA 4G9GA 2CUTA 3ZPXA 3SC2A 1JJIA 1C7IA 1MAAA 1ZI8A 3PFCA 4FKBA 2C5FA 2PL5A 4KAJA 1EX9A 3M82A 5ALHA 5HCUA 1DT3A 5IVKA 1QGED 1THGA 5AM0A 3ESBA 1J06A 5CT4A 3HEAA 2VATA 4RNCA 1UOOA 5EHXA 3HLKA 3MVEA 4EY6A 1TQHA 4FLMA 4CG2A 4P92A 2Y2VA 1MN6A 3WL8A 1E66A 4ZV7A 3A2LA 2XUHA 3NOXA 2OQIA 5A2GA 4OYLA 5CURA 1U2EA 2WLSA 2JGFA 1C4XA 2V98A 5ALRA 2HIHA 3D2AA 5IVDA 4MEAA 3VJLA 3WK8A 1NX9A 2BKLA 4AB1A 1EDBA 4YASA 4X6YA 5A7FA 4DGQA 4K6HA 3ED1A 1GQSA 4FTWA 1TIBA 3WKBA 4MJ3A 4WY8A 2QTBA 3VDXA 1LPNA 2V96A 3HC7A 1QIKA 1Q0ZA 1LZLA 2GBCA 1P0PA 2WTMA 3C8DA 2ZYRA 3QYJA 2H9YA 5AKYA 5AH0A 3LCRA 3H17A 3WIBA 1N5RA 3AZPA 1PV1A 5F4ZA 4WFKA 1QLWA 1IZ7A 3O4JA 1XROA 4L3WA 4C88A 4N8SA 2GBGA 5CXUA 4F0JA 2PU7A 4G8CA 1BROA 5D3KA 4B0PA 1CUUA 2WU3A 4D9JA 4BVJA 2ORYA 1CUHA 3FYUA 1B6GA 5ALWA 1HDEA 1VA5A 1CEXA 5ALJA 3RM3A 4OU4A 2ZYSA 1ORWA 3ZWQA 5DJ5A 2JGKA 4HTAA 1T4MA 1UOPA 5CH5A 1MO2A 4J0IA 2C7BA 5CT5A 2ZJ6A 2HRRA 5ALSA 3FSGA 5CT9A 1TRHA 5AK6A 3FSGD 3GZJA 3E0XA 4OD0A 4L0CA 3G9TA 3LIPA 3JYHA 2GYUA 1QIJA 2JBWA 2BUCA 4Y2XA 3C6XA 3D0KA 4HXEB 1GPLA 5ALGA 3U0VA 4X97A 2QJWA 1WM1A 3O4GA 3ICVA 4MQLA 5HF9A 4PSUA 3S8YA 4H0CA 5AK5A 1LZKA 4J0GA 3IDAA 1W52X 2PSFA 4LXGA 5JZ9A 5AKIA 5JALA 3V1LA 1XZAA 5CXXA 2PSDA 6YASA 5JADA 5AK3A 1X2EA 1PFQA 3PUHA 1X70A 1J1IA 1WPXA 5ESRA 4H7KA 5DNVA 5KREA 2OCLA 4Y2PA 1SCQA 3OC0A 3U1TA 2HA4A 3AILA 2PUJA 1HPLA 4GECA 5FPQA 2V97A 4UHFA 5AM5A 3G0DA 2BUBA 3QVMA 1W75A 3YASA 4UHDA 1XLUA 4ITVA 1ZJ5A 4H18A 4KYVA 5KWJA 4MQMA 1N8SA 3STWA 4QZVA 2VSQA 4DSAA 4E11A 3VKFA 1ETHA 1BEEA 1H23A 3CCBA 4HVTA 4BZZA 2OCGA 1BE0A 4BBZA 2HA7A 3AINA 1GZ7A 3UUFA 3PE6A 2BUAA 2WG1A 2R11A 5SYNA 4CCYA 4BC0A 2CJPA 4MYDA 3HJUA 4I3FA 2WM2A 3H04A 1H22A 4FMPA 3FBWA 3GROA 2YXPX 5EHNA 4ZWNA 1BCRA 5JD5A 2ZVDA 3WK7A 1L7AA 2DR0A 4RPCA 4ZI5A 4BCBA
chains in the Genus database with same CATH superfamily
4OB6A 4V3BA 4GGPA 1PR3A 3FNGA 4TYQA 4EVSA 3O4IA 1K8XB 3M6IA 4AZ3B 4B3FX 2OQVA 4L9RA 2OKGA 2B7CA 1VMIA 4YDQA 2F43A 1K9VF 1ODCA 3OHMA 2EJTA 1U0EA 2PS0A 3QIVA 3ENNA 5CEJA 2IV2X 3I9V6 3LVFO 2HX1A 4GDFA 1RBYA 3OF2A 4ZODA 5BQOA 3P97A 1AHPA 1YQQA 1QTNA 4PRZA 4YGYA 1GUYA 2C4KA 1L4HA 1ZD8A 3VA7A 2XX3A 2ZJZA 4L73A 3SIWA 2UVPB 3KZKA 5FUXA 2FQQA 5IM4A 3U44A 3LVQE 5AI0A 1NJ8A 3CNEA 3W2FA 5A4DA 3OBIA 4H1VA 2PX6A 3LFHA 5AKXA 5HUQA 3NWBA 3IPAA 4DXAA 2CCGA 4IRXA 2WSMA 1GVNB 4XWKA 5HIAA 4DVJA 1TUIA 1H2EA 5E9WA 1G5TA 4L8VA 2BHSA 4O25A 4TTVA 1JAYA 4L4YA 1LSJA 1OV4A 2VPIA 1Z6QA 2L17A 4Z7OB 4Z3DA 4EG5A 3ULKA 2PR7A 3QKSA 2Z1NA 2QQGA 1DRJA 3V33A 1US8B 4R68A 1OI3A 4QULA 3E9NA 2AOUA 4KNYA 1BHQ1 5EE9A 3U31A 3H9BA 1PNOA 1AHNA 1KNQA 1U7ZA 2KWIA 3RU2A 1UQTA 3ZY4A 2O05A 1Q7BA 3ER9A 1RKQA 2JFZA 1GLVA 3O83A 3UHPA 3PCTA 1DTEA 5KMGB 5K4HA 3KKZA 4WVFA 1X7GA 3C1UA 3CZCA 3HY4A 4J1NA 3R8XA 3RGWS 4EHNA 3HY3A 2PUVA 4FILA 3T5TA 1L7XA 3C6QA 4JHXA 4MVJF 4ZVRA 3GMDA 4GKVA 2AUTA 4AO7A 5BV2P 4W9RA 3D0QA 1OZHA 5JC8A 1H05A 3JVVA 4EGCB 2H4ZA 5THXA 4Y1EA 2Q9CA 1QRAA 4YAGA 4YAJA 1UMKA 2XNSA 1A27A 3EZ2A 5T4HA 1M10A 1E7RA 3LIIA 3SF8A 1CUCA 1FC0A 2PGLA 1JHYA 1MHPA 3BGSA 2IDJA 5LQSA 1GGEA 1C3VA 2WUGA 4PVDA 4RTAA 3QOWA 4N65A 4CE6A 4CMIA 1L4KA 1RC8A 2WAXA 1JQ5A 1NXXA 4RHTA 4C2BA 5J2TA 2Z6UA 4I5IA 4H3SA 3EF1A 4HLNA 2WINI 3QKRA 2Q6KA 3LBYA 3P26A 1QRDA 3DE3X 1SOWA 1JLSA 3TZLA 5M5BA 3RK0A 1PFKA 3G3EA 4PEVA 1K7EB 3K09A 3PHIA 4LW8A 3EWIA 1ABBA 3OZGA 1GO2A 2QQ0A 2JIDA 1UBOS 3D6AA 1CRLA 2XMQA 3V8BA 5DTJA 2PZKA 1Z6GA 4P7GA 1BWPA 4XIFA 2Q0SA 3C3EA 5IXJA 3KZVA 5F7ZA 3C7AA 3HKCB 3GFPA 2DETA 4LMBA 1VMKA 4BO0A 1A5SB 1XRNA 3VR4D 3UUGA 1H2ZA 3WG9A 4I5GA 4A0RA 2FXIA 1L5SA 3CUUA 1JYEA 1WXHA 2WA1A 3UHJA 4AY5A 1C9YA 2DECA 2K2WA 4DDMA 1BN7A 4C21A 3D54D 3E5HA 3OCZA 4LZZA 4P84A 1G21E 4RZ3A 4HAIA 3ZLUA 5AVQA 2C2KA 2P1ZA 1C3XA 2MIIA 2NQ8A 2WT8A 4GP9A 2QRVB 1GCOA 1NJGA 3ZDCA 1E3EA 4EHHA 3E61A 4Q82A 3BXGA 4L6IA 1PE0A 3BIFA 5K0GA 2JARA 1PEDA 1K7XB 2KNGA 3SAJA 4TL8A 2I6UA 4MS3B 4X8HA 1NLZA 1RSZA 3U37A 4DV4B 2XKBA 4JROA 3U26A 4JT2A 4RUKA 3IP6A 4RTPA 3K70C 3PGKA 5BMOA 4X45A 1BVUA 1YJBA 3LPMA 4W5HA 1KDVA 5HF8A 1V16B 1J23A 1Y8CA 4FEYA 2CY0A 3ZZUA 3D4PA 1P2BA 3DWFA 4Q4HB 1RE0A 5D1HA 1BS1A 3SX0A 1FLNA 3U39A 3PQFA 3HNOA 3I5YA 2KYGA 1JP7A 4O1MA 5EIXA 1WHTB 4RZIA 3BZBA 5J4LA 3GN2A 4CCSA 2G9UA 4P35A 2XMSA 3DEKA 3S70A 3MBOA 1SVMA 1PQWA 1YRYE 3VM6A 1YBHA 1H8HA 4IDCA 1KR5A 3O0TA 5AM4A 3OE4A 4EUSA 3BIWA 3HN7A 1H8HD 1OVMA 4RW0A 4CZ2A 4I19A 2NTEA 2EKZA 4QGFA 3SEZA 1JW9B 4QQ8A 4G26A 5A04A 5B2ZA 4Y2HA 2W11A 3CX3A 4GOMD 1M54A 5JU6A 2RHOA 3P8ZA 4A5SA 1JRLA 3MJ4A 3LDUA 3ZDQA 3THOA 3IAFA 1EXNA 3MJTA 3NAMA 5FOXA 2P68A 4UFNA 3VVBA 1VG9B 3UJ7A 2UUOA 2IHVA 3T3MB 3AESB 3G8DA 4CLOB 4EY5A 2QRUA 4BXOB 5C8YA 4LJ4A 5CX1A 2X23A 4DQXA 2NVBA 2I2DA 3G8YA 3H75A 5I9TA 2QRPA 3Q12A 4IY1A 4BMPB 3OCUA 3C5EA 3CEPB 4F1WA 1EE9A 3E9MA 4O1IA 2C9ZA 1OILA 1VP3A 4TMYA 1LDYA 5BSGA 1QQAA 3OT5A 1J70A 1GTMA 2WJWA 3KVRA 1VCIA 2FV8A 2HJSA 1S2LA 2O2ZA 2OZVA 2VAVA 1KJQA 3WQHA 3OZWA 1N57A 1OFVA 2DFVA 3NASA 1RT9A 3ZWWA 2ECPA 4QM6A 2WWTA 5CNMA 4W7HA 4Q4JB 4QO8A 1TM4E 1Y98A 2Y67A 1IRXA 4LF9B 3Q2IA 2OBBA 3WRXC 4WKCA 4EKDA 1ZM7A 1PQPA 2ODAA 1H1TA 1D9XA 3D6MA 1OI4A 3S2YA 2ZIFA 4AC9A 4CL0A 4DNQA 2A2ZA 5KVSA 1PK8A 4AQ7A 4Q3AA 1T0HB 5CYPA 1IEXA 3BDVA 4DVGA 4MAFA 4YPVA 3KOUA 3WL7A 4L7QA 2QN1A 4FCCA 1N4AA 2VH5R 1F0PA 4JI3B 1XHEA 4HWSA 3SKVA 1FVXA 2XCOA 3NTRA 4EG7A 3ZHQA 5JXJA 1NF2A 3LY5A 1RMQA 1HYBA 3BEDA 3VU1A 1W0JA 4MJXA 4GT1A 4OOFA 3LZDA 1W0JD 3V2GA 1KQGA 1TFRA 5KSYA 4DR6B 4TVOA 4WLNA 1RHQA 1XL1A 4ZV4A 3UB2A 2OUTA 1W4BA 3DMFA 4ISBA 1Y6QA 4Q7QA 4RHCA 3V8EA 1P3JA 2D1FA 2I4RA 3VOBA 3EFOA 4MZDA 1RNLA 4LGYA 1RJFA 4E5MA 3E1SA 3A9TA 2Y1LA 3N2KB 5I9IA 2O14A 3DC7A 4ZU6X 1AK2A 5E6RB 3H1PA 4XIIA 4CLXA 4CR6A 4IXDA 5G1OA 2Q7OE 4PG5A 3ROPA 2OV4A 2WWXA 1UJ2A 2VR1A 4TMXA 3GWZA 1IL0A 1H3NA 3EOBI 3HXKA 2X0NA 4GF5A 3ND7A 2UUPA 4HNHA 5EJAA 1QZUA 2BGIA 2PN1A 3VNRA 5CHYA 5KSWB 1IG0A 1E3SA 1O7JA 2IDZA 3IVGA 4MW5A 4RZXA 4F4UA 2JLBA 1B76A 2Q6VA 2IS6A 4J6FA 1NUHA 4LRQA 5ERXA 4KQWA 2ZSUA 1J9GA 2M2IA 1ECLA 4O2RA 1ZH6A 1FFAA 1S2GA 1PZHA 2DQ4A 4HB3A 4ZI2A 5JBIA 4Y2YA 3VSEA 3VV2A 5LQAA 1A98A 4MLDA 5KWVA 2Z8YA 5ULLA 5BNIA 3T61A 4QXPA 4FEAA 3TGLA 1BSVA 4R54A 2ZBEA 3SLGA 3V7WA 3MWKA 5LA6B 3AF4A 4TL9A 3GLGE 4R2XA 4HYEA 1GFZA 4JI2B 1YI1A 3A05A 3GNLA 2YYYA 4HAYA 4IZHA 3IP3A 1R00A 1QDLB 1RIIA 2GETA 4KX5A 4MICA 4O2AB 5AW9A 5T64A 5JC1A 8ABPA 1JU3A 3OZIA 2OZEA 2PDAA 4JSTA 1SVLA 4OQ4A 4UEJA 3TZKA 1MAHA 2NUPB 4DHEA 2VWGA 3WDSA 4UEOA 2BEKA 2HLHA 2X4GA 5HZGA 3P9RA 4AJ4A 3QEMB 1HF3A 3PRKE 2OAQ1 3FAZA 3KSMA 2J0SA 3BDIA 2JJ8A 4GXTA 4ZVOA 2ZB2A 3WHIA 4D8WA 4DMUB 4Q3BA 2OXEA 4ZOLA 13PKA 1TLLA 1FB5A 2DBYA 2DWQA 2XGGA 3NHUA 5GV7A 1N0HA 4F21A 3I4LA 5KC9A 4ZTUB 3HP1A 1PJQA 2A86A 3R44A 1N1MA 3UMCA 4KE6A 5DBGA 4JI7B 1OWPA 4Y67A 4BNNA 5ALZA 1TYZA 2I4TA 3EQ9A 3AHFA 1WS6A 4YR9A 4DMHA 3U5TA 1SQ6A 1D2MA 1W4CA 4BMNA 3I6IA 4RY9A 1LLQA 2VQFB 4JI8B 2GDJA 2QTMA 1ZLYA 5AVOA 1Y1RA 1AQNA 3WK5A 1AX9A 2I7CA 4QEKA 2ZXEA 5F3DA 5F1YA 1R15A 4W8GA 2NTJA 3BAZA 1A82A 4WZBB 1O9HA 2QSYA 1CY6A 3G0CA 5C9ZA 5KQSA 3GVPA 4OLHA 4H15A 4QPPA 4XCVA 1INLA 2E49A 1SRRA 2AJTA 3KHUA 3T3IA 4GBJA 4DCVA 4EX6A 1QZTA 5HKKA 2ZQ5A 3RFTA 1TA4A 4N54A 5JCJA 4C3UA 4YP1A 5HKKD 4TMFA 4JJAA 5CIWA 2P8JA 5JCJD 5SZHB 1BYUA 2C20A 2FRDC 3F6EX 3EXFB 4CF7A 1KY2A 3CONA 1NIJA 4M0EA 3GELA 2AFHE 1T6YA 4AJJA 3JWEA 4LCEA 4W5RA 2O1SA 1NXPA 3E70C 1M2EA 2IHJA 2I7XA 2NO5A 2HSEA 4LGVA 3S44A 3HSSA 3QXGA 3OUUA 2WHPA 3TZEA 1GAQA 1U9YA 4CM9D 1BQ3A 1QXSA 5DN6A 4NJEA 1U2ZA 3CN7A 4BDTA 5DN6D 1XFAA 1NSYA 4QU9A 3SHVA 1FFGA 2X8LA 2FZVA 2HDNB 1PGPA 1PNQA 4K86A 4U5QA 5LSAA 1UAGA 1N5MA 4HRVA 4EHJA 4P34A 4B43A 2G76A 3QFTA 3UJPA 3VO1A 1Q1BA 4CTNA 4XRGA 5L51A 2CXHA 4RKWA 2FKNA 4KPUA 3D4OA 2EEPA 5LP6C 3WGKA 3TGWA 1VMEA 4MYSA 1W5AA 4UBJA 1U2GC 2WTEA 4IX1A 4PW0A 4UD2A 3HB1A 4YAIA 2ZWVA 5MF6A 1C0LA 2P9JA 2FLWA 1YB5A 4U2EA 4WW0A 4FEEA 2ZRQA 2ZJ7A 2V7BA 1KZ4A 3O93A 3Q72A 3QJ5A 3CX4A 1QB8A 4NBWA 4Q4AA 4BQNA 3LC7O 4CLRB 4EATA 4EPRA 5AQ1A 1HQDA 3IYLW 4CLDA 1L3CA 1I7LA 5DI3B 3JWPA 2FSSA 5I7UA 1KZ6A 3WJ7A 3FTPA 1FTYA 2W6ZA 4C01A 4PSKA 1K4YA 3NORA 1J5XA 4MQBA 2CFCA 2P75A 5AIAA 5E2IA 4DLYA 2F55A 1TCBA 2VSNA 4X64B 5I7RA 3UMGA 3IOMA 5CB4B 1VE5A 1UIMA 1JEDA 2CLSA 1PQUA 2WYUA 4JBXA 4Z0HO 2HJVA 3UXYA 4EJSA 3TUZC 1MJ5A 1QC5B 2F3SA 3TZHA 4FWBA 3X3HA 3F1LA 4C6TA 1SKYE 1S4QA 1CNMA 1K97A 1LNZA 2I2XB 3CKYA 1A50B 2V8BA 1NOKA 1U0OC 3E35A 3KV1A 1NQUA 4M1EA 2X9GA 5CPBA 3SR0A 2J1LA 5CIQA 1E9DA 1CUWA 2X86A 4OP3A 5DGTA 3T5BA 3QWHA 1QVAA 3P27A 5DNEA 3NYQA 3JD2A 2VJBA 5CA0B 3AI2A 2AC7A 1SXJC 1DRWA 1NXTA 2D8MA 1FSGA 2QB5A 2WYHA 4G23A 3HUDA 4IFEA 4JB2A 1N2SA 2RHHA 3DAGA 3HVUA 4I1UA 3X2FA 3R20A 4D46A 3FHOA 3CNOA 2ATXA 1MVLA 1Z56C 3GHHA 2OSVA 2GUGA 2HJRA 2JA2A 3ANXA 3FSEA 4L8FA 3WZLA 5JWOA 3ZD6A 2HZ7A 4XLTA 4V2UA 5FA6A 2I62A 3BQNB 3FDXA 4RQTA 4EP1A 1Z0UA 2RGNC 2KMLA 2CKDA 1YQXA 3NGMA 4H1UA 3PDJA 5F5NA 3PGVA 2XVXA 2PRKA 2HHAA 1CG6A 4PYRA 5BQ3A 1N25A 2ZRLA 4D3ZA 6LDHA 5KBYA 1LGYA 1QVWA 1JIQA 3QBJA 1DAGA 2QZSA 3ET5A 3JV7A 3NWEA 1K6EA 3G68A 1NSFA 2C83A 4EA6A 5G2OA 5JWHA 5K0JA 1ZXBA 3ML1A 1E61A 5HVNA 1NR1A 3HEMA 3JR3A 1M7BA 4WSOA 2CXRA 3M0EA 3HKBA 2K5UA 1JHZA 3VO2A 5BSVA 1YS4A 2C5LA 4Z99A 1EWRA 3OE1A 4EUFA 5KEIA 1VZ2A 3HY6A 2OCKA 4XJTA 4A6EA 1DHRA 2GAJA 2VHYA 4YRFA 1ISRA 4JI5B 3VU3A 4FPXA 1WDMA 3D5TA 3U7RA 5K0TA 5EP1A 4B3IA 2XY4A 3PXGA 5EC8A 1EX7A 3L6RA 3VH1A 4BJ5A 5CEFA 1GTL1 1OWMA 2QLMA 4ZAVA 3IEUA 4L95C 1JT2A 2QA5A 4LNUA 1Q3TA 2H2AA 3IDFA 4UCQA 4DRXA 1LPSA 1AKTA 3UJNA 2JLVA 5CRIA 2FOIA 3QPAA 3NC1C 1MVOA 1E2NA 3EARA 3E4CA 3EVDA 3E7FA 4R9VA 4S1VA 2XKKA 2CDCA 3CKMA 3EUAA 4M1TA 5CLIA 1I7PA 1DIHA 4TWBA 5AKHA 3IOCA 4NV1A 2A1UA 1AC5A 3JQCA 4JT9A 1GT6A 4LMRA 1SU6A 4ENVA 1SXIA 1FXWA 2AG5A 1JDTA 3K5IA 4J0KA 4J2OA 4JLVA 4JT4A 4YRQA 1SOAA 3ZEAA 5JH7A 1KEPA 2PYZA 4R05A 1F8FA 1M0TA 3VHRA 4DWOA 1LFDB 1NXOA 3EEIA 1YK0A 4N3GA 4B35A 1NQAO 2A5LA 3QOXA 3P9QA 4Q1AA 2W70A 4PCAA 3DL0A 1LV8A 4FI3C 3L1UA 5DXAA 1H0KA 3O8BA 5K45A 4E5UA 3RRFA 2GTHA 4LOKA 5HDQA 1TO6A 1V47A 4YJGB 5LA6F 3T7AA 1ZH2A 5B3JC 4OHKA 1KZ7B 3FYHA 1AF7A 2B8TA 2IXGA 1BE1A 3PZBA 4KK4A 4OH7A 1FVHA 1XE3A 1NRXA 1WPGA 4B32A 3MN1A 4IIYA 2BD0A 2QRQA 3NM4A 2IY9A 4MWTA 4BVLA 3QTTA 1FSSA 1UC9A 2FN4A 1B8OA 2VUSA 1XTBA 4R1QA 1IQ0A 1UCFA 2FLKA 5JJBA 3Q5GA 2DFTA 4KN9S 1R9MA 3SFZA 2XCTB 2F4VB 3DFZA 2C96A 4Q6BA 3B13B 3U4DA 2XQIA 2YWDA 4FJ1A 4EA9A 4NMMA 2RK3A 5LQMA 1GL3A 3E5RA 4ZQFA 4HAVA 4MQFA 5EUMA 4DB2A 4J2HA 1GV1A 1UXGA 4AZWA 2YVLA 1AY0A 1SHZA 3RVRA 5IUNC 4S05A 2Y2UA 4BX9A 2JKVA 2GCOB 4F9KA 4JEMA 1PJLA 1TZKA 2DCMA 2GN0A 1Z8HA 1PYGA 2PUHA 1CUXA 1MRZA 2QNRA 2QY9A 3DL4A 5BYAA 1FPMA 3L46A 1EZZA 4X5OA 3D4LA 4B2IA 3RVKA 1APBA 5EUCA 3T7SA 4CCYB 3ESQA 4ZKDA 3RIXA 3GP3A 4AI6A 4KUGA 3ZV4A 1II8B 1II0A 2XXAB 1OLUA 3C45A 1FYWA 3KR1A 3W7AA 3Q8MA 2ZI7A 1NN3A 3CR8A 1EHCA 3GT7A 5DX1A 3RRZA 5C5DA 4D42A 3K2QA 3K94A 2Y4NA 3H6GA 3SC4A 3F0TA 3M6WA 2EJUA 3P7MA 2GAFA 1U99A 2NYRA 1O6CA 4QPDA 3UFBA 1XMPA 4FMCB 1UKVY 1EX6A 2GN1A 4J90A 4RPHA 2EW1A 1HT3A 3NTQA 2VYQA 1FRNA 4MPDA 1QONA 3MWGA 5HKLA 3OZRA 5BN1A 3K8YA 1FFWA 2PZFA 3O8RA 1WBJB 1PF7E 3IAM1 2CDRA 4OHFA 4NYJQ 4J0EA 5DLPA 3DE5X 1FX1A 4CFZA 4DJJA 4XASA 5FUYA 4C76A 4F06A 3A0RB 1E0DA 1QS0B 2YXNA 4ZO8A 3TZ6A 4ZDJA 4YMLA 1CZUA 4MOWA 3RHFA 5B12A 1GT91 1MX5A 5D5PA 3NKVA 1VLJA 1QLJA 4XCQA 3MMPA 2F43B 2O20A 3AM5A 1IBKB 2FFJA 1J2JA 4F04A 1R9NA 2FPPB 4EFDA 2WF6A 1XJ5A 4I50A 3S1AB 3D8SA 4ILKA 3MGGA 3GBPA 4PF1A 4BBJA 3CS3A 3BWDD 1XXHA 1GNTA 4NOMA 2HYDA 2RHJA 1KHHA 1P75A 4YBZA 4M37A 1E1NA 4J75A 4ZAZA 5CR9A 1ZN7A 2GJ4A 1X8JA 1YTLA 4G0ZA 1KQPA 4UMFA 3ASYA 3ZZMA 3PFNA 3U44B 1HLPA 4EGAA 4NC9A 1U9IA 3OKFA 4L4SA 1O87A 3Q2KA 4NOKA 1LC0A 4LRWA 4WN3A 3T06B 4BRWA 2ZVPX 3IDOA 1CY7A 3EZ6A 3IQWA 5CYFA 3FNIA 2BYTA 2ZYTX 4JLMA 2PGOA 1VPEA 2JL1A 1MEJA 1T8TA 3RC9A 4Q37A 1IFXA 4UBOA 3BH0A 3JZMA 1RXYA 1U28A 2JRLA 1RC0A 2W2LA 2XDQA 1WNFA 4EOGA 4HMOA 1NJ2A 1BAPA 2W2LD 4Q7MB 3TECE 3WIVA 4E03A 4M9CA 4X90A 4CR7A 1VP9A 2QQEA 1DAFA 4KPEC 4LJ9A 1VHLA 1YQGA 1VJGA 4IZIA 3D3KA 3CKKA 2NMVA 2XB6A 4EAAA 3AFNA 1FY2A 1KI6B 4QRHA 5DM1A 1IHXA 4P3XA 1WSWA 4WL0A 2C5EA 3O1LA 3OIGA 5TJ9A 3ZI7A 3VOAA 4N5NA 3U4GA 2LVBA 5CB4F 1CDOA 1JJAA 1KP3A 1YZGA 2QPLA 1E92A 3X1YA 3RVNA 1X42A 4OYRA 5EXPA 3BD7A 3EA5A 3RF6A 1BJTA 4F5ZA 4DTCA 2OVFA 4LI3X 3IT3A 3SF8B 1KORA 5A4KA 4JLWA 1BHO1 4UEKA 3F6YA 4CMIB 4YLEA 4I6EA 5K2MA 4F7DA 4ZIRB 2FRXA 3COYA 2H2FA 3D5EA 4FUTA 4ETWA 1EVIA 5CA0F 1X92A 2OHFA 1KSJA 2PXHA 4KQ1A 1X14A 1SURA 1TEHA 4ADSG 1HUQA 1LPBB 3T4PA 1MHTA 1OV6A 1ZITA 1TO2E 2XAUA 3C14C 2ANCA 3D64A 3TNFA 3LPNA 3WK6A 3I83A 1DBQA 1GYPA 3U0BA 1OYYA 3D4IA 1N6RA 1KYYA 1Z6TA 3R2JA 3RO7A 1HE2A 1SMKA 2BM8A 2WHYA 3WAGA 2VHUA 4QEZA 3WB2A 3LQKA 5D6NA 4BLWA 3AVXA 2LDXA 3H4IA 4HZGA 2J3EA 2PX4A 1SCUA 1QFZA 3KFVA 1DP4A 1WNTA 5C1DA 3D2CA 3MXOA 4U0KA 3H5OA 3QG1A 2XODA 1I2AA 5IVIA 1YACA 2I91A 2GPYA 3EBLA 4CM7A 4NU6A 2WYIA 1NNLA 4ZMSA 4K87A 2PXXA 2AJ8A 5FTNA 3KETA 1DO0A 3DZ8A 3OTQA 4GPAA 4MGZR 1D7AA 4ZGBA 3G2MA 3KKPA 2QUHA 2GPAA 4QDKA 4R0MA 2B2CA 5CLGA 1CQJA 4HWRA 3QZUA 3CUYA 3A0UA 4YVFA 3S8MA 4W9NA 4DEVA 1N2XA 2E37A 3NHSA 4HUQB 5JARA 5H9VA 2GNAA 3HCAA 2RGGA 3O2SB 4ZO9A 4EEKA 2WIJA 1V25A 5SZIA 3S29A 2ZGVA 5AT1A 1KE2A 1BHSA 4XB6B 1BO6A 3AVOA 2I4OA 2CMFA 2R6CA 4OHXA 2HU5A 3Q9SA 4O2LA 5BVHA 5F51A 4INJA 1NW5A 4QFBA 1BKYA 2F48A 1Q1NA 4UCFA 5AUOB 1DV2A 1SCDA 4GBGA 2DUNA 1FNCA 2OM2A 3SZUA 4CHTA 3IP9A 4RESA 3UYKA 2D0OB 5EMMA 1MH9A 2WIFA 3UOGA 5C7YA 3QFCA 3EDCA 3B53X 3EY4A 3O5AA 4A0SA 1KBOA 1ZGCA 3VO8A 3WRWA 4CF6A 2ID9A 3H5AA 1WCXA 4A92A 1YOBA 4N5LA 4CI9A 2XNHA 1T9CA 3QSYA 5FQOA 3ZHZA 4DUYB 5BSHA 5C7LO 2JI7A 3NV9A 3T5CA 4LWPA 2BSQA 2GS9A 1X7XA 1Y8AA 1GLNA 2W71A 2IEBA 1ZD5A 3A9RA 3MWDA 4OAPA 5B6JA 3TD9A 1F2VA 3EDQA 4LMAA 2D1QA 4F9FA 1EIZA 1LTQA 2O3TA 2F3RA 3G5MA 3IERA 2BGRA 3EASA 4Q9JA 1RS0A 1XCLA 4IGFA 5DHSA 3U3RA 2QX7A 5J47A 1H2WA 1N2HA 5EWMA 1UFOA 2TYSB 2JHCA 3UMMA 1PWZA 3BXFA 4QT0A 4BTLA 2QMQA 2GJ8A 3LKDA 3Q9NA 3VC7A 1UKBA 5DPMA 3H1FA 3O8LA 1NMZA 1K6IA 3SBOA 3HHEA 1J0BA 5FBQB 2DVMA 2BFBA 5LQUA 1WF3A 4RV5A 3UPTA 4OREX 3RRSA 5CX1B 3H2ZA 4OBXA 1NUQA 1FS5A 3UATA 4EYKA 3VC3A 4QQFA 3D31A 2XJ4A 3DW1X 1WMAA 2ZBGA 4WFJA 1BIFA 2R44A 3H9EO 3H2JA 1AHHA 2QGZA 5I7SA 3O3NB 4QYIA 4NSNA 2DPHA 1L5YA 4XR4A 421PA 2ZB7A 2V1XA 1NW7A 1U1CA 4UUNA 1N7IA 1Z33A 2OUKA 2CT8A 2GF2A 3AFHA 4JBHA 1XMOB 4GMDA 3THRA 3C6BA 4KQJA 3RD5A 4WLEA 4BZXA 3GDOA 3MTBA 3NIGB 3T99A 2PMFA 2WKQA 4OEHA 3CISA 4WK4B 2CXSA 3KL4A 4LAFA 4LXHA 1U8ZA 4G8DA 3X2SA 1V95A 1C30A 3BXZA 4AWBA 4TKMA 1HQKA 3LLCA 2FPSA 3SMVA 4PLVA 1JHXA 2ZSDA 4RF4A 1XZHA 1JFRA 2ZB4A 4A8HA 4DLLA 2HIGA 1KWGA 1SR8A 2D4HA 3BHIA 1TJ5A 3G5AA 4RE5A 4MW1A 3ONNA 3W5BA 4FMCF 4TXMA 3RIEA 2GMWA 3EDRA 4ZI3A 3FM9A 5JNWA 1KNXA 1Z7WA 3JAKB 4MRAA 4NESA 5AO9A 3SXUB 4W1QA 4D3DA 5C5CA 5HKBA 4PG7A 4FNMA 1N9ZA 3ROMA 2BMAA 2W22A 2ZRFA 4J7UA 1BRMA 4TYPA 5F7JA 5MGBA 2O52A 4P8RA 3ZZTA 2HK6A 4OVKA 2ZIUB 1XQ9A 2JFYA 1C0KA 1QOZA 1YI0A 4RJJA 1Z26A 1KKLA 4I8XA 3K6JA 4HLCA 3NAQA 3QBTA 4LHSA 4UVDA 2F9FA 1UK8A 3AF3A 1XP8A 3K6SB 3JWHA 3EFOB 3T3GA 2AR7A 4D8UA 4DNOA 2VEOA 1K89A 5DYYA 5IRCD 3VJRA 4YRDA 3T3NA 1U31A 1HV8A 1Z7GA 3H1BA 1U1DA 1YRHA 4FFBA 4RTSA 2QTCA 3FIUA 2I2AA 5I7WA 4HNGA 4KAAA 2V4MA 1XCBA 3JYQA 2B5WA 5ALMA 2EJVA 3OO1A 5EPOA 3E1GA 4DUGA 4X94A 9LDTA 4WESA 3KO8A 4GC9A 5C1IA 4DUGD 4LQDA 3PHGA 2P4UA 5FFMA 1YC5A 2QAGA 1L5FA 3CZ4A 3EZFA 1SVKA 3GRRA 4KO3S 5E2AA 5BN4B 5IPFA 1J99A 5IM4F 4XWAA 1KOGA 4PY2A 3BGWA 1VM6A 5B7NA 1Z3IX 2RARA 3T34A 2VHTA 4FDUA 5HX7A 3F67A 4U9UA 1KZGB 4XVRA 3B70A 4A0QA 4FYHA 1LPOA 4JENA 1Y5NA 3P9SA 4RCZA 1YKSA 3MS2A 1KP2A 1PGQA 4ZARA 2BEVA 3ENWA 1KP9A 2ZU6A 5LD2B 3I04M 3C3MA 3CEJA 4C06A 2OYSA 3MJSA 2VRWA 1JHUA 4NHOA 4RF3A 1LBEA 1W88A 3PKJA 3WS7A 2H5EA 2Y1OA 1UWCA 4KQMA 2BE7A 5AW1A 1FXSA 4IIEA 2H9IA 4PCLA 4QUEA 3LY8A 3GO4A 4OX9Y 1DEHA 3G1UA 2BHTA 5MN5A 2XXJA 3JY6A 4ITUA 1JQDA 3PX3A 1IQRA 3R4CA 5E0KB 1MQAA 1PVDA 4NARA 2J3LA 2I2CA 3WBFA 4BFYA 4AU1A 4MPJA 1K2WA 1QAQA 3ZW8A 4EF5A 2EL7A 2Q3BA 4ZOLB 3ZK8A 2APJA 5LR6A 4MMYB 5TIIA 4LF5B 1C7QA 3GG9A 4QDTA 1R0RE 2F3QA 5ALUA 4E7OA 4V39A 4NZZA 4ND3A 2O5EA 1T2EA 2EP7A 3RSLA 4K2AA 1RKXA 4G09A 2F6RA 3OMLA 4EPWA 4ZJZA 1Q91A 1IAVA 3EIHA 4BX8A 4EEZA 1KAQA 3HK2A 3FPJA 4I08A 3A4YA 2GZAA 2XKJE 3A2NA 4RANA 3JQBA 3L7YA 3Q6MA 4L8WB 4ZOEA 1YFZA 4HDQB 5J2TF 4RTJA 1BH2A 1TAGA 2HMVA 5SYAA 1EP3B 5ALOA 4JP5A 1BD4A 1RWPA 2YV5A 3JATA 3R6TA 4GG1A 2E4UA 3TTWA 3UCEA 1W4RA 4OAQA 4P86A 4DCGA 2XCSB 1SD5A 1GQ2A 3AL0C 3I9NA 3GPBA 4UVIA 4D92A 1ILWA 5EY5B 2OGZA 3MD0A 3TDNA 4EHAA 2JFUA 3Q0IA 3TRJA 2HJHA 3ZJUA 1J8YF 4ZDWA 1ZPDA 2AXPA 4YN3A 1ZINA 1Q2XA 1R37A 2P9YA 3M5DA 1WTCA 1AQIA 2PL3A 2ZAYA 4HGPA 2FSVA 2PFGA 3N3BC 4UU0A 4YS6A 3SPXA 1GZ4A 1A8IA 3P5SA 1NF9A 4UVHA 2CZGA 1ADFA 1G7TA 2IJGX 5FJIA 3STUA 2B1IA 4MI1A 4KYUA 3ZD8A 2NVWA 2BGWA 5U1PA 4ZJYA 2ZCJA 3K1JA 1IXSB 3SKYA 4JR2A 5K51A 3PEYA 3GUYA 3KZNA 5BURA 1F38A 4Y1GA 3HVRA 4PLTA 4XX0A 2O23A 3UKOA 4F4CA 3GEDA 4TKLA 2XUKA 2I5PO 4AY4A 2XXBA 2FW1A 2NT3A 1IIRA 3GB9A 1F4PA 3H42B 4FKZA 4MK4A 5CP8A 4CNQA 5B6PA 1U7PA 5HJ5A 3ZGNA 2ATVA 2PUEA 5C8VA 4UBLA 3AJ9A 2PX0A 4PX9A 1OZAA 1PFVA 1TKRA 2BR5A 3O9MA 4RWZA 1Q84A 3CNNA 2GYWA 3DZGA 4HPWA 4NJEB 2D0PB 3UGQA 2X3YA 3V4LA 4KCGA 3AIOA 1EXVA 1H9AA 2ZCUA 4MVWA 4JC4A 5BV7A 5J5CA 3CT6A 3SS8A 3ND6A 5DLYA 4MTLA 1T8PA 4KU4A 5K4AA 3PJDA 4JLDA 4EO4A 1JVNA 1Y1SA 2VDKB 3ZDEA 4OFZA 1EFTA 2ZRCA 5I9LA 3EY9A 4II7A 2JJYA 1DCFA 3WO1A 5BXQC 3DO8A 1VOTA 3DL2A 4A26A 3V42A 3NC4A 4MEBA 2QGNA 5JAMA 1LPPA 1UAAA 1QG2A 5TQ0B 5HIKA 4NAVA 2ZFUA 5EUQB 1MO5A 1YGYA 4XLZA 5FBLB 2VA9A 4FCTA 3AEKA 4TKZA 1OTHA 2V7QA 3C74A 1LVUA 4DT1A 3PNMA 2V7QD 1M34A 1NLMA 1L8AA 1TOAA 3WYCA 3C6ZA 3LBIA 3DE1X 1GPUA 3HKDB 5JJIA 4RO0A 4DIUA 821PA 3BTOA 1D2CA 1VJTA 1G2IA 4N6GA 1Q1EA 1AA9A 1USGA 2XYVA 4GWKA 1RDFA 4Y2SA 3WGYA 1AKQA 2DKFA 5DYTA 2OD7A 2PGJA 1YB1A 2G6BA 3WLRA 4GOOD 1B41A 2OHGA 4D4GA 5IP5A 3R6WA 3ZG6A 4G1MB 4PZUA 3UANA 5JAIA 1V2HE 4ZVUA 1T1EA 3KOMA 4AJOA 3O6VA 3UY4A 1RKBA 4EJSB 2CNNA 4X85A 5LQNA 3ZR4B 4PO3X 2G80A 5K6RA 3DBVO 4DMGA 4AURA 1AV6A 2XMDA 3IM3A 3AL3A 1RHRA 1QF6A 1CF4A 1E8MA 2I4IA 4EHBA 4IDGA 5K01A 3P52A 2ZT7A 3HH8A 1LS1A 3A9CA 3H18A 4WNAA 3T95A 1VLQA 2RH5A 3I23A 5FBZA 5FPKA 1TF2A 1OH8A 4EWLA 1GCAA 1SHLA 2MINA 1K68A 1C8LA 2GK4A 3M4YA 4OF4A 4YT5A 2CV2A 4YAFA 4RYLA 4ZYWA 2PJRA 3STYA 5GY7A 1RU3A 1H66A 3LKBA 9ATCA 2RGCA 4NBLA 1QSGA 1S3GA 2AK2A 2GZRA 2JZNA 3TQHA 5AJWA 4U9IS 2JGEA 4F7WA 2QAJA 1CYDA 1UR5A 1NONA 1ODIA 3A58B 3I9KA 4QTXA 3V7YA 5LVAA 3HXMA 1JDUA 1KIAA 1SCAA 2V6GA 3TQQA 5IDXA 4UCWA 2DE0X 2JHFA 3OPVA 3PFGA 4L9WA 3V3TA 4XFKA 5JSZA 1HLFA 1YZHA 1W47A 3CF4G 4N3CA 5K8VA 4IUYA 4J1TC 4YR7A 5E7MA 1VCHA 3LHDA 3LX5A 1D8AA 1UM8A 4RHYA 2RHGB 5AW2A 4QTUB 1MGPA 4BUCA 3PFWO 1NVKA 2XUGA 3AQIA 5KNLA 3MM4A 1G3IA 4UHHA 1UMBB 2WB2A 2EGUA 3C70A 4RTNA 1E1QA 4QRDA 2WUEA 5YASA 2Z4TA 3OWHA 4WT7A 1E1QD 1FDIA 1IWOA 2Y4OA 5AKJA 2H3HA 4MB6A 1H9BA 3H2HA 1Z45A 4K9NA 3UXEA 4MRPA 3NUQA 2JLXA 3T1OA 4MMZB 4QBFA 2VH1A 4YCNA 3GLHB 5BN3A 1QV9A 3HJGA 4YAKA 3OT1A 2ZTHA 4U4AA 3KELA 2VF5X 2WTXA 1X0VA 1EFCA 2VQ6A 3LLVA 4U02A 2IYTA 3LWNA 3ZGOA 4GPBA 1CRZA 4KIFA 3VR5A 3ACDA 1SUAA 1S1MA 3MCVA 4G9BA 1VB5A 4KAXA 4Q47A 2H59A 3EDMA 3RKSA 4EB3A 3W5DA 1NDUA 3K0FA 5AHOA 5TF0A 2X8BA 1H1LA 5JPIA 1RQ7A 3EULA 2ZR0A 3QLUA 3WWOA 2M98A 3T4XA 3S81A 4UE2A 3L8HA 2GK6A 2VJLA 4G4GA 4Z4FA 3CF2A 1F60A 1E63A 5KI6A 3QWBA 2B4KA 2IEDA 1Z6PA 3QFYA 3IO5A 5JNLA 3H97A 3TSCA 2R60A 4D99A 4GNRA 4JB3A 3K4HA 2NTYC 4NX2A 4HAWA 4BLTA 3C48A 1ZGZA 1P91A 2NV6A 4DCNA 4NECA 1XDSA 4NK4A 2NQ2C 1C3OB 2NSJA 2X8AA 2C4NA 4C89A 1THTA 1X19A 4YCBA 4ZRNA 1HMYA 1SVSA 1PJCA 2H31A 4OBEA 1B73A 3RUEA 1OH7A 4RLFA 4LOAA 5I5GA 4F6RA 3HACA 3VMFA 1XZJA 2OKCA 1MRNA 5ES4B 1C7EA 4P4GA 4M8NE 1BA3A 2NZ8A 2C99A 3TNYA 1ZD4A 4LKRA 1E8NA 3RSHA 5HM6A 4MO2A 4ZOLF 4BNTA 4HX2A 5A9SA 4PXSA 2OXRA 1U0NA 3QE3A 4BLPA 2VJYA 2C9MA 1XELA 3GOQA 3SYKA 3FTFA 2AJBA 2HU2A 5FA5A 1GM5A 2ALJA 1OYOA 1YJXA 2HKIA 3ONVA 3PIRA 5LL6P 2KLHA 1U2QA 2CBGA 5A5FA 1JQEA 4LY9A 3I6BA 1JMYA 4JV5B 1T5LA 3TE6A 3PDHA 4X93A 1A1VA 2C4MA 3M5WA 5B57C 4M0DA 5E9JA 2FPIA 3KJXA 4R9SA 3SK0A 2H8GA 4FR5A 3KC2A 1OUMA 4GZMA 1RAGA 4FD3A 5LQDA 1GL9B 4LE2A 5DLEA 3K4PA 3OQPA 2BM0A 3LHFA 4HG2A 5JZMA 5LD2C 1E59A 3EN0A 2QD5A 2WJPA 2F9LA 4YRZA 5BT9A 1RJ9A 2VCEA 1VHQA 3I2YX 5AIBA 5J43A 2WWYA 2JHAA 1DLIA 3E2MA 4UATA 1N7GA 4UMVA 5KHLB 5EIBC 5A6VA 1SEVA 4DNPA 5IFLA 3AUXA 7ABPA 4M60A 1OPRA 3LMKA 3PCRB 3QVKA 4D6XA 2R0QC 1QDEA 4QGAA 2G0TA 1K8YB 3VUFA 1I2MA 2OO3A 2PUGA 4MB2A 2Y0DA 1JXMA 2BONA 4C4YA 5LMUB 3DG9A 5E9QA 2ID8A 3V80A 1DINA 1ONNA 4IJVA 3W9UA 4P58A 1QORA 5T8KC 3WK9A 4E08A 1LBIA 1W1WA 3P9XA 1CVRA 3ZX5A 3IOEA 1ULSA 3GGJA 1XZBA 4BIIA 5BSTA 3Q5DA 1XZEA 1N0VC 5AVXA 3ETGA 4RKEA 4KXMA 2PV7A 3BD9A 5HTOA 1PJBA 4I50B 4ACBA 3U7HB 2AKEA 2ATCA 4MW0A 4LYHA 3WV4A 5JISA 3P32A 1NNI1 5FRDA 1XXHB 2IYXA 3TBKA 1A2QA 5FTJA 2A0WA 3PGA1 2DYKA 2ZI9A 1Q1QA 1JPNA 2O7RA 3ABRB 3PDUA 5DXJA 2V74B 4YRLA 4WWHA 5DYNA 1JIVA 1JG2A 1XMXA 1E89A 1CJBA 1ZK0A 3L8GA 4XWTA 2GA8A 4U3JA 1GG8A 1Y3HA 4FBMA 4A15A 4G0MA 5H3LA 5FPPA 2IY8A 1XTSA 4RZSA 3WICA 4AYXA 1I4EB 1JIXA 1G0OA 2C57A 2WRZA 3EGXB 2CKMA 4ALLA 5JT1A 3LG2A 3FKQA 4N9WA 4PQRA 2D5AA 1XTZA 1W93A 1JQBA 1ZUNB 1G7RA 2CSUA 2LWIA 2XDQB 3D6VA 4PPYA 1CS0A 4N6OA 4LOJA 1WSDA 1UBGA 1Q11A 3LXXA 3K9GA 2BEUB 3MELA 3MT0A 2WB4A 1V3TA 3SHTA 2QF7A 2W0MA 1CUYA 2CV1A 5CDYA 4QTZA 4WJZA 1PJAA 3IEPA 3GFOA 3MJDA 4ENUA 3KD2A 2B0CA 1G98A 1K3UB 3WWCA 2BFDB 3A4VA 3QSGA 1SWWA 2I2BA 2WMNB 4WBXC 1J8VA 4I4IA 3VKGA 4TVKA 4INZA 1T3TA 1V5EA 4YEDA 4EPYA 2ORWA 2X2EA 2FSPA 2VI5A 5KTRA 2WD7B 3AVVA 1Y3IA 2ICAA 1JGTA 2V45A 4QUDA 4RQAA 4LBVA 3TM4A 2M32A 1R6UA 4JELA 3K71B 1Y3FE 1QCDA 1SIBE 4CF5A 3KEFA 5EIAA 4NMWA 1Y1PA 2O8NA 1WETA 1E4EA 1I1HA 4CDGA 4OHRA 5TMEA 3GHYA 5ECYA 1UANA 3NQ41 2HA6A 4PSDA 4PYNA 3E5MA 4FB4A 1SVIA 2WUVA 3VAZA 1QB7A 3QEKA 5A4FS 4C4XA 3LUFA 3L6EA 1FCJA 4INOA 1J2EA 1IHPA 4RPLA 4ZT2A 5K9ZA 1IN7A 5DWDA 3K16A 5M3BA 3IHKA 2CF5A 3NEPX 3RS9A 4MV3A 3KJEA 5JRDS 2PT6A 1WA5A 1N75A 5DHUA 3L1VA 5B58T 1J8QA 1G6OA 5EIOA 1SKQA 1NV8A 2G4CA 1UBEA 2CMDA 3O7MA 3DMNA 3HBFA 2OFFA 3VZRA 4B83A 4DN6A 1J24A 2IP1A 4OXRA 1F7UA 4D80A 3LLMA 2H1IA 2JDIA 4GPEA 5BWOA 1CY0A 1RBZA 4NLLA 2JDID 1FFSA 2JVJA 1F2UA 1K5HA 1U98A 2G25A 2ONYA 3OTIA 2C7OA 3T9DA 3AIMA 2EERA 1EGAA 1JNXX 2LW7A 5HR5A 2QAIA 2HWXA 4RSMA 4Y0AA 4NBKA 1GKLA 1TU0A 3WLFA 2PEYA 5DGHA 5AM2A 3CE9A 1G2OA 1U04A 5LKRA 4HXYA 4UTOA 4Q01A 1RZRA 3QE0A 2DCUA 2ZE8A 3USES 3WWYA 4DARA 2OP0A 1RZRD 3KT3A 2F8MA 4OU5A 3NCHA 5EXDA 5WRFA 2JJ2A 3HXPA 1BCSA 4HGOA 5E4JA 5ALXA 2P65A 1COZA 3P2EA 2JJ2D 3JQ9A 4QNMA 1QRTA 4MIYA 1OI2A 4ND8A 1U90A 2IPLA 3KJNA 5A4MS 2JGLA 4JUCA 2B98A 3L5OA 5CX4A 3LQ4A 3CNLA 1CULC 2HMSA 3DSRA 3BJEA 4J43A 5SV2A 4AN0A 5H80A 3IXMA 4W6QA 3KP1A 2XNDA 4TYMA 3SSAA 2H1RA 2W4MA 3EFBA 3OPYA 4P93A 5U4QA 5I6DA 4IM7A 1FTSA 4LJ6A 2Q45A 3RC7A 3EPRA 2BFFA 1H2YA 2PKXA 2J9XB 4U2GA 3JQGB 3IKMB 1FXWF 4WBSA 4MITA 3UO8B 2J8ZA 4B9EA 1AKNA 2A35A 1RD4A 4MVJH 1KK2A 1A9SA 2BEWA 2NO1A 2B3DA 2QKYA 2WZBA 1F5SA 1ONOA 2R8PA 4MZXA 3V9AA 1E1RA 3MLBA 3H05A 4FSHA 5JNVA 3HVHA 3LQRA 5ILQA 1IOVA 3NYWA 4GGMX 3S2UA 2DSTA 4X1KA 4ZK6A 2TMYA 1YSCA 2FWIA 5IYZA 1C7ZA 4HNQA 3JTEA 4QUAA 3ZIAD 4D9BA 4L51A 4QVIA 4FDLA 1TUBB 1YBAA 1QRRA 1EFPA 1V96A 3KCQA 3R0JA 4MKIA 5NLLA 4QGBA 4DIMA 2F00A 5KYWA 1UPFA 1WQ4A 2YW2A 2BFBB 2CE7A 1Y6RA 2AFIE 3W6OA 1NWCA 1JR3A 5KTSA 2QVBA 2WD8A 2PSSA 3KUDA 3X0DA 2B25A 4OIFA 3HBNA 2GFQA 4FR2A 1JR3D 5M7EA 5ELXA 4B33A 2PT7A 3UMJA 4EKIA 4ZP3A 1NA5A 2ENUA 1YK1A 1CWUA 3WP1B 4BQQA 3FOWA 3TTVA 1DOAA 2PY6A 1XKLA 4X62B 4R1TA 3WHPA 5C4GB 2GN4A 3TIGA 3CXUA 1WZEA 4N7JA 5DTQA 3GLHE 4J2TA 3H3JA 3BWEA 2ASVA 5L3QA 4TUYB 1T9GR 4POOA 4U7GA 1A8UA 4PCUA 3FHJA 5J1TB 1SBIA 2RONA 1Z39A 3RTGA 4QFDA 2VZEA 2A94A 4RVHA 3NVKI 4HDAA 2VPZA 4D57A 4S04A 1DQSA 3I6YA 3NDIA 3O0DA 5IN4A 4UHCA 1RYNA 1IN1A 4LYYA 3DF9A 3SR4A 4U39A 3M3DA 2Z2JA 3UG7A 8ADHA 1SUWA 5IJZA 5DNYB 4WNYA 1CJVC 3T0GA 3N87A 4NQZA 4BFSA 4HXFB 3M4XA 4BQIA 5L8VA 3AFJA 2OA0A 3DLBA 3G02A 1U3WA 1NQVA 1W5TA 3EZGA 5F4BA 3IX7A 4BMDA 1CUAA 3GGGA 1Q19A 4CGYA 1K06A 1IZ8A 2H9AA 2VHVA 4QE3A 5IS2A 1WZUA 2BZSA 4YMWA 3ESCA 2GXQA 3Q7RA 4ZVNA 4UJ5A 3L04A 3IVCA 4K9DA 1X7WA 5HFAA 4C5AA 5CFLA 1LB1B 2CWDA 1EWQA 2E87A 2G36A 3UK1A 3NALA 1L7EA 2H29A 3A06A 3R3YA 4PBRA 3BFPA 3JX9A 2D0IA 5BSRA 2O8DA 2GPWA 5JQGB 2PRZA 4AYWA 5ECGC 4MGEA 4FGKA 2GJAA 3ELWA 5ESXA 1EK0A 3WSWA 1G6KA 3CLVA 4LQ4A 4OK3A 3OZDA 4LDJA 4BZWA 4I50F 3MTDA 2PL9A 1IDN1 3FZNA 5KYYB 1FFEA 1XEXA 4RGQA 4WESB 2K9QA 3C6YA 3ZGZA 4Q24A 1U2PA 3AV3A 5JJLA 3RTDA 3TEJA 4O8ZA 1R9JA 1R12A 3I72A 4FYVA 1P74A 2PBRA 3A4IA 4X7PA 1BMTA 5IBQA 3FZYA 1X80A 4EO7A 1G8KA 5AVUA 3L43A 3ZJYA 4YPOA 1B26A 3RBVA 4UVEA 5FWDA 3RROA 3CG0A 3L7JA 1G66A 1WABA 4MP3A 2XYHA 3L1IA 4F2WA 2OBXA 3UCXA 7REQA 4K8OA 2A67A 2HTEA 4R0NA 3FMPB 1GNPA 4IQ8A 1XNQB 4I99A 5D51S 1HZJA 2O2HA 2PIDA 2XVAA 2QRKA 4FGLA 4OPMA 4AVYA 3FMIA 4FQ5A 1GXSA 1MQSA 1CUEA 1P6XA 2LDBA 3PHJA 4MKFA 1Z3CA 1XRLA 3SQNA 1QUEA 3RKUA 2WOJA 3WGTA 1KQ3A 1MC4A 3TQFA 4UFPA 4BCDA 2EZUA 2H08A 3FX2A 3AX6A 3NNSA 1IJBA 1V0JA 2EZTA 3DVLA 1N1DA 3ED5A 3GVHA 4Z9XA 3QNUA 1OW3B 3SC3A 2WSYB 4QLOA 2G9VA 3KDAA 5DWVA 2G7MC 1AQJA 4I1YA 1YQTA 4LHEA 4EVRA 4JFRA 1ZIXA 4MGKR 3K0SA 1O58A 1HQCA 2ETXA 3GK3A 4RY8A 5GONA 3A6KA 3JXEA 3LK7A 5LDDC 4BN0A 2DSNA 4QSMA 4A2WA 4DIEA 2IBTA 3QLEA 5DV9A 2VAWA 2VP0A 1P39A 2VIIA 4D4JA 1EXWA 4FYJA 1W6UA 1QP7A 6NULA 1F1JA 2VN8A 5K4GA 3JATB 1PCXA 4UBMA 2J30A 5EGSA 1FZTA 1FFHA 2DUUA 3NDJA 4ZI7A 3OUTA 4CT4B 4J07A 5E4FA 2PD3A 3W6PA 2KLBA 4O2BA 4DCUA 4CEHA 3QY0A 3SEQA 4W9MC 4IYRA 4ML3A 5CXQA 3LVBA 1S2OA 4WY2A 1KQNA 2IE0A 2G8LA 4O33A 3S2SA 3WQSB 3Q3VA 4NEQA 5C81A 4MWOA 4NENA 1MT3A 4N76A 1IM2A 4KXYA 2BI8A 4ZPXA 5TT0A 4YMTA 3RCBA 2BFMA 4A7PA 1VL8A 4PZZA 3WYFA 1VKHA 3DXYA 2CB9A 2Q27A 1GPYA 1Y4DE 4RIEA 2CMHA 4TKVA 5CCEA 4MPPA 3A9WA 4LJRA 2JFOA 3NBYC 1XIVA 1P1CA 3CMMA 2VEDA 3IESA 5HKOA 1MKYA 5JS2A 4B3BA 3SDZA 3SNKA 3VPXA 1GYRA 1N6IA 1U6KA 5JZOA 3MEQA 3EXAA 3F78A 2GZMA 4ZD6A 5TB5A 5A0TA 2HQSA 4WCFB 4LXXA 5BYKA 1RAIA 1FJHA 2ZAMA 5C37A 4OQLA 4I9NA 1JSXA 1A2BA 1E3QA 1E0JA 1X9HA 4K26A 1KO4A 1K92A 4HLUC 4Z0PA 1BOFA 1YJQA 4JJZA 2YUIA 3G2LA 3R7FA 3A2MA 5JI2E 2W6CX 4KYIB 4KR3A 4BMVA 1XP5A 4IXMA 5DBIA 1JL3A 2FWJA 4DSUA 2A3RA 4PTLA 2PMBA 3CPJB 3DDCA 2QVZX 3SQOA 2L42A 4NDAA 4TN5A 2WJ4A 3UC5A 5EUBA 3WLEA 2D7DA 4Q4CA 3C39A 3CZRA 3OPQA 1FUYB 2IOHA 4FDTA 3VGJA 3VX3A 2ODTX 1OPXA 3D3QA 1QO7A 2P9ZA 5A3JA 1EK2A 1XKQA 4Y9RA 4ALNA 3NRCA 2X58A 4J16C 5JJKA 5JFTA 4X41A 4EMSA 1ZO8A 2W2OA 3ILHA 2O48X 3VR6A 5FX2A 5IEJA 5F77A 3JAMA 2H63A 2PLRA 3D8HA 3E82A 1UBFA 3UJCA 3VR6D 3FOZA 3ABZA 1UJCA 4FNOA 5FOTA 1VRCA 4UNSA 3GW8A 3EOZA 4AUNA 5AVVA 1E9SA 1PR2A 4UDXX 3USZA 4BGDA 4M8SA 3LOPA 4RKFA 4XFJA 4CNBA 3NI2A 1W0CA 4XPIB 1H4TA 3C3BA 4MP8A 2BMWA 5JEDA 1OKKA 2PXAA 2FPKA 3T9EA 2FR8A 4BIMA 1ULZA 2L2QA 5I7HA 1UODA 2CL5A 3MTGA 1FP6A 3WJAA 1Y5IA 2HIAA 1N2CE 1OA1A 2X0FA 2DWPA 4YCDA 3BULA 1E2DA 4XQCA 2CUTA 1GFWA 3T7CA 1Q77A 2F3TA 4S2UA 1E2BA 3ZE9A 4RF2A 3DVRX 1DBWA 4AZVA 2O2EA 3DZBA 4LRYA 2H1OA 1M2FA 3WMFA 2NXCA 2FU5C 1TU3A 4FKBA 3PFCA 3WAKA 1P5FA 2FMIA 1R8QA 5K6TA 3VNVA 4Q3NA 3IQHX 4X3OA 5ARCA 1HTBA 4WK6A 4XGRA 3RUCA 2P6RA 4WI1A 1VG0B 3M82A 4LG1A 1Q20A 3RYFB 5ALHA 3SQLA 4Q7LA 3K9QO 3KPUA 3DWEX 2QYTA 1VE1A 5ER9A 4DPMA 4UHJA 4BFZA 3ESBA 5B7GA 4DLVA 5JCOC 2DAPA 3H84A 3ZBPA 5BT8A 2VSYA 2M9MA 5KNBA 5DIZA 4WZAA 5E7IA 1M8KA 4YALA 5E8JA 3A1SA 4JKYA 4R8VA 2X7JA 4UMEA 4PNHA 3PQ6A 3VAAA 2UYHA 3GUCA 1KPIA 1IATA 2NU6A 1XUOA 5I4KA 5L4SA 2LPMA 3E7DA 4LYGA 4JJEA 3DVAB 3GZTB 4EJMA 3W5UA 2P30A 1K9SA 2JLSA 4IO1A 1TMYA 5HBGA 1ZISA 5BORA 3OLQA 1PGOA 2Y2VA 3H0EA 3VNBA 5JSZB 4XSGA 4D9MA 1JLLB 3VU9A 5J4VA 1JI0A 3HCBA 4LCBA 3MD9A 3A2LA 4R1NA 2XUHA 3L0YA 3HLYA 4C20A 3OAAA 3EHDA 1N0UA 3L4SO 5JMWA 1U63A 1WVIA 3EISA 1QUFA 1M7HA 3OAAD 4OYLA 3PWTA 2AQ8A 2IF0A 1U2EA 5CB6A 4C2UA 2BPOA 3RG8A 2JGFA 4MV5A 2XTMA 1C4XA 3CW2A 5LLDA 3GJ0A 5C32A 1AS0A 4LXQA 4YXWA 3ZH2A 3R74A 2HIHA 1HDIA 3VKVA 1DFGA 5L40A 1H4SA 1EQAA 4YXWD 5JQGF 4HN9A 4MEAA 5B3LA 3GLTA 2AG6A 2WABA 4ATNA 3M8KA 3PQ4A 1DTWA 1TDJA 5BN3B 2O4UX 3OT1B 4ETMA 1DO2A 2AMFA 3GJYA 4GX1A 1VFPA 3WBJA 1FS4A 3M3PA 1WQ3A 2AXNA 4AB1A 1EDBA 2R86A 4PFKA 1XV5A 1XAGA 4X6YA 3OZEA 3UGJA 4CIYA 1D4AA 121PA 3P0HA 4ECAA 4ZICA 3K0FB 5B7PA 3WLMA 2EGHA 3DZCA 2ZETA 3TVDA 3VSBA 2A9PA 1XNRB 3U3JA 1EWKA 3EW9A 1U5AA 4FTWA 2JBHA 2VTKA 5BMVB 2JS7A 4GLJA 3QXJA 2Z43A 4KXWA 3B6JA 4WY8A 1FTGA 3WO0A 3VDXA 1R6AA 2Y77A 2AVNA 2ODQA 3AUJB 2JANA 2V96A 1A97A 3HC7A 1NKSA 4TL7A 5F9FA 4XKJA 1VHDA 1ZSYA 4GPD1 4IFBA 1ZBDA 4QICA 1SCJA 3W8DA 5KTYA 1JB9A 1U2DC 4HUJA 2BFCA 2OBYA 3MUEA 2B5OA 3W8NA 3AJEA 3HCFA 3AB7A 1P0PA 1NVVQ 3N5CA 4YNBA 5B1HA 3TOVA 4U8HA 2GD0A 5TDHA 3AFGA 1FW8A 3DEFA 5AKYA 5EWJB 3QVUA 5AH0A 1G38A 2R2GA 3LCRA 4MR7A 3SFVA 1NUSA 3B82A 3H17A 1UBCA 2A5YB 3FKJA 4WA7A 4BNKA 1LNQA 1PV1A 3HVKA 3DUWA 3OQBA 3GP5A 3UQZA 1TADA 1SK9A 2QTFA 2IYEA 4NDZA 2IS2A 1IZ7A 1NRWA 1UJBA 1I0LA 4BEVA 1AS2A 4UJ3A 2ZM5A 1G1AA 1QH1A 1Z16A 1ACMA 3EGIA 3Q3EA 5JO9A 3GA0A 4C88A 1ZC4A 3QKUA 4N8SA 4F0JA 2PU7A 5FI1B 4LPSA 1UEXC 2HUPA 1ZQ1A 1ULUA 2IYYA 3L6OO 1KJ8A 4OFWA 2Q50A 4RPGA 1KY5A 5TC4A 2ONJA 4AYTA 4DS3A 4EA8A 3P20A 2VA8A 4TMZA 1NNSA 5E7QA 2IQ5A 1S8NA 5TVGA 4B4DA 3MTQA 1T2CA 4DXDA 1L1RA 2ORYA 4K6FA 1VE3A 2IOQA 1T35A 3HWSA 2GD6A 3C6MA 1VA5A 1N1EA 4DOMA 2OCDA 2YBDA 3B6MA 3AETA 4O0MA 2QSJA 3CPEA 2AE1A 4QJIA 2FPIB 4G0WA 2Z83A 3EXHA 2ZYSA 4Y2GA 2J32A 2OTCA 5DJ5A 1FYFA 1JDJA 4AS3A 3QKIA 3JWIA 2JGKA 3L8MA 3FI0A 1S7GA 3M33A 4HTAA 4L2IA 2I6XA 4PLCA 2JI8A 5CH5A 4N3BA 2FEKA 3NHPA 1RJ9B 2OVBA 1L4FA 3ICCA 4OBBA 3ZJ5A 3W77A 3AXTA 2C7BA 4FE7A 5CT5A 4DE5A 2I1WA 4UUMA 4J94A 1YZLA 3K0BA 2V59A 2YY5A 3LJKA 4LOLA 3WLIA 2ZBPA 4BLSA 4CT5A 4H08A 2LR0A 1B3RA 2IH4A 1QCYA 1E3DA 4BQFA 5IJAA 3U60B 4E4YA 2CLOB 3EE6A 3G1TA 2WAMA 2MSLA 5CPFA 4OJNA 1W4AA 2DOKA 3DA8A 3KG2A 5F9HA 2WR8A 5ESWA 1DJLA 1NWHA 1SA0B 5A02A 4A5OA 3ZGVA 1ORDA 4K7JA 3ECCA 2JBWA 1S3SA 4OI4A 1LH0A 1R0LA 1A69A 1X77A 4Y2XA 2C7PA 1HNZB 1V9LA 2QSUA 3C6XA 4D4HA 5FAXA 1KJIA 5AHKA 3UOWA 3RBZA 4HXEB 1GPLA 4REQB 3U0VA 3ODPA 3KJGA 2B94A 3U81A 4QGSA 3S4DA 4JBGA 2BKXA 5HF9A 4DG5A 1CZOA 5FNZA 4JVMA 2VZ0A 3IOYA 4H0CA 4U3JB 1R3UA 2EG9A 5LQKA 1N3LA 3DGFC 1WULS 3N05A 3NOQA 4I6GA 5LOVA 1O94C 2QP4A 1UZMA 3IDAA 4FQ8A 3W2IA 2IZ0A 1W52X 2FOXA 3OJOA 3M2TA 3DMHA 5JZ9A 3R5JA 5LJIA 1ZNZA 1GSHA 5CB0A 2ZRKA 1CS0B 2R8XA 1GCUA 3N59A 3F1KA 4GXRA 4LSGA 4D45A 1P31A 2VDMB 5CXXA 2VPQA 1LW7A 3OQIA 1KSFX 2JD0A 4D4MA 2NVUB 4Y0VA 1PFQA 4DJTA 5CA1A 2E5LB 4JYAB 4JSYA 3HB7A 3I30X 4WAUA 4ZU1X 2YN0A 5KYVA 3VR0A 2F2TA 3ZQJA 2V55B 1HWYA 5DNVA 4MS4B 3B7WA 3P4UA 1TVKB 3D6TB 2AOVA 1DC4A 1S0UA 2OCLA 2FPWA 2ZWAA 4GQAA 4HEA6 4Y2PA 2QMZA 4EQ6A 3EEOA 3LZCA 3TD2A 4OSPA 4KO2S 1WLYA 5ICGA 2RG1A 2JCBA 5CXSA 1O0BA 3NHKA 5T5QA 2JJMA 1PLKA 2PUJA 1GOTA 2AMYA 2IUYA 5AW6A 4C3OB 1HX7A 2RFLA 3Q7QA 3WDKA 4E6PA 5BW4A 4LWOA 1JDPA 1C9DB 4Z7QB 5AM5A 3T1NA 2O4CA 1W9MA 3M6MD 3PVSA 2IU3A 2DBRA 1M2OA 3KAJA 4EO9A 2BUBA 3QVMA 2GJKA 1WCWA 3NAZA 3NM6B 1NZFA 2X9VA 3KSDO 1E4EB 2OECA 4JX8A 4UHDA 3YASA 1XLUA 1E4VA 1MORA 1BVRA 1MJNA 1LI4A 1SH7A 1T6NA 1U8AA 2B78A 2HQOA 2Z58A 1NMQA 3KDSE 3B1KA 2VNHA 3OA0A 2G7ZA 2VXBA 4PC6A 5F73A 3S2EA 3T41A 1LK7A 3I62A 4ER3A 2C54A 1VPLA 5HZHA 4ENSA 5ITWA 3LY7A 1NUAA 2J59A 2VDQB 1ZQ9A 2Q99A 3E3MA 1I7NA 2EWWA 5EMHA 1Q7GA 3IV7A 3PDWA 1CB0A 1RE1A 3DTNA 1R8SA 1KVTA 4TLBA 4ENWA 4KVAA 4W5OA 4ZEOA 2X6TA 3M6VA 3S2FA 4P3NA 1Z82A 3WXMA 1MABA 3W5IA 3IP8A 4E11A 1KEEA 1H23A 5CCXA 1BGXT 4GZ5A 3MG9A 1JEYB 4BKPA 2EIXA 3NYRA 5DNDA 3TLEA 4CBVA 1RAHA 3UPDA