2CBGA

Crystal structure of the pmsf-inhibited thioesterase domain of the fengycin biosynthesis cluster
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
210
Chain Sequence
SAAGEQHVIQLNQQGGKNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITEIQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITADLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGIQTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNILDKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Thioesterase Domain of the Fengycin Biosynthesis Cluster: A Structural Base for the Macrocyclization of a Non-Ribosomal Lipopeptide
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords FENGYCIN SYNTHETASE
total genus 69
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.40 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 2cbgA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cbgA01
3TJMA 4X71A 4C01A 1G42A 2WQZA 4N8DA 1XLUA 1TCAA 4YPVA 3IUNA 4FKBA 3ZLUA 1CUSA 1JI3A 2OGZA 1MPXA 3QYJA 3A2MA 3DOIA 1EB9A 1BN6A 1W75A 5ALSA 4YK7A 2I03A 2RONA 1Q83A 3QPDA 4UFOA 3NGMA 4BBZA 3WYDA 3QPCA 2XMRA 4OB6A 3OPMA 4B84A 3O9MA 5JALA 4HRXA 2BCEA 1J1IA 4FDMA 3CN7A 4I3FA 3DD5A 2XMZA 3WJ1A 3FBWA 3R3UA 1UWCA 4IHAA 4UBIA 4KAJA 4Y2YA 4N8EA 2J3DA 4H0CA 4DGQA 3DL7A 4HXFB 2JGFA 1OXMA 2VAVA 3C87A 4K5QA 3RK4A 5A7FA 1UOQA 3F97A 1EVEA 2CUTA 2WIKA 3W9BA 3KSRA 4BZZA 4UHEA 2FX5A 4B81A 2I3DA 5E4YA 1N5RA 4INZA 5ALEA 5DNUA 4EUSA 3VVMA 2HFJA 4B7ZA 1LLFA 4Y2VA 2HU8A 1YR2A 2OAGA 1IUOA 1TKRA 4RNCA 1LPPA 1NU6A 5JZBA 1AKNA 2HA7A 3I6YA 2GBCA 1F0NA 2RI6A 5AO9A 1W1IA 2WJ4A 1AGYA 5ALNA 2GYVA 1N5MA 3IB3A 1XRNA 1ZJ5A 3EF3A 1QOZA 4C4YA 1QIHA 5HZGA 2XQGA 4F60A 4IH1A 4IH9A 2W22A 4CG3A 2AXEA 5FLKA 5K3BA 2V96A 2XB6A 4GDMA 4W1RA 5ALMA 4KE7A 4WFIA 5AI6A 4Y2PA 4HRYA 1OILA 4RE5A 4J0GA 3L1JA 2QR5A 2IX9A 1THTA 4BC0A 3V1NA 4X93A 1XRMA 2XMDA 2RHTA 2XI4A 3WKAA 3BE8A 1J06A 2WHQA 3FYTA 3WJ2A 2XUJA 3UMJA 1TRHA 1UOOA 2DSNA 1YA8A 4EA6A 2XMSA 1DT5A 5C8VA 5ALXA 1XQXA 1WB5A 1CPYA 3DKRA 3W06A 4BVLA 1XZBA 2WHPA 1ZGCA 4OUKX 4UBNA 3BF8A 2ZVDA 4P92A 1EB8A 3S8YA 1JMKC 5AKLA 4ARBA 4DNFA 1WB6A 5DYTA 2Z8ZA 1PFQA 5EIEA 3GUUA 1GPNA 1AQLA 5JZ9A 4EY5A 1CUUA 1EVQA 4BB0A 2DR0A 1XZHA 1WHTA 5AOBA 1FSSA 2HA5A 3O4JA 1DX6A 1KU0A 2AJLI 5CTAA 2GBGA 3ILSA 4BCDA 2QM0A 1CQWA 4XJVA 5FDFA 3I6MA 4WDQA 4AN1A 1SOMA 2WJ6A 4KR0A 2OGTA 3A2NA 1ZI8A 4B85A 3WQHA 4MXDA 3V1LA 4UFNA 4CI9A 3JYHA 4X97A 2QUBA 3R3XA 2PVSA 3F9CA 3SK0A 4Y2RA 1QIMA 1SFRA 1JMYA 4I19A 1BCSA 2WFLA 5LKRA 1Q0ZA 1P0IA 3WA6A 2G5PA 2OCKA 3TEJA 1H2ZA 2HRRA 5K3FB 5AIBA 1EDBA 4CCWA 1ZD4A 2QOEA 3QITA 1XZMA 2XT0A 3H2GA 4AO7A 4XWGA 5T4EA 1XRLA 3ESDA 1WOMA 5DWDA 2VEOA 1JJFA 3WK9A 5LZ4A 4J0IA 1UKCA 1Z68A 2C5FA 2ECFA 5AH0A 4E11A 2OGSA 1OCEA 4KEAA 4P08A 3ESBA 4UHDA 2XQIA 4XVCA 2Q0XA 4OD0A 3WKBA 4H7EA 1JJIA 3C5WP 3G7NA 1Y7HA 2JGJA 1LZLA 4BC1A 5DNWA 5ISMA 1QO7A 5SYMA 3ZWQA 3WLAA 3WWPA 2JEZA 3D59A 3STXA 5ALWA 4CCYB 4UUQA 4DIUA 1VZ2A 1ZD5A 4GWLA 1XZAA 4QLAA 5A7HA 5AKXA 1F0PA 3H2HA 1YCDA 2HIHA 3WA7A 1IUNA 4X6UA 2X76A 2GBIA 3WI7A 2X5XA 2DHDA 4G8BA 3FLEA 2JIDA 2P8SA 1SCQA 4AMZA 4U2FA 5LZ5A 1P0PA 1MN6A 1VZ3A 4B9EA 1G4HA 3C70A 3DYIA 4BAZA 1DTEA 5DTJA 1EK2A 3DOHA 4JH0A 2BUCA 3H2IA 4Q3LA 2Z3WA 3VVLA 2C7BA 4BRSA 2B4KA 1J2EA 3RARA 2XUPA 4X3CA 3I2GA 4W1SA 4MQMA 4EY8A 1XRPA 3C45A 4ZV7A 5D7BA 3QMWA 4C4ZA 4J0JA 3M83A 3FYUB 5AM2A 4HZGA 4BE4A 1C4XA 4A16A 3R41A 5AI5A 2PKYX 3STUA 4C88A 1CUXA 3G9XA 1ZD2P 2GBFA 3R3ZA 2GZRA 1B41A 2BJHA 4JNCA 2CJPA 5C8ZA 5FP0A 3VJLA 4AB1A 3DKKA 1E66A 3HLKA 5BV7A 2O7VA 4GW3A 3W05A 3H1BA 4QDTA 1G66A 4UHCA 1EA5A 3H04A 2GZSA 4N8SA 4KAFA 2ZYIA 3U1TA 5AK6A 1MU0A 1CUEA 5AM0A 4AO6A 5LZ9A 3EIOA 3MUOA 2HM7A 3HZOA 2OCGA 4QNNA 1ORWA 2Z5GA 5AKGA 2WFLB 3W04A 1IZ7A 4BRZA 5K5EA 2QT9A 1ZI6A 1TQHA 1UKBA 5A71A 2BFNA 5LLSA 2VT7A 1IMJA 5CH3A 1VXOA 4UHHA 4ARAA 2G5TA 3FLBA 1J07A 4M0FA 3LP5A 4BVJA 4X91A 3E4DA 4LYDA 1ZOIA 1VE7A 1BN7A 3A70A 1AUOA 4MWSA 3HI4A 1GKKA 5F4ZA 4KRYA 2WFMA 1R3DA 3AIOA 3Q0TA 5AK3A 4CIBA 1ZICA 4A5SA 3ZV7A 4EHBA 4V2IA 3IUMA 1EDDA 2XLBA 3UUEA 1CUCA 3G9TA 2O2HA 2Y6UA 4C6HA 4U2BA 5AI0A 2H9YA 5FXMA 3BJMA 5BWCA 1Q0RA 3W2TA 3ANSA 3N2ZB 4TVKA 3STYA 5EIHA 1THGA 2WIDA 1A8UA 4KE9A 4GBGA 3ZPXA 4CCYA 2J3QA 1CV2A 3DQZA 2V9ZA 3BL8A 3V1MA 2PSFA 2XUIA 3GROA 2XQFA 3I2HA 4QA9A 3PUHA 1HLGA 2PX6A 1GKLA 3HXKA 4NMWA 3C8DA 2WIGA 5EHXA 1UFOA 3H1AA 1UK8A 4Y2QA 3E3AA 4H7IA 5AK4A 5AM1A 3GZJA 3AFIA 4G9EA 2QS9A 4PSUA 1CRLA 5LP1A 1W52X 3KD2A 3D3NA 2OXEA 4QE3A 1WHSA 5ALIA 3FOBA 4CIAA 1P0QA 1CEXA 3FYUA 5E2IA 3LIIA 2WJ3A 5D6OA 2PM8A 5EI5A 2WUGA 2HU5A 4MEAA 4GI1A 1CUFA 2WFZA 4W1QA 2QXTA 1CUDA 4Y2TA 2HL6A 3STWA 5IVKA 3AZPA 4DMHA 2J4CA 4LKOA 1AZWA 4K6GA 5EHZA 3BWXA 4OB8A 3BJRA 2XQJA 3WL8A 2DFPA 5AM4A 3WL7A 4UBOA 2ZSIA 2ZSHA 2HU7A 4Y2UA 5LZ8A 2WTMA 3O95A 4X85A 3QZUA 1ETHA 3NUZA 4CG1A 4OYYA 3PICA 3VJKA 1QTIA 3G02A 4OU4A 4UHFA 5AOAA 1A88A 1VE6A 1DINA 5ALZA 1B6GA 2VJDA 3FWHA 1P0MA 1C7JA 5HF6A 5IKXA 4DNPA 5K3EA 5EFZA 1FFBA 1R9MA 3WKDA 3IA2A 4DMFA 3R0VA 1E8DA 1SC9A 1GQSA 1LPBB 1XROA 1ODSA 1XKTA 5AKHA 4AZ0A 4KACA 4LYEA 1GQRA 1CUHA 5E4TA 3C5VA 3KWJA 4FLEA 5D3ZA 3N0TA 3IURA 2ORYA 1CIJA 1E8MA 5T4HA 5JARA 1CQZA 1XZIA 2CEKA 3E1GA 3I2FA 3H0CA 1AMNA 3DL4A 5ALVA 4J0DA 3AILA 4DMKA 1MT3A 3A2LA 5ALUA 2FJPA 4J7AA 5D3KA 3LLCA 5HFAA 1UZAA 5DTIA 5K3DA 4TGLA 2R8BA 3H2JA 2QZPA 1ZI9A 3MUNA 4WFKA 2RGUA 3OURA 1DT3A 2VJAA 3B5EA 2WLSA 4H7HA 4X00A 5DYYA 1QFMA 5T4BA 2OQVA 1AURA 4FBMA 5KBYA 4DNQA 4AN0A 4ETWA 3MVEA 1H23A 2VA9A 2QXUA 2ZYSA 4B82A 4Y9SA 4MWTA 2AJBA 3KWFA 3WWOA 1EINA 3O4IA 5AM3A 5E4JA 4BTLA 1QJ4A 4HVTA 1R50A 4AO8A 2E3JA 2XMGA 2XUKA 1ACLA 3D7RA 3GBSA 4FFWA 4OPMA 5EIAA 2JF0A 4Y2SA 4B0OA 3DS8A 2G63A 4QWWA 3ESCA 2RIPA 2BAGA 4G5XA 2Y2UA 1BE0A 4BAGA 3WK8A 3C6ZA 5J3JA 1H2XA 1X2EA 2QVBA 3QM1A 1AC5A 4J0CA 4U2CA 2X8BA 1MJ5A 5ESRA 4MYSA 2HA6A 3D2BA 4FHZA 4D9JA 2XUOA 1GPLA 2WHRA 1QLWA 2XUFA 3VDXA 4C87A 2JGKA 4QWMA 3FAKA 4OCZA 4L3WA 1QE3A 3PFBA 5HK9A 3FCXA 2HRQA 1MAAA 3PF9A 4XX1A 3F96A 4ZRDA 2HDWA 3G8YA 3C8HA 2WG2A 3PFCA 4Q3KA 3D2AA 1JKMA 1MX1A 5KWJA 2AJ8A 5EGNA 3ESAA 5CMLA 4G4JA 1T2NA 3QBJA 1H22A 4WCVA 3Q8WA 4JUIA 4FFVA 1BCRA 4EB0A 1R1DA 4X6XA 1X70A 3FLAA 2AJCA 4DLNA 1XZFA 4BE9A 4KAAA 3H18A 4E15A 3V9AA 1JT2A 2D0DA 3F67A 5SYNA 1H2WA 1XLVA 2VJCA 3ZI7A 1W4LA 1NX9A 2DHCA 5LIPA 1EK1A 4ZI5A 4H7DA 5H3HA 3TGLA 1RWQA 3HABA 3KDAA 4KE8A 1HDEA 2JGIA 1E5TA 3A6ZA 1XQWA 3DJYA 1XRQA 3IIIA 3I2KA 1HQDA 4PSCA 3WK4A 5LYYA 5CXUA 2C0QA 2ZJFA 4BP8A 5I9IA 3WK5A 5DLPA 3W9UA 1VLQA 3H2KA 2EDCA 1QIFA 2NW6A 3OG9A 4U2DA 4UBLA 4DSZA 1CUZA 4KYVA 1CUVA 5KWIA 4X92A 3M82A 4Y7DA 3DYVA 2HHAA 3BIXA 5AIAA 4EY6A 2C0PA 3I28A 4S0XA 4FMPA 4B9AA 1F8UA 5CT5A 4X6YA 1YB7A 3CCBA 4C4XA 3LIPA 3PF8A 2H1IA 5JD6A 5FV4A 4O08A 1A8QA 2BUAA 2DHEA 4PO3X 2VQ6A 4AMYA 3WK6A 1DQZA 2JGEA 4YX9A 5I8PA 3V1KA 2IITA 1WB4A 4Q34A 3ANTA 5JYCA 2ZYRA 2DQYA 1ZIYA 3B3QA 4L9AA 3YASA 1IZ8A 3R3WA 4U2EA 1QIIA 2AJDA 4KRXA 1TAHA 1GPKA 2PSDA 5ALLA 1WPXA 4NZZA 2I3ZA 5JASA 4P93A 2WKWA 4J0HA 4HS9A 3ED1A 3RLIA 1JU3A 1WM1A 2CMFA 3O9VA 1M33A 1FFEA 1BEZA 2DQZA 2PU7A 5AKIA 5AJHA 5I7UA 4G9GA 1MO2A 5JAHA 4DNOA 4LXGA 5ALGA 1S8OA 3WZLA 1HPLA 1QONA 2VJBA 2O2GA 3ZLVA 1UKAA 1LGYA 1IVYA 2WUEA 1MNAA 2QTBA 3DLTA 5AI9A 2V97A 4BDTA 4LIPD 1VA4A 2ROQA 4JYMA 5HCUA 1YAHA 3G9ZA 3VISA 1SCKA 4BVKA 1TCBA 5JIBA 2WTNA 3SC2A 1DWQA 1QFSA 1DWOA 3ICVA 4I4CA 5ALYA 1JFRA 1UK7A 4UHBA 2WG1A 2XMCA 4H77A 5BOVA 3IBTA 4ZV9A 1QZ3A 2QJWA 4BAUA 3DEAA 1XKLA 2PBLA 3X3HA 2WILA 2YH2A 4J0KA 5AHXA 4G1FA 4OB7A 3WWEA 3F8SA 4WDRA 5K3FA 3HYSA 2K2QB 3DNMA 2QKYA 3HC7A 3AZOA 1AX9A 2O2IA 3NWOA 1MX9A 2YASA 4HXEB 4M0EA 2CBGA 4BTVA 3JW8A 3IUJA 3L1HA 3AINA 5JAUA 3CXUA 4UBKA 2JEYA 2HADA 4GECA 5ALRA 2BGNA 3WKCA 4BZWA 1GT6A 1ZJ4A 3MGAA 3FSGD 5AP9A 2C5GA 3C43A 3G0BA 4UFPA 4RPCA 2H7XA 3WMRA 4JYPA 4WY5A 1ZIXA 2WIFA 1DWPA 1BROA 4LXHA 1LPSA 2XUHA 4B6GA 1QIKA 5AKEA 2DCMA 3ICWA 4X90A 3T52A 1A7UA 4UBMA 2FUKA 1K6EA 4QLOA 4X95A 4PV7A 3STVA 2VTVA 5C8XA 1F6WA 1FFCA 1XFDA 1E89A 2ZJ7A 1VJ5A 5CXXA 4RGYA 4HTAA 2WHPB 1T4MA 2W6CX 3GELA 2XMBA 5DJ5A 2PL5A 4W63A 1HBJA 1ISPA 2Z8XA 1GZ7A 3K9BA 5CURA 2B61A 5FUMA 4FOLA 3JWEA 4N5IX 2H7CA 5AKJA 1UK6A 3K2IA 4BATA 5HF9A 4A23A 3FNBA 5AI4A 4L0CA 4HAIA 3O0DA 3FCYA 2CKMA 1N1MA 4K6KA 2WUDA 5FOQA 3I1YA 5ALKA 2XUGA 5ALQA 2RHWA 2ZYHA 5K3AA 4AQDA 2EDAA 1CUJA 4JEIA 1L7RA 1CUIA 4EBBA 3E0XA 1E3QA 2WM2A 4Q3OA 1K8QA 3IULA 1ZGBA 5HF5A 1GGVA 4DYHA 4RE6A 1XZGA 5HK8A 2VT6A 4WFJA 1D07A 2ZJ6A 1LPOA 5IVDA 2WG0A 5AOCA 1DQYA 3D4LA 1R88A 1BU8A 4GEGA 3HJUA 3WWCA 3WKEA 1VXRA 4FNGA 4AXBA 1XRRA 2XUDA 5AI8A 2YYSA 2C58A 5A7GA 5JAOA 4FWBA 2JBWA 1TK3A 4FTWA 1DU4A 4MYDA 2WUFA 5CT6A 1YASA 5CH8A 3GA7A 1LPNA 3BDIA 3LCRA 4F5ZA 2H7YA 4HXGA 3EQ9A 4H7JA 2R11A 3WK7A 2FJ0A 3HEAA 1XZKA 3C6YA 1YAJA 4N5HX 1U8EA 3HRHA 1LBTA 3I1IA 4BCCA 1VOTA 3RKSA 1LZKA 1WPRA 4UBJA 3BF7A 1QIEA 3FSGA 1ODCA 3QMVA 3SX4A 1O6GA 4AZ3A 2J4FA 1N8SA 3VXKA 3TRDA 3G9UA 5ALHA 4B83A 2ACKA 4IO0A 2HA0A 2QJRA 3GFFA 1NU8A 2Y2VA 2ONCA 1W76A 1K63A 4QDZA 4PF1A 3KOOA 5FKJA 1JJBA 1ACJA 2HA4A 5ALOA 1G5FA 2PPLA 1YSCA 1UXOA 2QUAA 2Y6VA 1MX5A 5JD5A 4DTCA 4WJLA 2BUBA 3I2IA 4K6HA 1CUBA 1EI9A 1H2YA 4Y2JA 1MTZA 1K5PA 4OSEA 4Y2XA 3QMMA 3C6BA 4BYMA 4ZGBA 1UK9A 3BIWA 5JD4A 5HKBA 4XIIA 4EY7A 4PNZA 3QVMA 2OAEA 2WSLA 1QIDA 5FPQA 4K2AA 1L7AA 3VJMA 5EHNA 3IVMA 1EDEA 3L1IA 2PUJA 3D0KA 2OCLA 1XZLA 1CUAA 4KE6A 2XUQA 2RAUA 2XUAA 5C7YA 5IH7A 1CLEA 3OC0A 2CZQA 3VKFA 3NOXA 5A6VA 1LPAB 1XQVA 4H18A 4AX4A 3T4UA 2XLCA 4UPDA 1E8NA 1Q84A 3AJAA 4F0JA 1GXSA 3G0CA 4H7FA 3G0GA 5AM5A 5K3CA 5HQ3A 3O4HA 3AUKA 2PSHA 3I2JA 5AK5A 3EQ8A 1BRTA 4W9RA 1BS9A 4GLBA 3PUIA 4F21A 6YASA 1VKHA 3C6XA 4QDXA 1QTRA 2YXPX 3FVTA 4H7KA 3ZLTA 3BXPA 4QZVA 4MEBA 4B80A 3R40A 4PQEA 1USWA 4P9NA 1FFAA 3PE6A 2WU4A 4LHEA 4FLFA 2PUHA 2PU5A 2IIVA 5JZSA 1UOPA 3HSSA 4OU5A 4FLMA 3M81A 5KREA 1XZEA 1QIGA 3OM8A 4ROTA 1WCYA 5C81A 2I78A 4B0PA 3G0IA 2C4HA 3KXPA 2QMQA 2VATA 1I6WA 5ALDA 3FYUC 1TCCA 3I6ZA 2Y1KA 5FRDA 1DX4A 1EHYA 5AKYA 1XZCA 2VAXA 1U65A 4Q1VA 3WIOA 4H35A 1LBSA 1KU6A 5JATA 1ZD3A 1YA4A 3P2MA 4BDSA 3F98A 3WIBA 4CFSA 4BP9A 3WL5A 1HL7A 3QPAA 2OQIA 5DNVA 5BWBA 1QO9A 4PW0A 2OPHA 3BDVA 2OG1A 4ZREA 1CFJA 1FJ2A 1A8SA 4X7BA 1L7QA 4J03A 5CT4A 5CW2A 4X94A 5HFNA 2GYWA 3U0VA 1QGED 4IH4A 4ZXFA 1U2EA 4CG2A 4M0MA 4LXIA 3AZQA 1K4YA 2HA3A 4QEKA 4W1PA 1EX9A 2JGLA 3EQ7A 5ALFA 4PSDA 2LIPA 5CT9A 4DM7A 4Q05A 1C7IA 3S2ZA 2VSQA 2UZ0A 4DSAA 1SCIA 1RYYA 2XE4A 4FBLA 4G8DA 3SWWA 1X2BA 1UT6A 3OOSA 5HQ3B 2XDWA 3RM3A 1EXWA 4G4IA 3IDAA 3R3YA 4YASA 2GYUA 1PV1A 5CT8A 2B9VA 1RP1A 4J3JA 5ALPA 1PJAA 4G8CA 2Z3ZA 1TIBA 5EHQA 4C89A 4ITVA 3CCCA 4QDUA 3OTQA 1Y37A 4FNMA 1MNQA 3R3VA 4GHWA 4WY8A 4BCBA 4GXNA 5IVHA 4U2GA 2BGRA 5YASA 4NVRA 3UUFA 1XZJA 2WU3A 4G4GA 4ZWNA 5LZ2A 5DYWA 5HF8A 5AICA 3LS2A 5IVIA 3STTA 1LPMA 3HACA 1Y7IA 1YB6A 2OLEA 3PI6A 3K6KA 5AKZA 5JAPA 5A62A 3AIMA 2ES4A 2ACEA 1MAHA 4TPKA 4OYLA 1KEZA 4MQLA 5ALTA 2BKLA 2O7RA 3B12A 3CN9A 1BEEA 7YASA 1XQYA 2QRUA 2JGMA 1YS1X 5FPPA 1EH5A 3WL6A 4MJ3A 5ALJA 3PDCA 3IUQA 5T4FA 5JANA 2HFKA 4IQ4A 1QIJA 2WIJA 2PSEA 3AIKA 2G4LA 2OCIA 4Z49A 1JU4A 3O4GA 3H19A 4E14A 2XQKA 2D5LA 3DDUA 5AKKA 1IUPA 1CR6A 1XZDA 1W6RA 5CBKA 2PSJA 1O6FA 4L72A 5LKAA 5JADA 2VF2A 1CUWA 1R4ZA 3V48A 3WZMA 4E46A 5CRIA 1CVLA 5A2GA 1HKHA 2EEPA 2V98A 3M3DA 1CUGA 3DCNA 1XLWA 3H17A 3EBLA 1ORVA 4NS4A 1LNSA 3QH4A 5CH5A 3FVRA 4KJXA 1FFDA 1YS2X 1R9NA 5LZ7A 2B20A 4Q82A 1CUYA 4EY4A 3WWDA 4DMCA 1VA5A 2XMQA 2CB9A 1ODTC 2HA2A 4QDOA 3D5EA 3G0DA 1U4NA 3D2CA 3WYNA 4EZIA 5HKAA
chains in the Genus database with same CATH superfamily
3K70D 4Y9TA 3ZWVA 5EMHA 1MVNA 4MUFA 4KG7A 5C34B 3HEMA 3OLWA 4N6OA 3PV0A 4NENA 4W99A 2MCFA 2DLCX 4QPZA 3TM4A 2NGRA 2WQZA 2HTFA 4N8DA 3D8UA 3QEJA 1XLUA 3KPVA 1WMFA 5AVZA 4OV6B 3NTXA 4Q0MA 1JQDA 2MYPA 2QRMA 4FKBA 1KSGA 2WIBA 2P2YA 3H9QA 3TZCA 4BO6A 3EC7A 4JVLA 2JIMA 2OGZA 1MPXA 4NZ9A 5CVEA 3DFUA 3L5OA 3TG2A 2ZTVA 1P7PA 1QG4A 2I4RA 2C9OA 4LHZA 4TSRA 4KUEA 4BX9A 5AW2A 1Y3BE 2IRWA 3G9QA 4IJKA 4HAYA 5CD1A 2DT5A 4N3AA 4AUKA 1D2CA 1KORA 2H92A 4UFOA 2VYCA 1TJNA 2OSBA 3FBGA 2WINI 4I8XA 4HLUA 4RH0A 4PZPA 5DBGA 3O9MA 3NYIA 3VHRA 3H9BA 1A2BA 2ZCUA 2BCEA 3HBFA 1XAHA 1AKTA 1KTIA 3I58A 4FDMA 3UCEA 3CN7A 4I3FA 4MW1A 3PWZA 2AN4A 2QU7A 3QLJA 1KC1A 1RZRA 4LFAB 1EFKA 1J56A 2JPDA 3COYA 3CU5A 1W9HA 3KNZA 3QE2A 4JY7A 3T4XA 3R3UA 1O89A 4PHHA 4G0UA 3NNNA 3UK6A 1UWCA 3OQNA 1E1RD 4D99A 4W5OA 3TGPA 1ZM9A 1ST2A 1IHYA 2E4UA 2J3LA 1QZUA 3BIJA 4MV0A 4MMYB 4NZOA 4TV8F 4XOUA 1JVNA 4O4IB 2FK8A 3RRXA 2R1UA 3IAS1 3LCUA 2J3DA 2O5RA 1RHMA 5CP8A 4ZQGA 2QI9F 3AESA 4OHBA 2ODAA 4G63A 4MRSA 4DGQA 3O8OA 2HWXA 4GPZA 4V3CA 4KGVA 1NT2A 4HXFB 2JGFA 3TRKA 4RK1A 3LCCA 4PYMA 3H9JA 1A76A 1IQ0A 3AVVA 2CLEB 3A7EA 2I2CA 1Q0PA 2X0RA 3C87A 4MB6A 4QOEA 4JK3A 4ASUA 4W8HA 3RK4A 4GMFA 1FJXA 4EG3A 2ZJZA 2J3IA 3CNQS 3L05A 4B3XA 3CPSA 4WRRA 4JCOA 2R1VA 3CNOA 3W3AA 2M98A 3LHSA 3NC1C 3EX7C 4NR0A 4WQMA 5JMTA 1ITZA 4FNOA 1K68A 1NXWA 1IWBB 2D00A 3TFQA 3RRYA 4CVNA 2E2WA 1G9XA 3IDSA 1UODA 4BMCA 2I3DA 2IGTA 4FN5A 3G5UA 1C0IA 2ORWA 5KB3A 2VTBB 5C4IA 1VBNA 1K3TA 2WY2D 4EUSA 4OHYA 3VVMA 4KU4A 4RF5A 4ZJUA 2F2TA 3WGIA 3RG8A 1FBTA 2RHLA 2XAUA 1HOTA 2JI6A 2Q9BA 1YH3A 2R8YA 2YIVX 1BWQA 1QKKA 3GNLA 4KVZA 3T7DA 3B13B 3W8NA 5CM9C 3ZZ0A 1W47A 1GXSB 2HU8A 2PWYA 3FR8A 4YJ2A 1TA9A 4MS3A 2C7QA 4K26A 1IUOA 3AR5A 2OM2A 3HADA 3HN2A 3N3AC 4WXEA 5B53A 2HNKA 3O8OB 1LPPA 4YJHB 2G9NA 3ZHBA 1M1ZA 3R9XB 3H5OA 3SZLA 1E1KA 5IAKA 3OQBA 3R8CA 4CDGA 5IJ0B 4D9IA 1DPFA 2ZT5A 2Z2JA 1OREA 2PRJA 3CTMA 4FSDA 5EP3A 4JQCA 2QMOA 4B44A 1AKNA 1PTKA 2I7XA 3BHNA 3C3YA 1W46A 2HA7A 5JC8A 1SBQA 2OKGA 3GPCA 5AHOA 4Z4IA 1WS6A 2VXYA 6ADHA 2CWDA 4NNOA 1YVPA 1KRXA 3IBCA 3IO5A 1H8EA 4OMCA 2WJ4A 3IDQA 1HFJA 4C06A 5B4UA 1QS0B 5JFTA 1CNEA 4NP6A 2RGNA 4U8GA 1VDZA 3IUSA 3DEHA 1SUBA 5FV7A 3RQIA 2RH9B 1T0PA 2GYVA 3T5MA 1AS2A 1E2UA 5IK2A 3RBAA 1XG5A 3EF3A 4MS1A 1UXHA 1ECBA 2RB4A 5K8LA 2R0QC 3GAFA 3QXHA 3L8GA 1RCTE 2HAEA 4J9VA 4Q7LA 4YV2A 2CJXA 2J9RA 2Q5JA 2XWBF 3RU3A 4F4FA 5G41A 2P5TB 3THYB 2R66A 1EYZA 2XQGA 3ZEIA 2IYWA 4MINA 2ZE8A 5D84A 3HJGA 4U6QA 5JNUA 1MV5A 5G53C 1TU3A 4RCVA 4NYMQ 1EWKA 1P29A 1ZCZA 4IH1A 5IJAA 5F1OA 1OB2A 1EFRA 1E0SA 1R4NA 4HAWA 4O1HA 4TWBA 3RVPA 3TOCA 5ED0A 1KIMA 4ZO4A 4CG3A 2BV3A 4S12A 3T7JA 5ICGA 4C14A 3AEYA 1DV1A 5AT1A 3IX7A 3E05A 3GLQA 4U6NA 2BDUA 1BAPA 2YOHA 1K7EB 4NMLA 1SKBA 4RDCA 3UMBA 2F9FA 5ALMA 1Y4ZA 1TIPA 4HGOA 4DCTA 5AI6A 4WI1A 4IXNA 3DAFA 2C4UA 1OILA 1KDOA 4I5EA 3C74A 4J0GA 1TA0A 2RMKA 2GEFA 1T9BA 4GI3A 4BGEA 2PXXA 3Q7RA 4C0XA 3I45A 1ML3A 1JIUA 2F8TA 2OFFA 4HMQA 2DY0A 1NVAA 4B6GA 1DL5A 2OD9A 1KJ9A 3GJ4A 3LLMA 1PFVA 1R64A 5FI3A 4CN8A 3I6QA 5C1OA 3MB8A 1M7BA 4ZCQA 4UTRA 4XPZA 2YHAA 3NIBA 4XSGA 4DLKA 5L4LA 1QU3A 3N39C 3AI3A 3DOOA 4LY9A 3WJ2A 4V0OA 4BFLA 3NUGA 5DHTA 3QOWA 1ODLA 1TRHA 2PL9A 4BY9E 3KKMA 4Q4JB 1M2GA 3GJ7A 2DSNA 4URZR 3CFYA 3I5MA 1YA8A 1W19A 2IHZA 3CX4A 4HZUA 2A9VA 2RDMA 1Q91A 5DWVA 5JSZB 2UXCB 4CKBB 2BKXA 2FLVA 2BPOA 3QE9Y 3AJ9A 1ANKA 3UJPA 1Y0BA 3BD8A 4QFBA 4MKFA 4EVIA 1PYDA 2ZIXB 4DLTA 2J0EA 2JGNA 2WDPA 4GXTA 3DKRA 4BVLA 1OT5A 1U0JA 4UE6A 2WHPA 1UEJA 2HB6A 4YAFA 4L0MA 1S8NA 1UMCB 5IM4A 1J2JA 2LCIA 1LVUA 3HYTA 2QN2A 1XWWA 3BF8A 4CEIB 1Q15A 1ADFA 3IQGX 3NHSA 2IHTA 2QLNA 5A03A 2AC2A 3K5WA 5HRAA 1VSUA 3MGGA 3FZGA 2OC4A 3ROTA 1EB8A 1RWPA 1JE1A 1JMKC 1NNSA 1MUUA 5AKLA 2PY6A 2VWHA 1E1MA 3GEIA 1L8OA 3IBFA 3KTAB 4HH3C 1UBLS 5LXTA 2O57A 2DQKA 1E61A 4GX0A 4IIXA 3GMDA 4D6PA 3UWKA 3UA4A 5B1IA 1H93A 4FUTA 4JJGA 2MSWA 3MB5A 1CJUC 1G5QA 3W5HA 4EHFA 4Z7OB 1QH1B 1NN5A 4ZAWA 3U7QA 2GI4A 1GPNA 3RYFA 2VBCA 4BB5A 1N9GB 2FR8A 3X1ZA 2AHRA 1CUUA 3EFOB 3T0FA 1U8XX 4CBVA 3KJQA 2AS0A 5INTA 1NDHA 4H6PA 2MJLA 4RLHA 3WL4A 4R7ZA 3IIEA 1MX3A 3CKLA 4OJQA 3NETA 4W7HA 4BB0A 1G8GA 1DELA 1CBUA 3T5TA 1EFAA 5K4AA 1CTQA 3VU0A 1XZHA 3DB2A 2VIIA 5I4IA 1FSSA 6CHYA 2I0FA 3DMNA 4CUZA 4D9GA 3Q8XB 4ZCPA 4TKUB 2J5RA 2DE0X 4GKKB 1DX6A 5EZSA 2YCLA 4FS8A 4RULA 2RGNC 4X66B 1AO0A 3K0EA 1FC0A 3JVUA 3H11A 4BNDA 3MMSA 4C0QC 1CQWA 2Y0BA 3IAHA 3GN2A 4IUCS 1A5ZA 4S1OA 4WA7A 3UH1A 5GJVC 2JAQA 4WBNB 5I9TA 3MBKA 4ZU6X 3HFSA 3WBFA 2VYFA 1A0OA 1QG6A 1RQXA 3PRHA 4TKVB 4F5YA 1DRWA 3LFHA 5JC1A 5KTPA 5TB5A 2CNWD 2IIPA 4TN5A 1BVRA 4DYDA 3C6KA 2L19A 3A2NA 1CB7A 2V65A 3D6VA 2JLZA 1UM9B 1O08A 1ZK3A 2VWQA 1PR1A 2OV3A 3BSWA 3TJRA 1QB7A 2QDKA 5U4QA 2YJGA 3WV5A 2ZBRA 2QQ5A 4IW3B 2Q6TA 4UFNA 4Z9AA 3U9SA 4CI9A 5TLSA 3D6FA 1G9TA 2C00A 2R79A 3KQSA 5F2EA 3E9NA 4DCGA 4ZXPA 1JU9A 4NOMA 2BMWA 3DDNA 3RTGA 1DE0A 1JMYA 2GFQA 4P4LA 4PN3A 2YHIB 4RPGA 1AA9A 2ZSUA 5TMEA 3LHDA 1GRCA 3ET4A 4BVBA 4CJXA 2P2CA 4ZMBA 4BP1A 1RAHA 3DAHA 4ZCTA 4IKEA 1NOIA 1SOUA 1XE3A 4DPMA 2GILA 1P0IA 3BMXA 3WA6A 1FE8A 4DLZA 1DOHA 4ZICA 1BDHA 4EW3A 2VTKA 3SF8B 1RLUA 1BQ4A 5B2FA 2OP1A 4LVCA 1F8GA 2HRRA 3GRFA 1BMFD 2AFIB 3AR9A 3S68A 2H16A 2W6QA 3QEBZ 3K6RA 1NSFA 4MYUA 1JNYA 2MINB 2QQ0A 4E5SA 1AGRA 1WLSA 1R37A 3ESYA 2BFOA 2FMKA 4U02A 1TM2A 5CCBA 2BMDA 2XT0A 3UAXA 3B8HA 2X7HA 3CWCA 4XWGA 2F67A 4CLXA 1J33A 4MKZA 3PC6A 4KYIB 4DJ5X 2R8OA 1ADGA 5FUXA 5DYIA 3NVKI 1HKUA 1E9RA 4CEHA 3GWHA 2BR5A 4UOZA 1XRLA 3U7HB 3ZIUA 5EJ7A 1WXEA 3RC2A 2JASA 5KNBD 4E5VA 3OA0A 4ZKDA 2F3TA 1UDBA 4QL3A 2YBDA 2VPIA 1PS0A 3LQ4A 4F9KA 1Q12A 4UU0A 1P45A 1Z68A 1CZKA 2VNHA 1YR1A 5AH0A 4E11A 4C20A 3KE9A 4KEAA 4DIMA 1E3IA 2PBFA 3TNDA 2XBLA 3HY6A 4HDSB 2YFHA 3IMGA 1M1NB 4O1IA 2RK6A 3T3PB 1EVLA 1I30A 1SH7A 1N2CE 2Q5QA 2XQIA 3GGPA 4XVCA 4M1YA 3BMOA 4CFZA 1S3GA 4OOEA 1P80A 2EZ4A 4NXMB 1HA3A 1NNUA 1FQKA 2E4YA 2G9RA 3EHEA 3RK1A 3DXZA 3PHGA 1KMHA 4LZPA 3G7NA 2OBFA 1ZISA 4U8HA 2OMKA 5LLTA 3KE8A 4F9GA 5I01A 1KYTA 5ISMA 3HCEA 3TFWA 3ZVNA 5A4AA 2VDJA 3NEJA 3N7AA 2P75A 1XD2B 1GZ4A 1GT91 3D59A 1JEQB 1EA7A 1L5ZA 1S0UA 1GPH1 2W6IA 4WINA 1RE1A 1DCKA 1ZO8A 4I50B 4J2OA 2QHXA 3SR4A 4G07A 1AKWA 3NBUA 4RL4A 4XEHA 2D1SA 3AJ8A 3TW8B 3X0DA 1GU1A 2TECE 1VZ2A 4YMVA 1ZD5A 3FZYA 1X1SA 5A04A 4YMLA 2HUNA 5E3JA 3S5UA 1P44A 2YHBA 3E84A 1NYLA 4ZZ1A 3WA7A 3HCRA 1IUNA 2VF7A 3GBPA 4OHWA 3UXEA 3IV7A 4KIGA 2G7MC 2Q5LA 2PGNA 3D1JA 2I8LA 3ADOA 1A8PA 2CC2A 4Y0NA 2C1ZA 5E8JA 4OI1A 2XNHA 1EPUA 3WGGA 1B42A 2AR9A 2EZ9A 1FIUA 1Y8ZA 2YV1A 4JWKA 3FLEA 2HQ1A 1J9ZA 1FS6A 2JIDA 2ZXEA 2GM3A 3EAQA 3QEMB 5FPSA 3EBOA 2AFHB 4XUEA 1QYRA 1XHFA 5DGCA 3LVFO 4LRXA 2A2ZA 1V9LA 2QX7A 1ADCA 1SCUA 1Y6ZA 1MN6A 1Z88A 4FFLA 3MPOA 2BFCA 1CW2B 3LRXA 4FYJA 4U3JB 2NSLA 3JZFA 4O6VA 1HTWA 1UUFA 1RXVA 3CX3A 3K35A 1PI3A 4LRQA 1G7TA 5L3SA 1D4ZA 1DTEA 4NEGA 1V37A 5HILA 5K1ZA 4AL4A 2PKXA 2B30A 3KYCB 1M2VB 4A8JA 3WDMA 1MAWA 4JJEA 3OZEA 4YMHA 2C5AA 4Y2YA 3FNHA 1G5RA 4YRTA 3R5JA 4MRPA 2GXSA 3TRJA 4AAYA 2ZRJA 3FPGA 4P4SA 5HGJA 1EP2B 2R97A 2Z3WA 5HJ7A 2RGXA 3IMFA 5EYPB 1ZRSA 2C7BA 4KYUA 1E6UA 3TKLA 1VE9A 5KTYA 1SWWA 2Q29A 3GLFA 1J2EA 2RQYA 1QYVA 1RXEA 1W4BA 4DV4B 3RARA 3V2IA 4W1SA 4PCAA 4JSYA 1XRPA 1OHHA 5BXQC 1JN0A 2WF6A 2C61A 2ZT7A 1PG2A 2FMXA 3IEUA 1Q1NA 3QMWA 5D7BA 3P26A 4E5MA 4S05A 3EXIB 2WTXA 4RSRA 5J4HA 3MMXA 4AZVA 1LFAA 1U9CA 2XITA 4E2ZA 4F2WA 4IUYA 5DZSA 4D9FA 1OU0A 1IHPA 1U90A 2R6ZA 5BN4A 5AM2A 1P8AA 3B1YA 3KBBA 1O6ZA 2J3HA 4CV0A 3EGXB 4NCIA 3VNRA 3VZPA 1HFEL 4HZGA 1IXRC 3ZR4B 4BE4A 1OSNA 2Q8NA 1B8UA 4PO1A 1KK0A 1LJUA 5G0WA 1WUTA 3STUA 2HBRA 1T25A 4EB8A 3L07A 4IRUB 1XK6A 3L8DA 3GA0A 3KT3A 1N6KA 3RWBA 3R3ZA 4J7XA 4RJIA 1KJIA 1DKMA 3PIRA 3MJFA 1SVNA 2HK9A 3D4OA 5IZCC 1ZMBA 4JITA 1SZJG 1ZYUA 4JNCA 2EARA 4GAEA 4P5EA 4PTYA 3GJXC 1Y9JA 4V24A 4BMOB 3RIYA 5C8ZA 2ECQA 5A6SB 1JALA 4RHFA 4I4TB 3UJ6A 4AB1A 3K09A 4GWKA 3ZNOA 4JU9A 4G65A 3UAGA 1T24A 1X3LA 3NEPX 1R0WA 1VB3A 1E66A 2FWJA 5B5SA 4X60A 4EZEA 4C08A 4NDNE 1ZZEA 2O7VA 4II2A 4GW3A 1IOZA 2FKNA 2JIBA 3GG2A 3W90A 3KYDB 1T10A 2I15A 4R8SA 2UAGA 3HUFA 4GC9A 4BFUA 5IDQA 1QQTA 2I33A 4RZSA 5KSWB 3TYXA 1G66A 4PR3A 1PNVA 1QP7A 3GFVA 4N8SA 3GEGA 1SHZA 2BKUA 2P0EA 1RYNA 4PGFA 3DDSA 4I55B 1L0BA 2DMRA 5K8IA 3A1SA 3L4SO 1PBNA 5AJYA 1LU9A 2PZFA 3ETLA 2Z5GA 1M66A 3M5DA 5BSGA 4G1VA 4AURA 3PHHA 4RSMA 3HYCA 3ZHOA 1FYWA 5K5EA 1ZI6A 4E1VA 1TQHA 3DDOA 2VDOB 4WLFA 2BD0A 1EGMB 4LJ9A 2HZ7A 4B71A 2BFNA 1XCOA 5LLSA 2HR1A 9LDBA 3E5HA 3ZQKA 5HKLA 1NVEA 1P9OA 1XEFA 1VXOA 2WAMA 3GYGA 3UJNA 4L0DA 4FFNA 3USZA 4E2YA 5EUMA 3ENVA 1M1YE 1X9HA 4LNUA 5BW5A 4GNRA 1FP2A 2A0YA 2IEGA 3A25A 1KNXA 3HUDA 4DCSA 4CETA 3RUCA 3PKJA 1TU0A 4I08A 1TE2A 3GC6A 5C51B 1SVLA 1K88A 4IV0A 4KXVA 4MVCA 2J09A 1UZUA 5CIWA 4XRGA 4ZOEA 4NC9A 1SHUX 1U8FO 1UJCA 4KR3A 1K5HA 5C37A 1HEYA 2H5LA 4EBFA 5A0TA 3F6SA 1JYSA 1ZOIA 1B7GO 3IM4A 1TMOA 3JQBA 1QAQA 5KNDD 1AUOA 2A5GA 2CE2X 3PPXA 4MWSA 3V8EA 1QFZA 3I72A 1ZH2A 1GKKA 1UDCA 5CB8A 1PNRA 4B3RB 4DLVA 2QTHA 3O8DA 5B6JA 1F7UA 5HUJA 4MMXB 2AK3A 4TUYB 4KIWA 4GYWA 4Y2GA 3N0VA 5DMXA 1R3DA 4M87A 3P9CA 2O48X 3VO8A 2VJOA 5L7YA 1Y9EA 1X7ZB 2FWPA 1XTKA 2ZBVA 3MWLA 4J4BA 4M7OA 3BREA 3IH5A 2OV6A 5ESDA 4FOTA 3RABA 4ZFNA 2HV9A 3IUMA 4PBSA 4ZGGA 2JAUA 3G9TA 5F9HA 2O2HA 3K32A 2AQIA 4NJMB 2EZ8A 5DLEA 2PAAA 2PQ0A 1RKVA 2W37A 1X1RA 1V7ZA 2ZIGA 1BO6A 2M1XA 3AHHA 4KWIA 4XTRA 3UHJA 2AW3A 4KLAA 4AJOA 1KO5A 4FKZA 2V1UA 5TC4A 3JCZA 4LOHA 3OZTA 2CXQA 3LCMA 3WGKA 3W2TA 2RBGA 5JSKA 3ANSA 3WHLA 1KO8A 5JBQA 5CITA 1J23A 1VIVA 2IOYA 3WQQA 4G4SP 3OX1A 5EXEA 3U4QB 1G7RA 4EG8A 4RTQA 1DPGA 1KK1A 1THGA 2WIDA 3TAXA 1NAIA 3HBLA 5H68A 4GBGA 3OY7A 3ZPXA 4LUCA 2GN0A 4B73A 1NULA 2R4UA 4Y6RA 3AETA 5H3CA 2XD9A 3BL8A 3V1MA 2C2HA 2PSFA 4NXNB 2PUAA 1LK0A 1PT9A 4JBLA 1I3LA 2VP6A 4LBZA 5DGXA 1D0VA 1QH0A 2IU3A 3I64A 3SN6A 4LHYA 3T6KA 3CVXA 4P0TA 3FVQA 4MUHA 5A6SA 3PUHA 3TUZC 1NUTA 1HLGA 2PX6A 1Z2PX 2BGKA 3RFFA 3NCHA 4X20B 4A26A 4FUQA 2WB2A 1P33A 3CUEF 5FOSA 2A1TR 1P75A 1GCUA 5EHXA 3ROQA 4P3KA 1UPFA 5JAZA 3BE4A 5LWQA 3I4CA 1JIQA 4KO2S 4II7A 3RFCA 2WTUA 2NSYA 2VVTA 5HZKA 5AK4A 4RIHA 2RARA 1U3TA 2WTBA 3ZV4A 3QFZA 1MP0A 4D46A 4EPXA 2IODA 2GAAA 5DBHX 4R7GA 1TADA 1NHGA 4YJFA 2AH5A 1C9EA 1Y98A 1H6CA 3QVLA 5CLLA 1KFKB 4J07A 3IAS6 1RXIA 2VSOA 3N8IA 1N92A 1R18A 1NRXA 2FHPA 3UC5A 3WDKA 4G9EA 2E5WA 3NBXX 4PSUA 3LRPA 3WXMA 1PZXA 2WD7A 3Q7QA 3UTCA 1HT1E 3RSLA 4YP5A 2GPTA 3I9MA 3P32A 3AVXA 4N49A 3D3NA 4GICA 4QE3A 4OHCA 1BMFA 4DLBA 1UEXC 4EUEA 5ALIA 1T43A 5F64A 4CIAA 4IF4A 3GRRA 2O7NA 3EOZA 4KK4A 4ZI2A 1X1CA 2J3JA 4Y7CA 1NR5A 3LIIA 3B7GA 3ES9A 3EGWA 2AL7A 2Q4RA 4MP8A 4EJSB 1PR9A 2QTCA 2NUPA 1VMKA 2V3CC 2PM8A 4K9PA 5EI5A 3FF4A 2C7VA 2FR1A 1UM9A 4GI1A 1ZHFA 3M4XA 3NBMA 1R6VA 2WFZA 2QXTA 3WGMA 5CDSA 2E18A 3F1KA 2HHJA 3IT1A 3HU5A 4D9HA 2XGOA 4M89A 3UFXA 1T4CA 3AGPA 1IXYA 1W85A 5TMPA 1JKJA 1Y5NA 1UBKS 4MWGA 1Q6ZA 1ETUA 3GCXA 3VAAA 1KBZA 3FKSA 1GL9B 2WVJA 4ZT4A 3PNLA 3HWWA 2VTEA 3SS8A 2G7ZA 3DE7X 4FYHA 1ARZA 4NICA 3TZBA 2RG7A 4DRXA 5B7QA 1M8KA 2PANA 1N0UA 2W6ZA 1F4VA 3CO5A 2EJUA 1OIWA 3KZMA 4KC0A 3KEOA 2XQJA 3JALA 4HQ0A 3U19A 3IXQA 1SUFA 2F1OA 1CF2O 3HR4A 4OQQA 3VR0A 3WL7A 4QXMA 2ZSHA 2ZULA 4A2QA 3H5WA 3URMA 2XWSA 2HU7A 4HGYA 4R2KA 3OTIA 2ZZMA 4Y2UA 3TD9A 1YI8A 5IT0A 2COUA 2CV1A 1QE5A 4UEJA 2ZRDA 1OH7A 5CA1A 4X85A 1TUEA 1MIOB 3K0FA 3QZUA 3KJNA 1HI9A 2COKA 3LTNC 2O2SA 4X41A 3IP8A 3TE6A 1RC8A 4WL0A 4WBNA 1QTIA 5AVWA 5E6SA 1S2DA 3REGA 1L4UA 4HF7A 1P1RA 2B4TO 1Y33E 2FZVA 3HZZA 3BM5A 1V0JA 3LY9A 2WABA 4BGIA 2ZE5A 2NQ2C 2ONYA 1B6GA 1ZZGA 5AW9A 2AMYA 3J81k 4LY6A 2WP0A 3ZW7A 1K6IA 4TL8A 2VRWA 4MQFB 2Z8YA 3OIFA 1Z6XA 3H5TA 2WIAA 3SI7A 3T06B 2IIBA 3R74A 2J5QA 2O6HA 3W5SA 1T1SA 3JAMA 3VU9A 3MQ2A 5A0FA 3OESA 1N2SA 3KV1A 4MHSA 1IIBA 3RU7A 3KT6A 4Q9AA 1QFXA 5J4KA 4M54A 2UZ4A 1RWBA 2FSHA 2GN8A 5K3EA 2IDKA 2X9VA 3SGLA 1NVTA 1UL1X 2V7UA 3JALB 2WRZA 5CVVA 5KAMA 3V7UA 2C8KA 2A14A 3CF4A 4DDVA 3ORSA 2H54A 5IYZB 4DV0B 1M5RA 1AXRA 2XEXA 1FFBA 1NE7A 2QBYB 3R5XA 3E9MA 3WKDA 2X8JB 1A9TA 3P2IA 2R85A 4BMYA 3JQPA 1GZ3A 1U0GA 3C7DB 5DWQA 5IBQA 3S2EA 3RT9A 3R6LA 2WWVD 4DBLE 4DLWA 5CDHA 3MMPA 4A8TA 1LPBB 5C1IA 4D0SA 1JDJA 2Y1GA 4ER6A 3LLVA 4X1IB 3QOXA 1V25A 2Z1DA 1K08A 4OSPA 4WUTA 2LD4A 3GB9A 1KC3A 2P6PA 2VDKB 2F43A 3PC2A 4MCAA 5K03A 3AP2A 1CQIB 4KGDA 3AHEA 4NG5A 2HMWA 3MWYW 1YC2A 3Q7TA 3FYCA 4Z1MA 1LH0A 1UFRA 3AKDA 3BTVA 3DE1X 3E5MA 3DHYA 4OHMA 4P6VF 1IY2A 1XCPA 2WB4A 4QPDA 3C5VA 2OHVA 3KKLA 4FONA 1N77A 2QK4A 4GZLA 3IURA 5IT5A 1DTWA 1M2OA 1UC9A 1E2QA 4ZEXA 3TRHA 1QWSA 1REQA 3W6ZA 4RZ3A 1AY0A 6AT1A 3KSZO 1RWOA 1JHAA 5JARA 2ZAIA 1BH6A 3E1GA 3I2FA 3OKPA 4RDHA 2OXCA 4RY2A 2YXEA 2I7DA 3U4AA 4KVGA 3D8BA 5HDBB 2X9NA 3AL3A 3EIQA 4A0HA 4IHKA 3TTTA 3EAGA 5DHPA 3UPUA 4WASA 4KI0A 5EQTA 5EYPA 4M49A 4MQEB 1D6NA 1FU8A 3FH0A 3AILA 4LE0A 3KSBC 5A02A 2YQ4A 1HG0A 3L3BA 4P86A 3N74A 1YJ8A 4MVJA 2FJPA 3CW8X 4J3NA 3LLCA 4DCUA 4EF6A 3K4QA 1UZAA 2BHSA 4Y3UA 4GMDA 5DTIA 3T4PA 1SU4A 2XF2A 5K3DA 4YMUA 4BV8A 3HR7A 1PJQA 2DTXA 1ZI9A 1XDDA 2ZATA 2Q9UA 1SXJB 4B3JA 2D0IA 2IE8A 3E58A 2JS7A 1U0OC 1DFGA 2VJAA 1W48A 1Y7LA 3EGXA 3H5LA 4IWNA 3ZDCA 5LMZA 5BUCA 2OB2A 4WZAB 5DYYA 4AS1A 1BSVA 5KU1A 2OQVA 4URXR 2PS9A 3IQZA 5KJFA 1AURA 5KC8A 4L8VA 5JH7F 1RXYA 1CYDA 3RB8A 2J9ZB 2GCOA 1WOYA 2SECE 3WDLA 4ETWA 4QBIA 5E6UB 3OOEA 4OMFG 3DGFC 5IKOA 3MVEA 2AF4C 1QS0A 1Q7CA 1TKCA 2VLBA 3A9TA 3L7DA 3BRQA 4RQAA 3UVEA 2QXUA 1W93A 4MWTA 1WVIA 3PL1A 4KBYA 4OJYA 2AJBA 1MB2A 4IXDA 5CM8B 1MIOA 1VYVA 1Z8DA 2QUJA 3GMIA 4HNAA 3VMMA 4AF7A 4CPDA 3O4IA 5BUQA 2C5LA 4IFIA 2H59A 5AM3A 2P6RA 1SM4A 4HVTA 3HJFA 3THOA 1G6KA 4MK4A 2JFOA 4YRLA 3F7TA 4F4CA 4MW6A 4IIEA 1E3TA 4X7RA 3UEOA 2G1PA 2X6TA 4FFWA 4OPMA 1A9PA 3UHAA 2P8JA 1XMJA 4HEQA 3BMQB 5GIPE 4UU1A 5FTWA 4Q3DA 5B64A 3ZGYA 4F45A 2ERCA 2I8AA 1LK5A 4OP3A 4E0BA 3DS8A 1E1CB 1ULZA 2A86A 4LRYA 3N2LA 3OJCA 4MUKA 4L8GA 5THXA 4AVYA 3MSXA 2EW2A 4LI0A 3ESCA 1C2YA 4CMCA 5EJ8A 4KSCA 1P5ZB 3TTWA 4CNQA 2FRXA 2J85A 2REQA 3AOGA 5IN4A 2JL1A 3A10A 3QF4A 4H1VA 1XL1A 4HDSA 5FB3A 5IANA 2QJOA 4BLPA 1WJGA 2CDCA 3KUUA 4LV8B 1QVWA 2PGJA 2X5KO 3WK8A 4BAGA 2QMYA 3WHIA 2O07A 2PZKA 1U2GC 4LCEA 2HJVA 1WBJB 1P3Y1 1DC3A 2GERA 4MA0A 1HNZB 1FVHA 1H42A 1SG6A 3HFRA 1NUQA 3B7PA 4W8OA 4JB8A 3TTYA 4DIFA 4IDQA 4EHLA 1H2XA 2AD1A 2O2XA 1X2EA 2ZRMA 1QO0D 2QVBA 3CX8A 4FVTA 2ST1A 1AC5A 4IWYA 4BO1A 4B1FA 4DDKA 1VBKA 1CJCA 2PPVA 4E7OA 1T0IA 4XYGA 5JNRA 2CLLB 1FCJA 3Q2OA 2PEYA 1MJ5A 5ESRA 2VSYA 1PQUA 5LBUA 4D74A 5DP2A 5DNDA 2I6SA 2CYBA 1ZEJA 1PEAA 4PGHA 2X8AA 1FA9A 2XUOA 1MORA 4MVWA 4MB0A 1KI7A 4U5XA 1TF7A 1QYCA 3THXB 2XUFA 4CKBA 1I80A 2X0NA 4GH5A 4ALKA 3HR8A 2QENA 4CT4B 3EHDA 2JIPA 1RWKA 1W2GA 2UVPB 1QR2A 3FCXA 5KNCD 3LQRA 5GZ3A 1CRWG 1RQRA 2C2WA 4EKYA 1SUWA 2CD9A 1NW7A 3KKKA 1WBBA 2TMKA 2YVLA 2Z3VA 4AYTA 2QTLA 3NBAA 3ZGNA 1OBCA 1EGQA 4ID3A 1RQNA 4JI6B 3PUYA 2CMKA 3FX2A 1PTJA 3HJCA 4K9KA 3KVRA 2HDWA 1DC8A 3FF1A 5A9RA 1SBZA 3GRKA 4LJKA 4HXYA 2JCYA 3EEIA 4I6EA 1T13A 3LA8A 4DUPA 2IYZA 4P81A 1J2TA 3H2YA 1JKMA 3S4CA 1MX1A 3NIWA 4UQLA 1GGKA 5KWJA 4Z53A 3UYLA 1W7AA 3GLHB 3UG7A 5DFAA 1N7HA 1ORIA 2IBSA 3RJMA 4OLHA 3RF7A 3AY7A 5DM2A 3QIAA 1T2NA 2PX5A 3A04A 1H22A 4JUIA 3PIDA 4PR0A 1L4FA 5DEIA 1R1DA 4L4SA 3B9RA 3LT0A 2WU8A 1X70A 1XMVA 4YC7A 2QM7A 5L9AA 4IS2A 2GN1A 1RI4A 5JRJA 4FHEA 1ORRA 5F9FA 1ZOSA 1JKFA 1G2QA 1W1WA 4Z8XA 2XSZA 5CM2Z 1Z26A 5ICCA 1CJMA 4BX3A 2FN9A 3AR4A 3C1OA 1W5SA 1T5SA 2C88A 1DG9A 4E15A 4TKUA 2CLHB 2WF7A 2C4TA 1WEKA 2AN5A 1H2WA 1BHJA 3DZIA 3PS9A 3JVEA 3WX0A 2AKEA 4MI6A 3KOZA 2GMWA 2QPTA 4EA9A 2YJTD 4MITA 3RGWS 4CKWB 4PQRA 1Q44A 1NX9A 3D7KA 2DHCA 5LIPA 2AEEA 5REQA 4JLAA 3NH6A 4EG1A 4ZI5A 1P2FA 4ARUA 1TU4A 1L4YA 2NZJA 4H7DA 2X5NA 5U1PA 3WGJA 3NAMA 3C5EA 3VPXA 5K8VA 1NG1A 3FGZA 3TGLA 4QG3A 2CF6A 1AT1A 1YZTA 2FN8A 4KE8A 4L6CA 4M7WA 4RCYA 2JGIA 1E5TA 1RM4A 2ATCA 2WNHA 5DM60 2IZZA 2II6A 1YJ5A 4MWOA 3AQ4A 3S7ZA 4GKJB 3BXXA 1K7YA 3LXRA 4QNMA 4MGYR 3WK4A 4MWBA 4JC4A 2FFQA 4U7PB 3IKLA 3SXJA 4WOCA 1U0RA 4XSVA 5IKPA 5LPNA 3NHPA 1YVDA 5FNVF 2YZMA 3OBBA 5H8WA 1LBQA 4LQLA 4EDHA 4JSRA 1X80A 2PRSA 3SY8A 1WA5A 1SR8A 2ZJFA 3BMNB 4FJ0A 3WOVA 3EPHA 3WK5A 2V6FA 3TZEA 3DOFA 5K99A 2FGKA 3T3DA 4I14A 3E3OA 1OZ0A 1VLQA 2WE7A 4XZ3A 1TO6A 1ZW1A 4HWGA 2DG2A 2ISQA 1YKFA 1QIFA 4NZPA 1EXVA 3LAWA 3CLSC 2ZJOA 2FP3A 3WOHA 3ZTTA 5JI2E 5K0GA 3O5AA 3NIGB 5BOSA 1T4CB 2B2CA 4UBLA 2A92A 4DSZA 5JSFA 1CUZA 1FVOA 4BB6A 4KYVA 1CUVA 4UAJA 5KWIA 5SZKB 1OWNA 1U04A 4Y7DA 621PA 4NI5A 5JEDA 2HHAA 1X86B 1CP2A 1NE2A 2PS1A 2ZT8A 4E70A 2A3NA 1V1RA 2ZUTA 3UT5A 1BVYF 3ZCSA 1OVMA 2OLKA 1OX4A 4OP2A 4AN4A 1YVEI 2GCGA 4QO8A 5JU6A 3I28A 4RMNA 5BO5A 1B00A 3VH1A 1BYIA 1T34A 2HBQA 3M4YA 3UMGA 1EXNA 4TM8A 1KQGA 3G2HA 3R5SA 5EE3A 1F06A 3FIUA 1BWPA 1CG6A 3KXLA 1O5OA 3FI0A 4BQNA 4BJ6A 4F85A 1J00A 4DABA 5C7LO 2HWUA 2WM8A 3PVZA 3R23A 4K6FA 4WVFA 1F8UA 1WZCA 3E1KA 4X6YA 5CT5A 2A30A 1M0SA 3NW9A 3HDQA 4C4XA 2GJ4A 3PF8A 1T9CA 4RZUA 2M6RA 2QRLA 1JEYA 3IELA 3EISA 3ZOKA 1Z15A 1Q0UA 4YO8A 2V3VA 3TB6A 4ARZA 2RAFA 4JGBA 2QA5A 2ZWMA 3D6JA 1M2JA 3QLUA 4BQSA 3WNQA 3N53A 1BMTA 4FI3F 3HYLA 2IS2A 1YTLA 1OIXA 1ZAKA 1E63A 4B6EA 2I1VB 3U60B 3W5AA 3C0KA 3RC1A 5I8PA 2GEVA 4JOSA 1U9JA 1UBUS 4OFXA 1V3QE 4PFSA 4JEUA 2IH5A 1VJGA 1L5QA 2M1ZA 4G2TA 1ONSA 4BNYA 1AN0A 3ADBA 3CLVA 4UNSA 1NX6A 5EMMA 2DPHA 1SBYA 2V58A 2QTNA 4N3CA 1BCRB 1ZIYA 4MR8B 1YC5A 5D85A 2WKQA 3TZQA 4F5DA 1KI2A 5AUNB 3R3WA 2QTTA 4WNIA 6REQA 3V00A 1VP3A 4OA5A 1DKUA 1FJHA 1G8FA 1O8CA 4ZT6A 3NLLA 3EG9A 4G89A 1IEQA 2J08A 2RSLA 3FFAA 1QIIA 4U2EA 3W2EA 3WIUA 5JNVA 5JXJA 3Q7IA 2AVNA 3CNBA 4NECA 2B34A 5I47A 4I9HA 3Q6MA 3JQQA 4QBHA 3KJXA 4QX6A 3WZ2A 5LMUB 4MQFA 2ZPTX 2VYND 4XI9A 4J1TC 5JASA 2WKWA 3QU2A 3GZ4A 3DVSX 3RSOA 3T5CA 4C7OA 4RY9A 1LRLA 3U13A 1X42A 4XLTA 1VJ0A 5HSGA 3ED1A 4WN9B 5J5AA 3RLIA 1JU3A 1MB9A 2OILA 2O1EA 2Q7XA 4AK9A 2ZB7A 2QF7A 3OJOA 3EPRA 1QG2A 1WM1A 3U4IA 5CVDA 1IULA 4R2MA 2BGTA 3AFMA 2BN4A 2X23A 2NXCA 5CYOA 1GQFA 2D3WA 4XDHA 3B6MA 5AJHA 4Q7JB 4EJFA 2F1KA 2ZRKA 4MS1B 5JECA 221PA 2ZI5A 3IJ5A 5IFKA 4O4LA 3AUFA 1UANA 3KYIB 4DNOA 2DP4E 5I3CA 1MRSA 2C8LA 4G2NA 1SXJE 4LXGA 3RYHB 2XWJI 3V8NA 1R0CA 4KBGA 1S8OA 2H2GA 4CRWB 1TLFA 1XAIA 2VJBA 4G9BA 4L5BA 1P1HA 2WDZA 1Z0AA 3AW9A 3DHNA 4PNEA 1OYVA 3D1VA 4GR4A 4IDDA 3DCJA 2J07A 4NNPA 1I9CA 3AEKB 2SKDA 2WUEA 3GRPA 2Q2WA 1Y1KE 3VFDA 5JUWA 2DHRA 1KEVA 1XD2A 2GF9A 2GSWA 5EEHA 2M9MA 4UNPA 3ER9A 2D4AA 4QBTA 4MS4B 4TMXA 4AJ2A 4W5QA 2CJFA 5UKDA 3H16A 4R2HA 2VJYA 2J0VA 2ZROA 2EJBA 1G63A 4I6JA 2XPCA 4IPTA 1YZFA 4UPVA 3QKRA 1BFKA 3ZKWB 5BWNA 5BW4A 4W5RA 4OQ4A 3U26A 3P9NA 4AWXA 2OO3A 2VF4X 4F4UA 4I5DA 3RUEA 4RK0A 1G41A 2PMFA 5F1KA 1TCBA 4FT2A 2WTNA 2BCGY 1CR1A 2AF3C 2OUIA 3SQOA 4CIWA 5K0TA 4MCHA 1YL7A 1U98A 4NCXA 5TXGA 4BUZA 1GNQA 1HMPA 1NQWA 3QFCA 2HMVA 2BHRA 4L27A 4FFOA 4WH0A 3W4KA 2CNLA 4BV9A 1UAYA 4EA7A 3RF6A 2YY6A 1JFRA 2Z30A 3NASA 1UK7A 4F1KA 4PXYA 2E6UX 3TL6A 4C07A 3VQTA 3HDYA 3E3MA 1TECE 2XMCA 4N0QA 3SQWA 3KYBA 4LF6B 4YCDA 4FIZA 3Q3VA 1WMDA 4B3BA 4XM0A 3RPEA 4I55A 4P7JA 5LP6B 1V45E 3CUVA 4MO2A 4CYMA 3MS7A 3P9YA 2PBLA 2Y27A 3NDJA 2FSGA 2QT0A 5JS2A 4CMGA 1O9HA 4ZQIA 1JDVA 5E0KB 3KLOA 3FUTA 5K01A 1VL2A 5HE9A 4BWYA 2BM8A 4FNAA 2XDQA 1F8XA 1UINA 1KMCA 1PWZA 4I1RA 4LXXA 1RJWA 2H4HA 4G5OA 1TVCA 1ZN8A 2XE7A 2QB5A 4MP6A 2PLAA 1OWMA 1RAFA 4ND6A 1Y6JA 1C3VA 4ZI7A 2J67A 3ZWOA 1JAIA 3QFFA 3KC2A 2DTDA 5KI6A 2FZCA 3B9PA 3X1XA 4YCMA 2YWFA 2R25B 3QFSA 1U4OA 4FYYA 2OYRA 2VPWA 3K92A 3KV3O 3NQ41 3DDWA 4HEA6 3EYWA 1R0YA 3GT3A 3GRYA 4NK5A 2OXTA 4AJ4A 1C9DB 2K2QB 1EJBA 1OZFA 2V1XA 3QUSA 3U61B 3PEFA 1UFVA 3HCFA 1ZSNA 4OF4A 4W5HA 2J8ZA 2QYOA 4YRFA 4PIVA 4X1YA 5J63A 3VOTA 3VYUB 2H1VA 1MX9A 2FQXA 1DJNA 3DVAB 2PXAA 3MJTA 1K7CA 4K46A 1AQNA 4D25A 4YN3A 4KPUA 2CBGA 5G3YA 1E96A 4AS2A 2CWWA 5GAJA 1HNWB 3ZGZA 1H0SA 3FHLA 1BDJA 4FZJA 3NTQA 1CEQA 1KAMA 2BH9A 1B8OA 1GDHA 1P6UA 1TL7C 1RZ3A 2OKCA 1ZD1A 2WMDA 5AJXA 1N0WA 5FHQA 5LMCA 8MHTA 1ZL0A 4ZVSA 2DQSA 3MGKA 1HTBA 2B78A 5AVSA 1JHPA 5ALRA 5HKKD 4BZWA 4DAEA 4TKZA 2BELA 3MGAA 1OV4A 1RXCA 2DYKA 1R4NB 1IATA 3RIXA 3FSGD 5LU8A 2GDJA 3C43A 3H6HA 5L95A 2Z98A 3AWDA 2AKAB 4Q3EA 4RPCA 1HF3A 4F4DA 2FW8A 3L82B 4WNYA 3VDNB 4HP8A 1UBEA 3CISA 1P2BA 3WMRA 4D9EA 3DEZA 2PZEA 4JYPA 4WY5A 1ZIXA 2WIFA 5BN3B 1DWPA 4F8EA 3IV9A 1BROA 3E22A 4FEGA 4E4RA 5CDTA 2R6GA 4EI2A 2QSUA 3PE3A 1A9YA 3AP3A 1M7HA 2DGDA 1KFBB 4XVHA 1HRDA 1W87A 1N36B 5DM4A 4TL7A 1L4LA 2DWOA 4Z4EA 1XMSA 4QLOA 4AP5A 1CZLA 4TLBA 2JFPA 6LDHA 1VYHA 4X95A 1HZZC 3ZKWA 1X7XA 3AERB 1SURA 5F73A 3AM1A 1Z4MA 3CWQA 1NY6A 4HL6A 4R9VA 1Z33A 3SXPA 1TD9A 3DC2A 2CLDX 2RD2A 2VTVA 4LWZA 1U28A 3GCDA 3QVXA 1X7YA 1M8PA 5C8XA 1D1PA 4YI5A 3ZTWA 1N1DA 2AUNA 4GQIA 1E89A 4LNHA 4ZT7A 4Z0PA 2WPNA 4BKMA 4RAOA 2F9MA 5CXXA 3HJNA 4CKEA 3ZD7A 2CDNA 2NYAA 1U3WA 1PUIA 2FU5C 2W48A 2B3TA 3P71T 2PUGA 3T94A 4TN1A 4N5DA 2HWKA 4O4IA 3F49S 1T4MA 2FPPA 3HM2A 2W6CX 1FXUA 3KUXA 3GWGA 3INTA 2XMBA 4IR7A 2FZKA 1J9GA 3L4EA 4FU0A 3OM0A 4FHGA 4PLZA 5DJ5A 4B45A 4XKJA 3G79A 3PHCA 3UGJA 1HBJA 4MGHA 1LFDB 5CFLA 1IRIA 1VIAA 3FTPA 3HEBA 4P38A 1ODKA 1OXTA 1JB9A 1VG8A 5DP1A 3EIXA 3L04A 4Z3OA 3O75A 3R76A 4Y9DA 1S5PA 2B61A 2HJWA 3FOWA 3V7WA 1LBIA 1GGEA 2Y77A 3JWEA 3P9IA 4ZEMA 1FLDA 4GKAA 3HVJA 4MYHA 2FFAA 1U2DC 3KPJA 5EKXA 1TXGA 4LHWA 2B25A 2QVYX 3K2IA 3AHJA 3WLFA 3OE1A 4AJHA 3EZ2A 4OIFA 3P9ZA 4A23A 4GOND 3QWFA 2BI4A 4HVLA 5B30A 1JAXA 5KCZA 1U8ZA 4RTPA 4G0ZA 1NQ5A 1H05A 5IMSA 1MZPA 1IFXA 3RUAA 4YCSA 3JAWA 2CKMA 3A31A 4K6KA 4C21A 3OJWA 1M1NA 1YRBA 2IHJA 5LJIA 2JHGA 4ER5A 1R16A 2HPAA 4DCJA 3HNPA 3AVUA 3FPAA 3NBZC 3NDPA 1MFZA 2DRNA 2QN6A 2PIAA 2ZYHA 4QXPA 2CN1A 5H59A 5K3AA 3TQQA 1I0IA 1XN4A 3IIMA 3GDHA 3PNBA 4CZ2A 3VDRA 1PNQA 1YL5A 2IZ0A 2IUFA 1CUJA 4KXLA 4O8ZA 3HKCB 1ISSA 1E69A 1L7RA 1U6KA 5BNFA 3E0XA 4HLDA 1U7DA 2WM2A 2YV5A 5J2TF 3TXYA 1GRVA 3W6OA 1ZGBA 2Q2OA 2PD6A 1R4AA 1MB4A 1DSSG 3NYQA 4BKOA 2WR8A 4LYJA 2QX4A 3VHQA 3T61A 1R9GA 5I51A 4XVUA 1RRCA 5CLFA 4Q66C 4EFLA 2PBRA 5I7EA 3Q0EA 3LYHA 3QXCA 4H0NA 4Q9HA 3L8EA 1NKTA 4H1HA 3TN7A 4A5OA 1D07A 3U7EB 2HU2A 4CM7A 2FFJA 1QTQA 1RPTA 1O57A 1WDTA 4N6NA 1DQYA 2VZ9A 4ER7A 3C5HA 1JQJC 2GPSA 1BU8A 1Z13A 5FFFA 4GEGA 3ZKAA 2R6CA 4PZUA 2QRVA 4Z7NB 1OLSB 3KR9A 3QG0A 1GIAA 4NY1A 5KIAA 3WKEA 4NYMR 3EDYA 4QICA 4HLNA 1EIZA 5LQUA 2BEVA 2BKAA 2XUDA 4BZQA 3C3JA 5LM3A 1SD1A 2HPZA 5CDFE 5K0BA 2Q3JA 2FG5A 4PYNA 1U80A 2C58A 1ZVQA 5AUQA 3ULKA 1PEDA 5GONF 1TK3A 3KQVA 1KMIY 5GVRA 5CFNA 3DNFA 1VJTA 1I5EA 1XF1A 3PLNA 4P3YA 3GLGB 4JIMA 1M2KA 1YE3A 3VH4A 1ZGHA 3W34A 1JW9B 2WJIA 5DHSA 1IXZA 1QHIA 1ZMRA 2OZPA 2IHYA 2RI1A 1JAZA 2X4DA 4FCVA 4QBFA 4Q9JA 3RVOA 3SDSA 4TYNA 3KJGA 4EF5A 4ZRMA 1QRTA 1NVBA 4DG9A 2O2ZA 4KHPB 4TTSA 2X5OA 1YB4A 4MR9A 4YROA 5DBFA 4ZHSA 4QDJA 4INJA 2R11A 2FJ0A 1ECPA 2HLNA 1XZKA 2ZI7A 3GWZA 2H1WA 4LDQA 4LYFA 3RU9A 3LM8A 1K92A 1KR2A 2AZ4A 1U28C 3D54D 4M0UA 4N5HX 4TTPA 3U48A 1P19A 3CNNA 3HRHA 2B0CA 3RRZA 4ZVUA 2E48A 3WSVA 3DEFA 4LBVA 5LOVA 1ZJJA 2IYQA 1OBOA 2V54A 2FEMA 3EF1A 4KMMA 1GQ2A 4LN1A 4DT1B 2Y0EA 2CV0A 1IC6A 1JPJA 1XZNA 3BF7A 3HFJA 2YOFA 3F9RA 3FSGA 1V16B 4UBJA 1ODCA 3UWOA 2LW7A 3QMVA 4DR1B 3D31A 3F6CA 1TCVA 4ZVNA 2I54A 1YK1A 2PT5A 2G1JA 4YT5A 3VXKA 2V55B 1CZHA 1V11B 1SXIA 3D5QA 3G8BA 1NATA 1T9GS 3O31A 5IJZA 2BGIA 1IM8A 4NBVA 4YP7A 2HCFA 4B83A 5IF9A 1FX0B 3R6DA 4R54A 4XGIA 2H1LA 4BFCA 5GQSA 3TLCA 3L0IB 1VECA 3OA2A 5HIJA 1WPQA 4DCMA 1QANA 1FXWF 4BV3A 3L77A 1U1DA 1KI4A 1NU8A 2Y2VA 3MJ4A 3MTIA 5KX5A 1SCBA 1W76A 2Y9PB 4QDZA 2D06A 4GMHA 1K66A 5LFAA 1ICIA 1TVKA 1KA9H 2GTPA 3L5KA 4FYWA 1O3YA 5BRAA 2YINC 5JAIA 5HCNA 4DOMA 3EEQA 4M0LA 4X64B 4XB6B 2OAQ1 3A1DA 2YRXA 3FVWA 3M3PA 3M49A 4LZJA 1G8SA 4N7BA 3TOZA 2VYNA 2ERXA 4B3CA 1F9EA 5EMLA 3ECCA 5F7ZA 3QX3A 3QLUC 1KIFA 4OQNA 4B6SA 2HRCA 4POAA 1NVVR 1OFTA 5HOEA 4EKDA 1PG0A 4HEJA 1FP7A 5LOVB 2AZXA 2BBOA 1YR9A 3JYLA 2VBFA 3R09A 2Z4TA 1LV8A 3N07A 4QXQA 2OK8A 5KZMB 2E85A 4WADA 2SHKA 1ZVMA 3OU6A 5EJ4A 2V7BA 4LJ4A 3TR0A 1ONNA 3VU3A 4WLEA 2LNDA 2V45A 2GEJA 4J8PA 4Y2XA 2DXIA 5AXCA 5FTLA 1Z5VA 3C6BA 4RGQA 4A4DA 1N32B 4ZGBA 1UK9A 2JHCA 3BIWA 2FW1A 3U39A 3VPFA 3IL2A 4E30A 1TYEB 3ABSB 2UYHA 2RJOA 3R77A 4IJWA 1OKKD 5EEGA 1YNOA 3L6OO 4EY7A 3WLPA 5AVVA 3BSYA 1PVOA 5KYXB 2IS1A 1XRJA 2F3SA 4DR2B 2OAEA 3WADA 2X4IA 4ENVA 2NNLD 3EXFA 1WO8A 3P0EA 4JC0A 4JL8A 3ZDRA 4BLQA 2R8RA 3ZE9A 2BMAA 4DMLA 1IBRA 3QKIA 1KJQA 1Z35A 2QL7A 3AF3A 3PGLA 3TZKA 4V02A 5EUQB 5ED4A 4AJ9A 1BMQA 4KQ1A 4RGBA 4G86A 1HDOA 1IPHA 3L1IA 1L7DA 4PC7A 4XM1A 4DV5B 5LD2C 4I4LA 1A4IA 4X1IA 4EHNA 5EJAA 2PKQO 5KC9A 3C16C 4UTPA 1KF0A 3JQFA 3ROFA 4DV6B 4XX0A 4F4IA 1NVFA 1T6YA 1A27A 1KI6A 2OCLA 1S02A 4IEIA 3G3EA 3ZUPA 1XZLA 3LQQA 3IS3A 3HV0A 4XW2A 3EXG1 4IL5A 4ZU1X 4C7JA 1G19A 2Y1XA 1IHDA 3VYSB 3FCAA 4UZFA 3FCCA 3SZOA 2QN3A 3QVJA 1CUAA 1IY0A 3EH1A 3MN1A 4JMLA 3IM3A 2B94A 2VHTA 3OLZA 3ZIAA 3NTVA 4NCBA 4KE6A 3PKZA 4PGAA 4K8RB 1IK6A 1WXIA 2BSAA 2RAUA 1SG9A 2XUAA 2XUQA 2Z9DA 1E6WA 3R5FA 4K6MA 3RJ9A 5BR1A 4ESOA 3IB6A 3S4AA 3VKFA 3NOXA 3QTBA 2ATVA 4NIMA 2XD4A 3UV7A 3JVVA 3NJ8A 3ANLA 3VPDA 1XQVA 4OBEA 1D2RA 1ZBDA 4RV9A 3EPJA 3GNTA 1Q14A 4GM1A 3S6JA 5IVPA 1WTCA 3VR6A 2IXEA 5KS2A 4YRJA 1SC3A 5ENZA 2XLCA 5TPZD 4L78A 4CLOA 5EOVA 1KR5A 1EEXB 1M73E 1PJCA 3K5HA 1FFSA 3AJAA 4UCFA 1GXSA 3G0CA 1FDVA 1G5IA 2N42A 4OLAA 1NJ2A 4NHOA 3G0GA 5AM5A 4FMCF 5K3CA 4K1XA 2IV7A 4RKFA 4W5WA 1CJTC 3AUKA 3LL4A 3ZYZA 3ZU3A 2GVNA 2JK0A 5LBIA 3AFJA 5E7IA 4LYHA 3TD2A 1I5RA 1Z22A 2FG6C 3AR6A 1NI4A 3HFGA 3QXGA 2PQ6A 4FJ1A 5DNAA 1NQAO 1Z2EA 3SX2A 5A9SB 4MGKR 5TEWA 4A7PA 3ENNA 1XAGA 2IYYA 4UDXX 1QAMA 2F1JA 3PFGA 3GRZA 1BRTA 5KX5F 1TF2A 3OPQA 2BFFB 4ZJZA 1U9YA 4UEQA 2OXRA 4RZXA 1HE2A 2VCHA 2AE1A 3PUIA 2VYVA 2XX3A 2Q28A 4MR7A 1P1FA 3C6XA 5LSAA 3HB0A 3DCYA 4YLGA 5CPFA 1AQUA 1KH1A 4R8LA 5SY6A 1QTRA 4PHFA 3AUSA 3F90A 4XWAA 1XB2A 4TXNA 3CURA 4RH3A 4BUJA 1K7FB 3GJZA 4CHTA 1SGWA 4WKGA 3BXPA 1WDMA 2I1LA 2WJYA 3SMVA 4DJFC 3G1TA 4QIHA 3TL3A 4DR6B 3IVGA 4M9SA 2ATEA 2ZB3A 1UQTA 2EF1A 1E3JA 1EWYA 3HL4A 2JA1A 2Y8EA 1JHVA 2PUHA 4QRIA 4OGGA 4V1CA 1OGIA 1YGPA 2IIVA 1PGQA 4MWCA 3T1OA 4I5IA 4EJ2A 3W5UA 2NXNA 3B38A 4WAUA 1IJEA 4OAQA 3QWBA 5KREA 2A35A 3KEQA 4PYRA 1EFDN 4M8NE 2CFRA 4ROTA 1BX3A 1WCYA 3OUUA 5DB4A 4YP6A 1OC2A 2UXBB 3OFKA 5FI5A 1UMKA 2RHRA 5C81A 4LYYA 2LR0A 4MUYA 4WEQA 2QMQA 2JRLA 3U4MA 1Q5PA 3SZGA 1RPJA 1Y82A 2AFHE 2BDTA 2A5JA 2LZ0A 2WD9A 3FYUC 5DOVA 4O4LB 1BQ3A 1P60A 4R9UC 5DF1A 1IEVA 1LLDA 3HGQA 2Y1KA 3SC6A 3SLGA 1CF4A 5BQXA 4TS1A 2PMCA 3TDKA 3FMPB 1EHYA 4D3SA 3T1HB 1VG0B 2G70A 2J9FA 4K9OA 1X92A 1V43A 3A1UA 5AKYA 4F6RB 1U0NA 2XCQA 2YWHA 1JHOA 3FROA 3MTEA 3TW6A 3PUVA 2O59A 3C3XA 1UC8A 3OZBA 4DA9A 1QTNA 4E09A 1XZCA 2H85A 3HJAA 2GB4A 4TLMB 1BU5A 3W2HA 4Z0TA 1S8FA 1AQYA 1SULA 4AICA 2XA9A 2I87A 3EGDB 4D80A 3TG8A 4MIYA 5JEEA 3ESRA 4TZTA 1KU6A 5JATA 1RQPA 3VV2A 4F3TA 4BEWA 1YA4A 4IDAA 4R9SA 1TEVA 1XNJA 3V1YA 3FTEA 2VWPA 3CRZA 2RHGB 3AOEA 4RZ2A 5FIUA 3ZY3A 3ASYA 2C20A 3LGSA 2IHKA 4JP2A 4FILA 2WC1A 4LZNA 3CVUA 1VYUA 2DTEA 2W9XA 2QTRA 3D2LA 2O2EA 1FSZA 3PL5A 1YWGO 1GSIA 1T36B 2R8PA 1RRFA 3GCZA 2FE1A 1SPBS 2Q5IA 4U00A 1E9BA 3IVAA 4TXMA 4P7FA 3GAMA 5ARDA 4PW0A 1TYZA 1EVIA 3SD7A 1EG2A 4YECA 4EEKA 5LQMA 2YYAA 3BDVA 3L0BA 4C22A 1JPVA 2XDAA 1ATZA 2FEOA 1QGDA 3MUFA 4ZQFA 4EJ6A 3C1TA 4RJLA 3QU9A 1P3JA 3PQ3A 4J03A 1SEVA 2F3RA 1R12A 1ZOPA 2G06A 1U7PA 3D8HA 2NU9A 3F71A 2GF0A 3MSCA 2NLOA 4X94A 1XTVA 3R9IA 3RHSA 3SF8A 3TNLA 1QRSA 2GYWA 3QSGA 4H1TA 4EO7A 3U0VA 3OTGA 4BYGA 4RCZA 4JJAA 3K9HA 4M1SA 3AKYA 3MPUA 2BGJA 3LZCA 1U2EA 4CG2A 3EC2A 4US2R 4J43A 4Z4GA 3GEDA 3NHYA 1XOIA 4M0MA 4KP7A 5TVKA 4DHWA 3B6IA 1P2UA 1QUEA 4LXIA 4WOJA 2HA3A 4BB9A 2C4WA 2V6MA 2E5LB 1H5QA 4W1PA 1U8TA 5BPFA 5JPCA 2GK4A 1I7SB 2V7PA 4YV0A 1FVFA 2NV2B 2UZ3A 3OPYA 4UUMA 3Q8LA 3I76A 3S2ZA 1PR4A 3ERCA 4O4HA 2XRYA 3TR5A 4YWJA 3CINA 1PKEA 1H2BA 2VOJA 3E9RA 3K9LA 1L4BA 4ZVKA 3RADC 3TX6A 5JYBA 1RYYA 2W6MA 1U0EA 1KZ9A 5JE8A 1Y4AE 4RZQA 4E5KA 4EQ6B 3EWIA 3W1WA 5TPZA 4BIMA 4LQDA 3U3DA 4YR9A 5LJLA 4RO0A 5L3VA 3S4DA 3SWWA 4YRIA 4IG9A 4LJ7A 1WP9A 3PQ8A 4PC1A 5HQ3B 2EU8A 2ZIEA 4D82A 3GLIA 3RRSA 2IT1A 1G7CA 2M6SA 1EXWA 4RA9B 5HBRA 2OA0A 5HNKA 4I1PA 4G5QA 3HL0A 4HWRA 4XGQA 3R3YA 3COVA 2PKRA 4HRVA 4IDNA 4MI1A 1P2GA 1DHTA 3ANYB 2R7MA 2GYUA 1PV1A 1V9CA 3I23A 4J3JA 2ZB2A 4YMGA 1PJAA 1O8BA 4DQXA 1KFEB 2QRNA 5CFMA 1U94A 5J2UB 3IKMB 4V0LA 3DZKA 3KQOA 1NKVA 3T7EA 1GCGA 4ZAVA 3L8HA 1V5EA 5F5NA 1IAQA 1C2TA 1TIBA 1XI2A 4HX2A 4MJXA 4P3NA 4PBRA 5EHQA 3RUHA 3VUEA 4DNXA 3NU1A 3KHKA 4WGFA 3NUQA 5KYKA 1BGXT 2G9ZA 2ZSKA 3HYNA 4OVKA 4W4TA 4HV4A 3OPYB 4F5EA 2CUKA 4GLJA 3GL9A 4B87A 5KTMA 4GQAA 4HDQB 3QVUA 2IE0A 3BMCB 3LO8A 4FNMA 3KFLA 1MNQA 2OYSA 2JJMA 2VYVD 4F8JA 5BQ3A 5DNEA 2JATA 2X14A 4CTNA 1XCJA 1L3IA 4RA6B 1DIBA 3L18A 1I2ZA 2MHCA 4U2GA 5B3JA 2PRZA 5B3KA 2PTGA 2ZTLA 3DFKA 1QRRA 5EP4A 3BB4A 5GIOE 5YASA 1G8JA 2AG8A 3F2VA 1L8AA 1K1EA 1MMFB 1V3VA 1XZJA 2NVBA 4TYMA 4W8GA 5JSYA 2IFTA 4RXUA 2C99A 4UJ3A 1XQ6A 3GH1A 4YXWD 4PLPA 2BBWA 4PBTA 3G88A 3OEED 1Y4UA 3EH2A 5AICA 3LS2A 4FOSA 1PWEA 4QOSA 1CS0B 1SVKA 1DAOA 1LPMA 5IVIA 2PZ8A 3HJBA 1G4UR 4JDPA 4E6PA 1KSHA 2ZT6A 1ZNZA 4AKIA 1YB6A 3MWEA 1FUIA 3GLSA 2NNWB 1L8QA 2CD7A 2CXNA 5GPBA 1U5BA 1YDGA 3RS0A 4YJ3B 4GUDA 5EIWA 3BHJA 1FL9A 1DAMA 3PPVA 4EYKA 1PK7A 2D8AA 4XUDA 5E7MA 5JAPA 5JG7A 1XALA 4B4UA 2ES4A 4AP9A 3CEMA 4JLNA 1L5MA 1RBQA 4O2AB 5B7PA 2V9CA 1GGJA 2G83A 3FOEC 1CU1A 3K5IA 3JQ8B 3ONVA 2QX6A 4XX0B 1M75A 4JNKA 3W8EA 1M2HA 2F3QA 2JDID 3D0OA 2G28A 4NBSA 1T2DA 1YIAA 1V9SA 5ALTA 2QD3A 1PL0A 4OQYA 3B12A 5J58A 4BUCA 4PE5B 1TT7A 4BMZA 1YNSA 4IJVA 4JD5A 2OR3A 3HMQA 1TVEA 1N5JA 1Y8RB 3IXLA 3CRQA 4NYJQ 4UZSA 2EF0A 1GL6A 3RBVA 1JG4A 2IWHA 4X8OA 1FSFA 4NZMA 3QOYA 4JLPA 2GTIA 3N7UA 4XJXA 4RD4A 2QRUA 2JGMA 3GFBA 4RY0A 3VR5D 3LKZA 5BSWA 3RHTA 1XQ1A 2YOGA 2C2GA 4NZYA 2Z95A 3WL6A 2XOEA 1XZ8A 1YZKA