3PMIA

Pwwp domain of human mutated melanoma-associated antigen 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
SFEVGMLVWHKHKKYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQAREDFNQDIGWCVSLITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PWWP domain-containing protein MUM1
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.60 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3pmiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pmiA01
3OYGA 3MO8A 4IUUA 4OVAA 4BE1A 3OQ5A 5D6XA 2EQUA 2RI5A 2X4YA 1XNIA 2BUDA 3OS2A 2X35A 3DB3A 2GFAA 2QQRA 5KE2A 2RJEA 3OYNA 3OYFA 2LDMA 3MP1A 3CEYA 3OS0A 2R57A 3QIIA 3LX7A 4E7IA 4QQ6A 4FU6A 2LCCA 3O8VA 2EQKA 3L2QA 4QQGA 5KE3A 4PLIA 4IUVA 4Z02A 3NTHA 2DAQA 4ZTJA 3EAEA 3M9QA 3S3NA 3L2RA 2X4WA 3PMTA 4EDUA 5IAYA 3S3OA 3OB9A 2LVMA 3FLGA 3GOXA 2M0OA 2LTOA 1KHCA 3OYJA 2RJDA 2GFUA 5FROA 4GY5A 2E5QA 3NTKA 2M1HA 5KCHA 3ASKA 1WJSA 3QKJA 5KCOA 3FDRA 1RI0A 3QJ6A 2BKDN 3META 1WGSA 2EQJA 3L2UA 3E9GA 3DLMA 2EKOA 3LYIA 2G3RA 4RG2A 3OYKA 4E7HA 5D6YA 2RJFA 2YRVA 3FC3A 4PL6A 4BACA 1OYXA 3LLRA 3ZEHA 2R5MA 2DIQA 3L42A 2GF7A 3OYBA 3OA6A 3F70A 4PLLA 2JZ2A 2MWPA 3MEAA 4BD3A 2F5KA 2JTFA 4ZTFA 2RHZA 3MEWA 2K3YA 3OMGA 3OYDA 5FRNA 4BE0A 2B8AA 3OYLA 4N4IA 3UT1A 3E9FA 1OZ2A 3OYCA 2BIVA 4A4GA 4C5IA 5J39A 2DIGA 5D6WA 3OMCA 2EQMA 3MEUA 3PFSA 5IN1A 3OYHA 4BDYA 2D9TA 2EFIA 3KUFA 5J26A 4LD6A 4Q5WA 3SD4A 1N27A 3PMIA 2RHIA 4N4GA 3L2VA 2HQEA 2RJCA 4A4EA 4A4HA 2R58A 2FHDA 2L3RA 4FL6A 2XK0A 5C6SA 4E7LA 3S3MA 2QQSA 3MP6A 3OYAA 2CKKA 3FEOA 2K3XA 5M9OA 4NS5A 4IURA 4B9XA 2O4XA 4QQDA 5C0MA 2XDPA 3P8DA 3PNWC 4QW2A 2PQWA 4IUPA 4II1A 4CRIA 5KH6A 2RHYA 4C5HA 3Q1JA 1WJRA 2L89A 2O4XB 3P8HA 4QVZA 2WACA 3OYEA 4E7KA 3C4SA 3QBYA 2M16A 4X34A 3LH0A 1MHNA 3H8ZA 4B9WA 4C5GA 3L2WA 4HCZA 3BDLA 3H6ZA 2RHXA 3OS1A 1H3ZA 2E6NA 4N4HA 4BE2A 3OYMA 1OI1A 3NTIA 5CIUA 1G5VA 4E7JA 4IUTA 4IUQA 2RI3A 2L8DA 3DB4A 3ME9A 3MEVA 2LRQA 2R5AA 1WJQA 2P0KA 2X4XA 4IKFA 4L59A 4C5EA 4UC4A 3LGFA 2NLUA 2IG0A 4A4FA 4BDZA 2RI2A 2RHUA 5FRMA 2VYTA 2RO0A 1SSFA 3OY9A 2MWOA 2HQXA 3MP8A 3S6WA 3LGLA 3OYIA 1OZ3A 3UWNA
chains in the Genus database with same CATH superfamily
4D8DA 2VB6A 3MO8A 3M0RA 5GAOl 1TWBA 3CCMT 3M0UA 1B07A 4HXJA 3ZL7C 1YITQ 4M77C 1G2BA 2QQRA 2QA4T 1QCOA 5CCAA 2DXTA 2IZYA 1VQLQ 1GCQA 3RMSA 4ZTJA 3VRZA 4MZPA 3CCVT 5FWBA 2FL7A 3S3OA 4RKUE 2HQHA 5FU7C 5FROA 3R6OA 5LJ5g 4ANJA 1J3TA 3DLMA 1YHQQ 1VQLA 3E19A 3LLRA 5LJ5h 3PT9A 3EFSA 2EGCA 4PJOA 1GBRA 2KQWA 3AT1B 1QVFA 2RM4A 1O9SA 4PJOB 5J39A 1AWXA 1UECA 1G3YA 1YHQA 4R55A 3I55Q 1NJIU 3JCMW 1AWWA 3RBBB 3V7RA 2RHIA 3VKIA 2HQEA 4JLIA 3CPWP 2LJ0A 4RIQA 2ATCB 2FZGB 3OYAA 2A28A 1X2QA 4B9XA 2EJ9A 5FW9A 2PQWA 2COWA 2KRMA 1IO6A 2H3JA 4BI4A 2L89A 1H3HA 2M16A 3H0FA 2DMOA 4OMOA 1A0NB 4C5GA 3C0CA 1ZSZA 2F5TX 4DOVA 3ZFJA 2MIOA 1PC0A 2DK3A 3SFMA 2M9UA 4BB7A 2L8DA 3VS3A 5GAN3 1Q82C 4RTWA 1ZLMA 3JB9G 1M4ZA 1WHLA 1WXBA 2P84A 1VQNT 2RQRA 1ZSZB 4BDZA 3A8MB 1KQSP 5GAN5 1VYVA 3QO3A 1LNXA 1WNLA 4RT4A 2K5LA 2BZYA 2QGGA 4KULA 1TG0A 2CS7A 4PJOG 2JVVA 4C92D 3O5ZA 4M7DE 1SRLA 4XU1A 2LDMA 1RAFB 2NUTA 2PUOB 3RKWA 2MPXC 4M75E 4J6YA 5KE3A 4Z02A 2LCSA 2KDSA 1Z9ZA 2NUTB 2KSSA 2VVKA 3OBYA 1OQKA 2M0OA 5GANj 4HKEA 4O6JA 2ZPEB 3CCQQ 4J83A 3EHQA 3CC7T 2MCNA 2HCKA 2HL5C 2XIDA 1KHIA 4HA8A 3E2UA 2EQIA 4PFZA 3CCQA 1RAAB 3E9FA 2BIVA 4Y92A 1YCYA 2Y4YA 3SWNA 1D1AA 4JS4A 4C92A 4Q5WA 2BTTA 2E4HA 1N27A 2Y90A 2RJCA 1NPRA 4Z8AA 1X6OA 3M0TA 3SWNB 2GBQA 3G4SQ 4C92B 1QKXA 2XU8A 4OB0B 3X26B 4FW1A 5GAMf 5C0MA 4XTYA 5ECAA 4QW2A 3M59A 4ZNXA 3M0SA 5GAN8 2CDTA 3Q1JA 4M77E 4KGXB 5LL6S 3A8OB 1OX8A 3L2WA 4KUDK 3BDLA 3G6EQ 3CPFA 3G4SA 3NTIA 4E7JA 2H9RA 4J7FA 2JOYA 4EMGA 2GNCA 3CCET 1TXQA 2KXCA 1WI7A 3LGFA 2E3HA 2RHUA 4M78E 2RO0A 1PKTA 2RQYA 2MWOA 2DD5A 2O2OA 1E6HA 5GAMe 3G6EA 1MMNA 3CPWA 1VQ5Q 2EJFA 3NFCA 3VS4A 1R0CB 2GFAA 3BE3A 1N8RU 4AFUC 1D3BA 3QDFA 2CH4W 5GAN2 4XTUA 3QG1A 1PM3A 4C92G 2JS0A 4QVDA 1YJ9T 2QEXT 1D3BB 3G7ZA 3CC2Q 3L2RA 3CC4Q 3QWXX 1CKAA 2CZ0B 2W0ZA 1VQ5A 2RJDA 3KFVA 4BY6C 1K8AU 3QFZA 5KCHA 1AOJA 5HKCA 1PRMC 2JUFA 5LJ3g 3FJPA 2RD1A 3I56Q 2EYQA 4C8QE 1KQSA 5LJ3f 3FB9A 2LC4A 4E7HA 5GANd 4JZ3A 4PL6A 2A7YA 1QW1A 3CC2A 3OA6A 3PE0A 2YLCA 2RK2A 3CC4A 5LJ3h 4LDYA 1PWTA 3P8BB 1NZ9A 4PFPA 1Y0MA 2KY9A 1V1CA 5CKHA 2FB7A 3I56A 4OF1A 4YTLA 1TSFA 3PFSA 1UGSB 4ORZA 1Q86U 3M56A 3ACTA 3L2VA 3RMQA 3QWYA 1WHMA 1QKWA 2FVUA 1Q95G 1U5SA 4FSXA 3P8DA 1YN8A 2LX7A 1NJIC 2O9VA 1FYNA 2OTLQ 3EH2A 1PCXA 2J6KA 2KT1A 1SPKA 4GLMA 5FWCA 1X6GA 5HY6A 1QLYA 4KBMB 1WFWA 1LOJA 2RI3A 3ME9A 4AG2C 2E64A 3VS2A 1PHTA 2FYKA 4UC4A 2QI2A 4XTVA 2D6FA 1KQ1A 3WVDB 2KNBB 4LNPA 4BI3A 2VWFA 1K9MR 5CAIA 2DO3A 1XNIA 2X35A 4CC4B 2PVOB 2R57A 3EHRA 4JLGA 3J81E 3JCMd 4E7IA 3KBGA 4C0DB 1W1FA 3TCJA 3VU3C 1GRIA 2DAQA 4FYYB 4Y91A 3FLGA 2XMFA 2PNIA 2MAMA 4MDXA 1Q82R 4R0KA 2X51A 2DZ9A 2E1HA 1C6VX 1AWOA 4BUGA 3LYIA 3IM4A 1RUWA 2P0PA 3G36A 2JM9A 1BK2A 2XDBA 4M77D 3JCMc 1UHCA 4RTTA 3TEEA 2NUZA 4PJOE 1VQ6Q 2KYMA 3AFJA 3OYLA 2OX7A 2NUPB 4ELYC 1RABB 2CP6A 2LZ6B 3FRNA 2DLPA 3SD4A 4J5YA 3VS5A 4M7AC 4M78D 4F7UF 4E7LA 2QQBA 2DEUA 1OPKA 1VQ6A 2VUBA 2L0AA 4K11A 4IUPA 2QAZA 1VQPQ 2CZ1B 2P4TA 4M7AF 4XTZA 2AZVA 1YP5A 4LE9A 3C4SA 2J6OA 2ZCFB 3CMAQ 1OU9A 2LQKA 3JCMb 2QASA 1K1ZA 1RLQC 4IUTA 1V76A 2C0TA 3BW1A 2MYSA 1MNEA 4L59A 4LUEA 4RCBA 1IGUA 2HDAA 1VQPA 3CCRT 4C0ZA 5A0LA 2YUQA 4AFZC 1VQ8Q 3OBWA 3I5RA 2DYIA 3UA7A 4M77A 4IUUA 2CZ6B 5GMKi 1NYFA 3CMAA 3A1PA 3UPUA 1M8VA 2PUKB 1LJOA 5GAMj 1VQMT 3OS2A 2QGFB 3A8HB 1I81A 4M77B 1PRLC 2RN8A 5AT1B 2K4YA 2JS2A 1YJWT 1XJWB 2J06A 2MK5A 1VQ8A 4F16A 1NM7A 4JRQA 4RTXA 1N8RC 1Q7YR 1VQKT 3HFOA 5FU7B 3I35A 1WJSA 4OMLA 1U1SA 3ER0A 4A63B 3QPHA 2EQJA 1G3TA 3VUBA 1WXUA 4BACA 2DNUA 2IVWA 2DL7A 2LP5A 2ENMA 1UHFA 2FRYA 2EZWA 2F5KA 3GWHA 1NPPA 5EG2A 1X27A 1YIJQ 2X3XD 2Z0WA 4BI8B 4HCBA 3GPLA 4M4ZA 1T3LA 3RERA 1VQ9T 4CC3A 4DA4A 1S72T 1NLOC 4M77G 5KYYA 3QYHB 2F2VA 3QSUA 3CD6T 2CQTA 2QQSA 3MPUB 5KYYB 1OX9A 4FM4B 1KC8U 1YIJA 1NLPC 4IURA 2D8HA 2L3PA 2VKNA 2V8IA 4LUDA 1ZBJA 2KT8A 3VS1A 4DEYA 2JMAA 5GAOn 4M78G 4J8OA 1Q86C 4QVZA 2M02A 2DETA 4HCZA 1T0JA 2YXYA 3CCJT 4DBRA 2RB6A 3GNGA 3TSWA 3LWHA 5KYUA 3M4GA 4KT0E 5A0DA 3OSSC 2IG0A 3EGDA 3HRSA 1YI2T 1AEYA 4DEXA 1IZ6A 2HQXA 2WSEE 4HCKA 2ZPFB 5KYUB 3EGDB 2YDLA 1BKBA 1VQ4Q 2IPOB 5HK3A 3OYNA 2X3WD 2K9QA 3OYFA 3OW2S 2XICA 5A2QE 1YJNQ 4QQ6A 2DXBA 3E1SA 3CBPA 1G83A 1EFNA 2FRWA 5GAMd 3JCMe 2X4WA 1ABQA 2HL3A 4F7UE 2KROA 2LVMA 2B86A 1VQ4A 1IHWA 3NTKA 3JV3A 1IHVA 2HSEB 4A54A 1Y57A 5GMKl 2CT4A 1YJNA 1IXDA 2LJ1A 3RDVA 1QP3A 1X69A 2JTEA 2DE0X 3ZBDA 5AYFA 3F70A 2DTIA 1JQQA 2L2PA 2YRDA 4J9DA 3PIPA 2D0NA 4R56A 4HVVA 2K3YA 5FRNA 2YUNA 1YITA 5GMKh 1K0XA 3V8LA 2KVQG 2VASA 2LQ8A 1I0CA 1WHHA 1BI0A 2K9GA 3REAB 3CCUT 1BIAA 1MV3A 4LD6A 2KI7A 2KNGA 2DL3A 5LJ5f 2NWMA 5FLXE 1ZA2B 2FO0A 1Z9QA 3FEOA 2DX1A 3M53A 1ZHIA 1K73R 2VV5A 1QP2A 1UEBA 4KH1B 5IHKA 1YITT 2RHXA 4J9FA 1UGVA 1VYTA 3JCMV 4IUQA 3CMEQ 2HEQA 2NYSA 2RQTA 1BCMA 3JRZA 1OU8A 5LJ5e 2KXDA 3OYYA 5GAOr 1SSFA 1VQLT 3PVLA 1M3AA 2ZAEA 1UB4A 1YWPA 5GJVB 1M90R 5D6XA 3I55A 1WDXA 8AT1B 1BB9A 1QVGP 4RUGA 2MOXA 3CMEA 2C0OA 1KK7A 3QIIA 1I07A 3L2QA 2OI3A 1YHQT 4J9GA 3EG0A 3NTHA 3L1AA 4NL3A 1SEMA 1D1BA 4OB3B 4XAXB 2ZZDA 3OB9A 3GOXA 2M51A 1RACB 5HK0A 1BYMA 1NBEB 3BDUA 3MHXA 1G3WA 2JT4A 4BY6B 5KCOA 1WQ7A 1FMVA 2EKOA 2PU9B 6AT1B 3I55T 1ZBXA 4OMNA 2RJFA 5CK9A 2E3IA 2XD0A 3TVTA 1KD1R 4MMLA 1FMKA 3CCLQ 1L6EA 1W2BS 2QTXA 2FPFA 2LJ3A 3M54A 4OGEA 4PK4A 1T0HA 2A0FB 1UJYA 2DXCA 2DTHA 3QFYA 3KUFA 2AHJB 1BCOA 4LXCA 4CC2A 5I21A 4FCYA 2EGEA 1M1KR 1GL5A 4A4HA 3CCLA 4JRIA 2O31A 2MI6A 2DEQA 2K3XA 5M9OA 4FT2A 3RKYA 2RQUA 2KR3A 2E65A 1W4SA 3PGGA 4RMOA 1XQHA 2GCXA 3V8JA 3S4BA 2WACA 3M55A 4PJMA 1PSFA 2QQ9A 2GTOA 3WVEB 2SEMA 1KC8C 2E6NA 1QCNA 2C06A 2CP7A 1K76A 4X9CA 1M2OA 4JRKA 1ZA1B 2NLUA 4J6WA 2RQVA 1OZ3A 1KQ2A 4EMHA 4C0GA 1AWJA 3EG2A 1MMGA 4J7IA 4A4KA 2MF2A 4O5VA 8ATCB 3CCQT 1Q86R 3GBQA 2ZPHB 2CP2A 1K9AA 1UGPB 2JXBA 4KUIA 2K6DA 1PNJA 4IUVA 1SF9A 2LT1A 4JJNK 5CQYA 4ELZC 4PJJA 4FIBA 3QZ9B 1RADB 2RA2A 4D8KA 1PKSA 1X01A 3VS6A 5HCKA 3QKJA 3JB9I 2YUPA 2QXFA 1BI1A 1HK9A 3M58A 4RG2A 2P0QA 1OYXA 3HL8A 2DL5A 1W6XA 1GFDA 4F7UA 5HVZA 3G4ST 3MEWA 3OMGA 1QVGA 2DPPB 2A3LA 3M4YA 2CB9A 1B3QA 2CQSA 1OZ2A 4F7UB 1I4K1 1WHKA 4M7AA 2LCLA 4RTVA 4BDYA 2D9TA 1NYGA 3TU4K 3G6ET 4FL6A 1FMWA 4M7AB 2GQVA 3GLXA 2HSPA 4WF2A 3V8KA 2HMAA 3P8HA 3HHTB 1W2BP 5I2SA 3QUIA 3CBOA 1H641 3I9QA 2O88A 1VQ5T 3REBB 4OB2B 3FIFA 2SRCA 2X9HA 3DB4A 4IIMA 2DL4A 1OULA 3GIBA 2RI2A 5LJ3e 4OGCA 1O75A 1BI2A 2JJ9A 5LJ5j 1ZUUA 3MP8A 1PG5B 4ZGDB 1YFNA 1U06A 3CC2T 1NG2A 3VYHB 2VGNA 4F7UG 1TUDA 2XKOC 3CC4T 1X75C 2AIRB 2QQAA 3A98A 1IGQA 1WQWA 3I56T 2EAYA 4NOYA 3L2ZA 3VRYA 3VUZA 3CXCS 1EIFA 1ZQ1A 4XTXA 2YUOA 3NMZC 1RAHB 1WHGA 3PMTA 3HTRA 1M5Q1 2OTLA 3OYJA 4GY5A 1KSWA 1FWZA 2C0IA 1M1FA 1OEBA 5CVIA 1Y96A 4E2FB 3QJ6A 1CSKA 2RF0A 2P4RA 1N9SA 2DVEA 1Y96B 3SB2A 2CUDA 1VIEA 2M0YA 4BD3A 4BE0A 1VQ7Q 2DF6A 1QVFS 4HT9A 2QYZA 4N4IA 2A36A 3UT1A 1XTDA 1X43A 2OTLT 4L6V5 1YBYA 3MJXA 4FYXB 1HD3A 1MUZA 1BIBA 4AT1B 2DFUA 3MP6A 3J80E 1GBQA 1VQ7A 2NUPA 3JCMX 4MZTA 4JJCA 3UF4A 4FT4A 5KH6A 2HZYA 3UFEA 1WJRA 3OYEA 1U1TA 4LD9K 1JO8A 3GP8A 1VQOQ 4CI0C 2JW4A 2DL8A 1H3ZA 3EFOA 2L5QA 1NEBA 3RKXA 3URGA 3N5BB 1CKBA 3HKSA 3EFOB 3X20B 1MGQA 1PSEA 2EIFA 2RQWA 3UWNA 2H8HA 2QDLA 1JBMA 1ZUYA 1VQOA 4GBQA 5DLOA 2ED0A 5KYNA 5KE2A 3MP1A 2CZ7B 4AG1C 2XDDA 5LJ5d 3HSBA 2QDYB 2LCCA 2AKKA 4A53A 5CO7A 5GAN7 3QG0A 1M2VA 1WZOA 2PZ1A 1D09B 3SDZA 2QK0A 1W2BA 1TS9A 4EDUA 1KHCA 1K9MU 4RTUA 1M2VB 1YNZA 1RAGB 4XU2A 1N9RA 1VQ6T 2M1HA 4PJLA 1X2KA 2KMTA 2BKDN 2LNVA 3A8LB 5IHNA 1U8RA 4OMQA 1UGQB 7AT1B 3VJPA 1C0MA 2MWPA 4ZTFA 3OYDA 5DY9A 2EGAA 2EYWA 2B8AA 3EFRA 2AZSA 2RK1A 1VQPT 3RR6A 4ESRA 4C5IA 5IXBA 3CXCP 4F9KA 4EMKC 3C94A 5GANg 1P92A 2RNAA 3OS5A 1JJ2S 2DXUA 3QXEB 4DBQA 3CMAT 5FU6C 2OTJQ 1M3CA 2FHDA 2L3RA 4X1VA 2O9SA 3CCSQ 5GANh 1K8AC 3SHWA 2O4XA 5L23A 1KG1A 1TH7A 4CRIA 4C5HA 2V1RA 1VQ8T 4ZP3A 2O4XB 3TQ7P 1V29B 2L3SA 3H8ZA 4RG8A 1TUCA 2OTJA 3DLLA 3JSCA 3H6ZA 3QZ5B 4N4HA 4E7ZA 3CCSA 1I8FA 3G71Q 4Z88A 2ZGWA 5CR2A 2VYTA 5GAN6 1VYUA 5LJ3j 2XHCA 4PJNA 4ZN3A 4OVAA 4FSSA 2KYBA 3GNFB 2EQUA 3PVQA 2RI5A 4QVCA 1ARKA 4N0AC 3DB3A 2CSQA 2DJQA 4M7DC 3OS0A 3CEYA 5DM7R 3G71A 2QG9B 3U23A 2FZKB 4RTZA 1B34A 2PVDB 3O8VA 4M75C 2F2XA 5GAOq 1H8KA 4XTWA 2DILA 4M7DF 1B34B 1MV0B 3CCMQ 2IIMA 3J7AF 2RMOA 2DKGA 1YIJT 1M8MA 4M75F 2QA4Q 5IHIA 3HPWA 4P5NA 4V2SA 1KQSS 1TU0B 1NJIR 2G3RA 2ROTA 1NE8A 2R5MA 3CCVQ 1I1JA 3R6NA 3CCMA 1Q7YU 1AHJB 2O01E 1G3SA 1RLPC 2QA4A 1QQJA 4AFQC 1N6AA 2CREA 4M7AE 3PMIA 3CCVA 4EIKA 2XK0A 2EW3A 3JAME 2CKKA 2F1LA 3TREA 1WX6A 3V7CA 4QQDA 3PNWC 3IQLA 3T9NA 2VGMA 1VA7A 1WA7A 2RHYA 3QDRB 4XK8E 4E7KA 2FEIA 5CQXA 4JZ4A 3HP9A 1UTIA 2J7IA 2DA9A 1VUBA 1BU1A 4BE2A 1VQ4T 1M9SA 2LX9A 1G5VA 4LDUA 2E5KA 5D7UA 2KYGA 1SSHA 1YJNT 1R0BG 2HNIA 4M77F 1TTHB 3CXCA 3CBMA 1ABOA 2DRKA 1JJ2P 4M78C 4GLKA 4B6MA 5GMKe 1ZX6A 1NEGA 2YT6A 1GCPA 1Q81U 2COZA 2OUTA 4J9EA 4M78F 3X25B 2CSIA 4ZN1A 4KRTA 1M1GA 1R2AA 1VQNQ 5LJ3d 2HAXA 4DBHA 2EYYA 4XQ3A 4E7SA 2PVGB 3INZA 2LTOA 1UDLA 2JN0A 2K2MA 3D7SB 4JS5A 2J05A 4OMFB 2E5QA 5CKEA 1EZZB 1VQNA 3BY7A 1KJWA 3META 1WGSA 3E9GA 4TVRA 4C8QC 3OYKA 1K9MC 3RIRA 2HD0A 4OP0A 1UG1A 2KGTA 4RTYA 3UDCA 2DYBA 4FW2A 2AT1B 5GAN4 1D1CA 2CP5A 3HFNA 3EH1A 1K0SA 4C8QF 2K5FA 5GAOp 4WCIA 2MMPA 2BE9B 3H0IA 3MEUA 3OYHA 1X6BA 3CC7Q 3H0HA 2R58A 1RI9A 1AVZC 1GFCA 1YCSB 3CMET 2I2LA 4JDSA 1M30A 2XDPA 3OW2P 3BFMA 1F1BB 2JTMA 3V7SA 4J9BA 3LH5A 5EC7A 1OPLA 4ZGEB 4DOWA 1IB8A 3CC7A 3MKDA 2OAUA 3OYMA 2A08A 1N8RR 5CIUA 3MEVA 2VXFA 4IKFA 2LRQA 2X4XA 4C5EA 4A4FA 4KH0B 5CKDA 3TSZA 2OJ2A 5IT9E 3OYIA 1K73U 5A0GA 5IH2A 4LDWA 1UFFA 2X4YA 2D1XA 1K8AR 4AMCA 2RJEA 3CCEQ 2X4JA 4HCCA 3HRTA 3EG3A 2K79A 2CGHA 1LVKA 1JXMA 3RSYA 3EAEA 1UJ0A 5IAYA 1M90U 1GCQC 2K7AA 3CCLT 2GFUA 4M7AD 3CCEA 2PTKA 3JCMJ 4J9IA 2ZPBB 1SKUB 2E70A 3WXMB 2I15A 1JJ2A 1YJ9Q 4AFSC 2QEXQ 5GAMg 2G6FX 4PNOA 2GF7A 3C12A 2JZ2A 2COYA 1M27C 3JCMP 2JTFA 1W70A 2RHZA 4PJOC 5GAMh 4J6XA 2KAFA 3JB9F 4FYWB 2ROLA 2V1QA 3QDEA 3RESA 2DERA 2DIGA 2ZPGB 2EQMA 1YJ9A 2EFIA 2QEXA 4X9DA 1UUEA 2BE7D 1Q7YC 4HT8A 1TOVA 4PJOF 2CP0A 1MNDA 2V8JA 3THKA 3A8GB 3X24B 3PTAA 1KD1U 2XI9A 1HSQA 2DJZA 3H9NA 1SHGA 4F14A 1HXDA 1N5ZA 1ZUKA 1JB0E 4NL2A 1PD0A 5I2MA 1AD5A 2JNGA 1JU5C 2EYZA 4X34A 3LH0A 2DTOA 1M1KU 4L5GA 4MMKA 2DRNA 4XU0A 1ZSZC 2P0KA 4JUVA 2F2WA 2E6ZA 2LMJA 2L3QA 3C95A 4ME7A 2DBMA 1E7OA 4MDWA 2AKLA 2JMCA 1QCFA 4OB1B 4JJDA 2BUDA 5GMKj 1OOTA 3QHSA 9ATCB 3OW2A 4PFOA 5CKFA 1IREB 3LWIA 3S4DA 5I22A 1BBZA 2EJGA 3S3NA 3PIOA 1Q81C 2FPDA 3NHNA 4C0FA 3M0QA 4XU3A 3DKMA 1Y7XA 3ASKA 3S4CA 2DBKA 1QVPA 2F69A 5KYXA 3L2UA 2ESWA 4HVWA 2YRVA 4M7AG 1JRIA 4DBFA 5KYXB 3JB9H 2EPDA 5J3BA 2Y4XA 2ED1A 4M7DD 4EMKA 2LQNA 2VXEA 1WPYA 3OYCA 4A4GA 4F17A 2YWWA 5I11A 4M75D 4E47A 1M3BA 1SHFA 3OSVA 4EMKB 2DM1A 3SWNC 4C92C 2BZXA 2ZPIB 3JCMQ 5FU6B 2HBPA 2LNHB 3LW5E 2CP3A 2I0NA 2CUBA 1RAEB 4C92F 2YRCA 4Y28E 1MHNA 1SRMA 1VIFA 3UA6A 1RL2A 2FG0A 1WJQA 4WTOB 1E6GA 4LDXA 4E6RA 2K57A 1AT1B 2DZCA 3UATA 5FRMA 2CT3A 2HKQB 1I5OB 1UGRB 1DJ7B 3OYGA 4N0AA 3QJYA 4M7DA 3X28B 1IRXA 4RTAA 1FXXA 1QWEA 3ACSA 2HKNA 1EX4A 4F04B 4M75A 2LT4A 2ECZA 4M7DB 3LX7A 4FU6A 1K73C 3CCRQ 3VS7A 4PLIA 1S1NA 4M75B 5CKBA 4KGZB 2CBGA 2XG8D 1WYXA 2EBPA 3VYGA 3CQTA 1VQMQ 1VQ7T 1QWFA 1WIEA 2E41A 4JJBA 3FDRA 2EYXA 2K5IA 2W10A 3CCRA 4CC7A 3EGUA 3H41A 5DLQE 1YJWQ 1Y07A 1M90C 3SEMA 3FC3A 2WSFE 3S4AA 1R8OB 2DIQA 4PLLA 2ABLA 2LQWA 3MEAA 1KC8R 1VQKQ 4Z89A 3M57A 1VQMA 1OV3A 4VUBA 4LN2A 4JPBW 4KGVB 1JEGA 3MCAB 1H92A 3HRUA 2V26A 3OMCA 1YJWA 5J26A 4M7DG 2GTJA 1WLPB 1VQOT 2DRMA 4N4GA 3QYGB 4A4EA 1VQKA 1HYOA 4M75G 1RAIB 3RRSA 1XOVA 1BI3A 5L8RE 3IM3A 1YWOA 4J9HA 2H3EB 1Q82U 1VQ9Q 4C8QD 1QMCA 1S72Q 1D0YA 1KD1C 4IIOA 3QBYA 3JB9J 3OS1A 3CD6Q 3EG1A 1KFZA 5GANf 1U3OA 4EPCA 2R5AA 4FYVB 4M78A 1GXIE 1VQ9A 2KRSA 3OY9A 1S72A 1Y71A 1I5LA 3S6WA 3ZEHA 1M1KC 4M78B 4BE1A 2CYZB 3OQ5A 2EKHA 4MZMA 3CCJQ 3CD6A 1D0ZA 1QVFP 2V8KA 1G8XA 4C0DC 2JM8A 1YI2Q 1HJDA 2EQKA 4QQGA 1FX7A 1MMAA 2RH2A 2HBWA 3M9QA 5GANe 1SG5A 2KK4A 2OAWA 3CCJA 1LPLA 2E12A 4JRPA 3VV0A 4C8QA 3CPWS 1RI0A 1MMDA 4PKCC 1YI2A 1WXTA 4C92E 2GQIA 5D6YA 4DQ2A 2CH4A 4C8QB 2DVJA 2WSCE 3L42A 1T3SA 1WHJA 3OYBA 4LDVA 2OTJT 2KE9A 3CCST 5GJWB 2FZCB 3G1JA 1QVGS 2K3BA 3M5AA 2KRNA 3EG9A 2KEAA 1UE9A 5D6WA 2DD4A 2D8JA 3JCMg 5IN1A 1Q81R 3EG9B 3JCMf 3EGXA 2VC8A 2YSQA 5KYWA 4QKUA 1PD1A 5C6SA 3S3MA 1LCKA 2K2VA 4ATOA 1K4US 4QT7A 3G71T 4NS5A 3JCMh 2KBTA 1AZGB 3EGXB 3ULRB 1VOMA 4HVUA 2D0QB 1R77A 5KYWB 1AZEA 4II1A 2YLBA 4ZGJB 2FPEA 1TUGB 2GGRA 2AK5A 1D0XA 1KIKA 1JXOA 3KXTA 3CCUQ 2J6FA 1C1AA 3JB9D 1ZSGA 3RNJA 2A37A 3A5ZB 3RUXA 3NPFA 4B9WA 4J9CA 2QTVA 3GF5A 1ACMB 2BZ8A 2E10A 3FJ5A 3AHUA 4C8QG 1OI1A 4RCCA 2RPNA 2EWNA 4PJOD 2YHTA 4OMPA 5IXFA 4OMMA 5GAOm 3M0PA 3I5SA 1B7TA 3NGPA 3VS0A 4D6WA 3LGLA 2EVRA 5GMKm 3CCUA
chains in the Genus database with same CATH topology
5A0GA 3CC2T 3VYHB 2VGNA 3MO8A 4M77A 4LDWA 4IUUA 2XKOC 2CZ6B 4F7UG 5GAOl 3CC4T 3CCMT 1X75C 5GMKi 3CMAA 2QQAA 3UPUA 2X4YA 1M8VA 2PUKB 1LJOA 4M77C 5GAMj 1VQMT 3OS2A 3A8HB 2QQRA 2RJEA 1I81A 4M77B 1WQWA 2QA4T 2X4JA 5CCAA 3I56T 2DXTA 2EAYA 2K4YA 4NOYA 3L2ZA 4HCCA 1YJWT 3HRTA 2CGHA 3VUZA 3RMSA 1VQ8A 4ZTJA 3CXCS 3EAEA 1EIFA 1ZQ1A 4MZPA 4XTXA 3CCVT 4JRQA 3PMTA 5IAYA 3S3OA 2FL7A 1N8RC 1M90U 1M5Q1 4RKUE 2OTLA 5FU7C 3CCLT 1VQKT 3OYJA 3HFOA 2GFUA 5FROA 5FU7B 3R6OA 4GY5A 4M7AD 1FWZA 5LJ5g 1M1FA 1WJSA 3CCEA 1U1SA 3ER0A 5CVIA 1Y96A 3JCMJ 3QJ6A 2ZPBB 2E70A 3QPHA 3WXMB 2EQJA 1K73U 1G3TA 3DLMA 1JJ2A 3VUBA 1VQLA 5GAMg 3E19A 3LLRA 4BACA 1N9SA 2DVEA 4PNOA 2IVWA 1Y96B 2GF7A 5LJ5h 3C12A 3PT9A 2JZ2A 3EFSA 3SB2A 4PJOA 1VIEA 2KQWA 4BD3A 3JCMP 2F5KA 2JTFA 3GWHA 1NPPA 2RHZA 5EG2A 4BE0A 1QVFS 4HT9A 1QVFA 4PJOC 4N4IA 4BI8B 5GAMh 4HCBA 2RM4A 4J6XA 2KAFA 3UT1A 1XTDA 1O9SA 3GPLA 3JB9F 4PJOB 3RESA 5J39A 3RERA 1VQ9T 2DIGA 1G3YA 2EQMA 2ZPGB 4DA4A 1S72T 4L6V5 1YBYA 4M77G 4R55A 1YHQA 2OTLT 3QYHB 1YJ9A 2EFIA 3JCMW 1NJIU 2QEXA 4X9DA 1Q7YC 4HT8A 3V7RA 2RHIA 4PJOF 3VKIA 1BIBA 3QSUA 2HQEA 2V8JA 3A8GB 4JLIA 3X24B 3PTAA 3CD6T 1KD1U 2XI9A 2QQSA 3MP6A 3J80E 3OYAA 4FM4B 2DJZA 1KC8U 1YIJA 1VQ7A 3JCMX 4IURA 4B9XA 2EJ9A 4MZTA 2V8IA 1HXDA 4FT4A 2PQWA 5GAOn 4M78G 4J8OA 5KH6A 1Q86C 1JB0E 2H3JA 4NL2A 5I2MA 4BI4A 3UFEA 1WJRA 2L89A 2JNGA 4QVZA 3OYEA 1U1TA 4LD9K 2M16A 4X34A 3LH0A 2DTOA 4C5GA 3GP8A 4HCZA 4CI0C 4DOVA 2F5TX 4L5GA 3ZFJA 3CCJT 1M1KU 3SFMA 2DK3A 4MMKA 1H3ZA 2RB6A 2M9UA 4BB7A 2L5QA 2L8DA 4XU0A 3GNGA 5GAN3 3LWHA 1Q82C 2P0KA 3JB9G 1M4ZA 3M4GA 4JUVA 4KT0E 3RKXA 5A0DA 1VQNT 3OSSC 2E6ZA 2IG0A 3N5BB 3HRSA 3URGA 3HKSA 4BDZA 1YI2T 3A8MB 5GAN5 3C95A 3QO3A 1LNXA 1WNLA 1IZ6A 2HQXA 1MGQA 2K5LA 2WSEE 3X20B 4ME7A 1PSEA 2ZPFB 2EIFA 3UWNA 4MDWA 4KULA 2CS7A 4PJOG 2JVVA 1JBMA 1VQOA 1BKBA 4OB1B 4C92D 5DLOA 2BUDA 4M7DE 5GMKj 5HK3A 3OYNA 4XU1A 5KE2A 2K9QA 2LDMA 3MP1A 3QHSA 2CZ7B 3OYFA 2XDDA 5LJ5d 2PUOB 3OW2S 2XICA 3RKWA 5A2QE 3OW2A 3HSBA 4QQ6A 1IREB 4M75E 2QDYB 2LCCA 5CKFA 3LWIA 4J6YA 2DXBA 4A53A 3E1SA 5CO7A 5KE3A 3CBPA 4Z02A 5GAN7 2KDSA 2KSSA 2EJGA 3SDZA 5GAMd 3S3NA 3JCMe 3PIOA 2X4WA 1W2BA 4EDUA 4F7UE 3OBYA 1Q81C 2LVMA 2M0OA 5GANj 1KHCA 1K9MU 4HKEA 4C0FA 4XU2A 4XU3A 1VQ4A 3DKMA 4O6JA 1N9RA 2ZPEB 1VQ6T 3NTKA 1Y7XA 2M1HA 3ASKA 4A54A 1QVPA 5GMKl 2F69A 1YJNA 2KMTA 2BKDN 2LNVA 3L2UA 3A8LB 1QP3A 1U8RA 4J83A 1UGQB 2YRVA 4M7AG 3CC7T 1JRIA 3ZBDA 5AYFA 3F70A 3VJPA 2DTIA 3JB9H 5J3BA 3PIPA 2XIDA 1KHIA 2MWPA 2Y4XA 4HA8A 4R56A 4ZTFA 2K3YA 3OYDA 5DY9A 5FRNA 4M7DD 2B8AA 3EFRA 4EMKA 3CCQA 2RK1A 2VXEA 1YITA 5GMKh 1VQPT 1WPYA 3E9FA 3V8LA 2BIVA 2KVQG 4A4GA 4C5IA 3OYCA 1YCYA 2LQ8A 2Y4YA 4M75D 4EMKC 4E47A 1BI0A 3C94A 3SWNA 5GANg 4JS4A 1P92A 4C92A 3CCUT 3OSVA 4EMKB 1BIAA 4LD6A 4Q5WA 2KNGA 5LJ5f 3OS5A 1JJ2S 2DXUA 3SWNC 1N27A 3QXEB 3CMAT 5FU6C 4C92C 2Y90A 5FLXE 2RJCA 1NPRA 2FHDA 1X6OA 2L3RA 3SWNB 2ZPIB 3JCMQ 5FU6B 4C92B 2HBPA 3FEOA 2XU8A 4OB0B 5GANh 3LW5E 3X26B 5GAMf 1K8AC 2O4XA 5C0MA 4XTYA 4QW2A 1KG1A 3M59A 3M53A 1TH7A 4CRIA 4C5HA 4C92F 1ZHIA 5GAN8 1VQ8T 2VV5A 3Q1JA 4M77E 5LL6S 2O4XB 4Y28E 3A8OB 1QP2A 1UEBA 1V29B 1MHNA 3H8ZA 4RG8A 3L2WA 4KUDK 1VIFA 3BDLA 2OTJA 3DLLA 3JSCA 1RL2A 3CPFA 2RHXA 3H6ZA 1YITT 3QZ5B 4N4HA 3CCSA 3G4SA 3NTIA 4E7JA 4J7FA 3JCMV 4IUQA 2JOYA 1I8FA 4EMGA 1WJQA 3CCET 2ZGWA 3LGFA 3JRZA 4LDXA 2K57A 2DZCA 5LJ5e 2RHUA 5FRMA 5CR2A 2VYTA 4M78E 2RO0A 3OYYA 5GAN6 5GAOr 1SSFA 1VQLT 2MWOA 2RQYA 2DD5A 1UGRB 5LJ3j 1UB4A 2XHCA 1DJ7B 3OYGA 4ZN3A 4OVAA 4N0AA 3QJYA 5GAMe 5D6XA 3X28B 3GNFB 2EQUA 3G6EA 4M7DA 2RI5A 3I55A 3CPWA 4QVCA 2EJFA 3NFCA 4N0AC 3DB3A 2GFAA 1FXXA 1N8RU 4M7DC 3OS0A 3CEYA 4M75A 5DM7R 3G71A 3CMEA 1D3BA 2LT4A 5GAN2 4M7DB 3QIIA 3LX7A 4XTUA 4FU6A 3QG1A 1B34A 2PVDB 3O8VA 4C92G 4QVDA 3L2QA 1K73C 4M75C 1YHQT 4PLIA 1YJ9T 3NTHA 5GAOq 4M75B 3L1AA 4XTWA 4NL3A 1D3BB 2QEXT 5CKBA 3G7ZA 3L2RA 2CBGA 2XG8D 4OB3B 4XAXB 4M7DF 1B34B 2ZZDA 3OB9A 3VYGA 3GOXA 2CZ0B 5HK0A 1VQ5A 3J7AF 1BYMA 2RJDA 2DKGA 3BDUA 1YIJT 1VQ7T 4BY6C 1K8AU 4M75F 3MHXA 1G3WA 5KCHA 5HKCA 2JUFA 2E41A 3FJPA 2RD1A 3HPWA 4BY6B 4P5NA 5KCOA 5LJ3g 3FDRA 2EYQA 4V2SA 2K5IA 1KQSS 4C8QE 1WQ7A 1KQSA 3CCRA 5LJ3f 3FB9A 2EKOA 2PU9B 5DLQE 2G3RA 2LC4A 3I55T 1Y07A 1ZBXA 4E7HA 1M90C 5GANd 2RJFA 1NE8A 3FC3A 4PL6A 2WSFE 5CK9A 2A7YA 1QW1A 3CC2A 2R5MA 1R8OB 2DIQA 3OA6A 2XD0A 2YLCA 2RK2A 4PLLA 3CC4A 5LJ3h 4LDYA 3CCMA 4MMLA 3MEAA 1Q7YU 1AHJB 3P8BB 1W2BS 1NZ9A 2O01E 2QTXA 3M57A 1VQMA 3M54A 1G3SA 2KY9A 4OGEA 4VUBA 2QA4A 5CKHA 2FB7A 3I56A 4OF1A 4YTLA 3MCAB 3HRUA 2DXCA 2DTHA 3OMCA 1YJWA 3PFSA 1UGSB 3KUFA 2AHJB 5J26A 4M7DG 1N6AA 5I21A 1Q86U 4M7AE 1VQOT 3M56A 4N4GA 3PMIA 3QYGB 3CCVA 3L2VA 4A4EA 4A4HA 3RMQA 2XK0A 1VQKA 3CCLA 4JRIA 4M75G 2FVUA 3JAME 2CKKA 2MI6A 2DEQA 2K3XA 3TREA 4FT2A 3V7CA 3RKYA 5M9OA 4FSXA 1XOVA 1BI3A 4QQDA 5L8RE 2E65A 3P8DA 3PNWC 1NJIC 1W4SA 3T9NA 2VGMA 3PGGA 4RMOA 1XQHA 2GCXA 1Q82U 2RHYA 3V8JA 4C8QD 3QDRB 4XK8E 4E7KA 2WACA 3M55A 1KD1C 1PSFA 5CQXA 3QBYA 2QQ9A 3HP9A 3WVEB 3JB9J 1KC8C 5HY6A 1VUBA 3OS1A 4KBMB 2E6NA 4BE2A 1VQ4T 2C06A 1M9SA 2LX9A 5GANf 4LDUA 1G5VA 1LOJA 2RI3A 3ME9A 4X9CA 4EPCA 2R5AA 2E64A 2FYKA 4M78A 4JRKA 4UC4A 1YJNT 2QI2A 2NLUA 4XTVA 2D6FA 2HNIA 4J6WA 4M77F 1KQ1A 3CXCA 1GXIE 3CBMA 3WVDB 1VQ9A 4BI3A 3OY9A 4M78C 1S72A 1Y71A 1I5LA 3S6WA 3ZEHA 1M1KC 1OZ3A 1KQ2A 4EMHA 4GLKA 4M78B 4C0GA 5CAIA 2CYZB 3OQ5A 4BE1A 2DO3A 4J7IA 5GMKe 4MZMA 1XNIA 3CD6A 2X35A 1Q81U 4A4KA 2OUTA 2PVOB 2MF2A 4O5VA 3CCQT 2R57A 4M78F 3X25B 4JLGA 4ZN1A 1M1GA 2V8KA 4C0DC 5LJ3d 3JCMd 3J81E 4E7IA 2ZPHB 2EQKA 1UGPB 4QQGA 2HAXA 4KUIA 3KBGA 4C0DB 4XQ3A 1FX7A 4IUVA 3TCJA 2PVGB 2RH2A 2DAQA 3VU3C 3M9QA 5GANe 3INZA 2LT1A 4JJNK 5CQYA 4Y91A 4ELZC 3FLGA 4FIBA 2LTOA 2KK4A 3QZ9B 2JN0A 2MAMA 4MDXA 4JS5A 3CCJA 4OMFB 2E12A 2RA2A 1X01A 2E5QA 5CKEA 4JRPA 3VV0A 2DZ9A 3JB9I 4C8QA 3QKJA 3CPWS 2E1HA 2QXFA 1VQNA 3BY7A 1RI0A 4PKCC 1YI2A 1BI1A 3META 1HK9A 1WGSA 4C92E 4BUGA 3E9GA 4TVRA 4C8QC 3LYIA 3M58A 4RG2A 3OYKA 2P0QA 5D6YA 4DQ2A 2P0PA 4C8QB 1K9MC 3RIRA 2HD0A 1OYXA 3HL8A 4OP0A 2WSCE 3L42A 3OYBA 4LDVA 2OTJT 3UDCA 2XDBA 4F7UA 5GAN4 3CCST 3HFNA 3G4ST 4M77D 3JCMc 3MEWA 3TEEA 3OMGA 1QVGS 1QVGA 4PJOE 2DPPB 4C8QF 3OYLA 2K5FA 2A3LA 3M5AA 2CB9A 3M4YA 5GAOp 4ELYC 1OZ2A 2MMPA 4F7UB 1I4K1 5D6WA 2DD4A 3MEUA 3JCMg 2LCLA 5IN1A 3OYHA 4BDYA 3FRNA 2D9TA 4M7AA 3SD4A 4J5YA 3JCMf 3TU4K 3G6ET 2VC8A 4M7AC 4M78D 4F7UF 4E7LA 2R58A 3S3MA 4FL6A 5C6SA 2QQBA 4M7AB 2K2VA 4ATOA 3CMET 2GQVA 3G71T 2I2LA 4NS5A 3JCMh 1VQ6A 2VUBA 4JDSA 3GLXA 4WF2A 2XDPA 2D0QB 4IUPA 3BFMA 4II1A 2YLBA 3V8KA 2CZ1B 4ZGJB 2P4TA 4M7AF 2JTMA 4XTZA 3V7SA 3KXTA 3P8HA 3JB9D 3C4SA 4ZGEB 3HHTB 3A5ZB 4DOWA 5I2SA 3RUXA 3CC7A 3QUIA 3CBOA 4B9WA 1H641 3GF5A 2ZCFB 1VQ5T 2LQKA 2E10A 4OB2B 3JCMb 2OAUA 3OYMA 3AHUA 4C8QG 1OI1A 3FIFA 4RCCA 5CIUA 4IUTA 2EWNA 2VXFA 3DB4A 3MEVA 4IKFA 2LRQA 3BW1A 2X4XA 4PJOD 2YHTA 4L59A 4C5EA 4RCBA 4A4FA 3GIBA 5GAOm 2RI2A 3CCRT 1VQPA 4C0ZA 5CKDA 5LJ3e 4OGCA 1O75A 1BI2A 5A0LA 4D6WA 5IT9E 5LJ5j 3MP8A 3OBWA 4ZGDB 3LGLA 3OYIA 5GMKm 3CCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYG A;  3MO8 A;  4IUU A;  4OVA A;  4BE1 A;  3OQ5 A;  5D6X A;  2EQU A;  2RI5 A;  2X4Y A;  1XNI A;  2BUD A;  3OS2 A;  2X35 A;  3DB3 A;  2GFA A;  2QQR A;  5KE2 A;  2RJE A;  3OYN A;  3OYF A;  2LDM A;  3MP1 A;  3CEY A;  3OS0 A;  2R57 A;  3QII A;  3LX7 A;  4E7I A;  4QQ6 A;  4FU6 A;  2LCC A;  3O8V A;  2EQK A;  3L2Q A;  4QQG A;  5KE3 A;  4PLI A;  4IUV A;  4Z02 A;  3NTH A;  2DAQ A;  4ZTJ A;  3EAE A;  3M9Q A;  3S3N A;  3L2R A;  2X4W A;  3PMT A;  4EDU A;  5IAY A;  3S3O A;  3OB9 A;  2LVM A;  3FLG A;  3GOX A;  2M0O A;  2LTO A;  1KHC A;  3OYJ A;  2RJD A;  2GFU A;  5FRO A;  4GY5 A;  2E5Q A;  3NTK A;  2M1H A;  5KCH A;  3ASK A;  1WJS A;  3QKJ A;  5KCO A;  3FDR A;  1RI0 A;  3QJ6 A;  2BKD N;  3MET A;  1WGS A;  2EQJ A;  3L2U A;  3E9G A;  3DLM A;  2EKO A;  3LYI A;  2G3R A;  4RG2 A;  3OYK A;  4E7H A;  5D6Y A;  2RJF A;  2YRV A;  3FC3 A;  4PL6 A;  4BAC A;  1OYX A;  3LLR A;  3ZEH A;  2R5M A;  2DIQ A;  3L42 A;  2GF7 A;  3OYB A;  3OA6 A;  3F70 A;  4PLL A;  2JZ2 A;  2MWP A;  3MEA A;  4BD3 A;  2F5K A;  2JTF A;  4ZTF A;  2RHZ A;  3MEW A;  2K3Y A;  3OMG A;  3OYD A;  5FRN A;  4BE0 A;  2B8A A;  3OYL A;  4N4I A;  3UT1 A;  3E9F A;  1OZ2 A;  3OYC A;  2BIV A;  4A4G A;  4C5I A;  5J39 A;  2DIG A;  5D6W A;  3OMC A;  2EQM A;  3MEU A;  3PFS A;  5IN1 A;  3OYH A;  4BDY A;  2D9T A;  2EFI A;  3KUF A;  5J26 A;  4LD6 A;  4Q5W A;  3SD4 A;  1N27 A;  3PMI A;  2RHI A;  4N4G A;  3L2V A;  2HQE A;  2RJC A;  4A4E A;  4A4H A;  2R58 A;  2FHD A;  2L3R A;  4FL6 A;  2XK0 A;  5C6S A;  4E7L A;  3S3M A;  2QQS A;  3MP6 A;  3OYA A;  2CKK A;  3FEO A;  2K3X A;  5M9O A;  4NS5 A;  4IUR A;  4B9X A;  2O4X A;  4QQD A;  5C0M A;  2XDP A;  3P8D A;  3PNW C;  4QW2 A;  2PQW A;  4IUP A;  4II1 A;  4CRI A;  5KH6 A;  2RHY A;  4C5H A;  3Q1J A;  1WJR A;  2L89 A;  2O4X B;  3P8H A;  4QVZ A;  2WAC A;  3OYE A;  4E7K A;  3C4S A;  3QBY A;  2M16 A;  4X34 A;  3LH0 A;  1MHN A;  3H8Z A;  4B9W A;  4C5G A;  3L2W A;  4HCZ A;  3BDL A;  3H6Z A;  2RHX A;  3OS1 A;  1H3Z A;  2E6N A;  4N4H A;  4BE2 A;  3OYM A;  1OI1 A;  3NTI A;  5CIU A;  1G5V A;  4E7J A;  4IUT A;  4IUQ A;  2RI3 A;  2L8D A;  3DB4 A;  3ME9 A;  3MEV A;  2LRQ A;  2R5A A;  1WJQ A;  2P0K A;  2X4X A;  4IKF A;  4L59 A;  4C5E A;  4UC4 A;  3LGF A;  2NLU A;  2IG0 A;  4A4F A;  4BDZ A;  2RI2 A;  2RHU A;  5FRM A;  2VYT A;  2RO0 A;  1SSF A;  3OY9 A;  2MWO A;  2HQX A;  3MP8 A;  3S6W A;  3LGL A;  3OYI A;  1OZ3 A;  3UWN A; 
#chains in the Genus database with same CATH topology
 4D8D A;  2VB6 A;  3MO8 A;  3M0R A;  5GAO l;  1TWB A;  3CCM T;  3M0U A;  1B07 A;  4HXJ A;  3ZL7 C;  1YIT Q;  4M77 C;  1G2B A;  2QQR A;  2QA4 T;  1QCO A;  5CCA A;  2DXT A;  2IZY A;  1VQL Q;  1GCQ A;  3RMS A;  4ZTJ A;  3VRZ A;  4MZP A;  3CCV T;  5FWB A;  2FL7 A;  3S3O A;  4RKU E;  2HQH A;  5FU7 C;  5FRO A;  3R6O A;  5LJ5 g;  4ANJ A;  1J3T A;  3DLM A;  1YHQ Q;  1VQL A;  3E19 A;  3LLR A;  5LJ5 h;  3PT9 A;  3EFS A;  2EGC A;  4PJO A;  1GBR A;  2KQW A;  3AT1 B;  1QVF A;  2RM4 A;  1O9S A;  4PJO B;  5J39 A;  1AWX A;  1UEC A;  1G3Y A;  1YHQ A;  4R55 A;  3I55 Q;  1NJI U;  3JCM W;  1AWW A;  3RBB B;  3V7R A;  2RHI A;  3VKI A;  2HQE A;  4JLI A;  3CPW P;  2LJ0 A;  4RIQ A;  2ATC B;  2FZG B;  3OYA A;  2A28 A;  1X2Q A;  4B9X A;  2EJ9 A;  5FW9 A;  2PQW A;  2COW A;  2KRM A;  1IO6 A;  2H3J A;  4BI4 A;  2L89 A;  1H3H A;  2M16 A;  3H0F A;  2DMO A;  4OMO A;  1A0N B;  4C5G A;  3C0C A;  1ZSZ A;  2F5T X;  4DOV A;  3ZFJ A;  2MIO A;  1PC0 A;  2DK3 A;  3SFM A;  2M9U A;  4BB7 A;  2L8D A;  3VS3 A;  5GAN 3;  1Q82 C;  4RTW A;  1ZLM A;  3JB9 G;  1M4Z A;  1WHL A;  1WXB A;  2P84 A;  1VQN T;  2RQR A;  1ZSZ B;  4BDZ A;  3A8M B;  1KQS P;  5GAN 5;  1VYV A;  3QO3 A;  1LNX A;  1WNL A;  4RT4 A;  2K5L A;  2BZY A;  2QGG A;  4KUL A;  1TG0 A;  2CS7 A;  4PJO G;  2JVV A;  4C92 D;  3O5Z A;  4M7D E;  1SRL A;  4XU1 A;  2LDM A;  1RAF B;  2NUT A;  2PUO B;  3RKW A;  2MPX C;  4M75 E;  4J6Y A;  5KE3 A;  4Z02 A;  2LCS A;  2KDS A;  1Z9Z A;  2NUT B;  2KSS A;  2VVK A;  3OBY A;  1OQK A;  2M0O A;  5GAN j;  4HKE A;  4O6J A;  2ZPE B;  3CCQ Q;  4J83 A;  3EHQ A;  3CC7 T;  2MCN A;  2HCK A;  2HL5 C;  2XID A;  1KHI A;  4HA8 A;  3E2U A;  2EQI A;  4PFZ A;  3CCQ A;  1RAA B;  3E9F A;  2BIV A;  4Y92 A;  1YCY A;  2Y4Y A;  3SWN A;  1D1A A;  4JS4 A;  4C92 A;  4Q5W A;  2BTT A;  2E4H A;  1N27 A;  2Y90 A;  2RJC A;  1NPR A;  4Z8A A;  1X6O A;  3M0T A;  3SWN B;  2GBQ A;  3G4S Q;  4C92 B;  1QKX A;  2XU8 A;  4OB0 B;  3X26 B;  4FW1 A;  5GAM f;  5C0M A;  4XTY A;  5ECA A;  4QW2 A;  3M59 A;  4ZNX A;  3M0S A;  5GAN 8;  2CDT A;  3Q1J A;  4M77 E;  4KGX B;  5LL6 S;  3A8O B;  1OX8 A;  3L2W A;  4KUD K;  3BDL A;  3G6E Q;  3CPF A;  3G4S A;  3NTI A;  4E7J A;  2H9R A;  4J7F A;  2JOY A;  4EMG A;  2GNC A;  3CCE T;  1TXQ A;  2KXC A;  1WI7 A;  3LGF A;  2E3H A;  2RHU A;  4M78 E;  2RO0 A;  1PKT A;  2RQY A;  2MWO A;  2DD5 A;  2O2O A;  1E6H A;  5GAM e;  3G6E A;  1MMN A;  3CPW A;  1VQ5 Q;  2EJF A;  3NFC A;  3VS4 A;  1R0C B;  2GFA A;  3BE3 A;  1N8R U;  4AFU C;  1D3B A;  3QDF A;  2CH4 W;  5GAN 2;  4XTU A;  3QG1 A;  1PM3 A;  4C92 G;  2JS0 A;  4QVD A;  1YJ9 T;  2QEX T;  1D3B B;  3G7Z A;  3CC2 Q;  3L2R A;  3CC4 Q;  3QWX X;  1CKA A;  2CZ0 B;  2W0Z A;  1VQ5 A;  2RJD A;  3KFV A;  4BY6 C;  1K8A U;  3QFZ A;  5KCH A;  1AOJ A;  5HKC A;  1PRM C;  2JUF A;  5LJ3 g;  3FJP A;  2RD1 A;  3I56 Q;  2EYQ A;  4C8Q E;  1KQS A;  5LJ3 f;  3FB9 A;  2LC4 A;  4E7H A;  5GAN d;  4JZ3 A;  4PL6 A;  2A7Y A;  1QW1 A;  3CC2 A;  3OA6 A;  3PE0 A;  2YLC A;  2RK2 A;  3CC4 A;  5LJ3 h;  4LDY A;  1PWT A;  3P8B B;  1NZ9 A;  4PFP A;  1Y0M A;  2KY9 A;  1V1C A;  5CKH A;  2FB7 A;  3I56 A;  4OF1 A;  4YTL A;  1TSF A;  3PFS A;  1UGS B;  4ORZ A;  1Q86 U;  3M56 A;  3ACT A;  3L2V A;  3RMQ A;  3QWY A;  1WHM A;  1QKW A;  2FVU A;  1Q95 G;  1U5S A;  4FSX A;  3P8D A;  1YN8 A;  2LX7 A;  1NJI C;  2O9V A;  1FYN A;  2OTL Q;  3EH2 A;  1PCX A;  2J6K A;  2KT1 A;  1SPK A;  4GLM A;  5FWC A;  1X6G A;  5HY6 A;  1QLY A;  4KBM B;  1WFW A;  1LOJ A;  2RI3 A;  3ME9 A;  4AG2 C;  2E64 A;  3VS2 A;  1PHT A;  2FYK A;  4UC4 A;  2QI2 A;  4XTV A;  2D6F A;  1KQ1 A;  3WVD B;  2KNB B;  4LNP A;  4BI3 A;  2VWF A;  1K9M R;  5CAI A;  2DO3 A;  1XNI A;  2X35 A;  4CC4 B;  2PVO B;  2R57 A;  3EHR A;  4JLG A;  3J81 E;  3JCM d;  4E7I A;  3KBG A;  4C0D B;  1W1F A;  3TCJ A;  3VU3 C;  1GRI A;  2DAQ A;  4FYY B;  4Y91 A;  3FLG A;  2XMF A;  2PNI A;  2MAM A;  4MDX A;  1Q82 R;  4R0K A;  2X51 A;  2DZ9 A;  2E1H A;  1C6V X;  1AWO A;  4BUG A;  3LYI A;  3IM4 A;  1RUW A;  2P0P A;  3G36 A;  2JM9 A;  1BK2 A;  2XDB A;  4M77 D;  3JCM c;  1UHC A;  4RTT A;  3TEE A;  2NUZ A;  4PJO E;  1VQ6 Q;  2KYM A;  3AFJ A;  3OYL A;  2OX7 A;  2NUP B;  4ELY C;  1RAB B;  2CP6 A;  2LZ6 B;  3FRN A;  2DLP A;  3SD4 A;  4J5Y A;  3VS5 A;  4M7A C;  4M78 D;  4F7U F;  4E7L A;  2QQB A;  2DEU A;  1OPK A;  1VQ6 A;  2VUB A;  2L0A A;  4K11 A;  4IUP A;  2QAZ A;  1VQP Q;  2CZ1 B;  2P4T A;  4M7A F;  4XTZ A;  2AZV A;  1YP5 A;  4LE9 A;  3C4S A;  2J6O A;  2ZCF B;  3CMA Q;  1OU9 A;  2LQK A;  3JCM b;  2QAS A;  1K1Z A;  1RLQ C;  4IUT A;  1V76 A;  2C0T A;  3BW1 A;  2MYS A;  1MNE A;  4L59 A;  4LUE A;  4RCB A;  1IGU A;  2HDA A;  1VQP A;  3CCR T;  4C0Z A;  5A0L A;  2YUQ A;  4AFZ C;  1VQ8 Q;  3OBW A;  3I5R A;  2DYI A;  3UA7 A;  4M77 A;  4IUU A;  2CZ6 B;  5GMK i;  1NYF A;  3CMA A;  3A1P A;  3UPU A;  1M8V A;  2PUK B;  1LJO A;  5GAM j;  1VQM T;  3OS2 A;  2QGF B;  3A8H B;  1I81 A;  4M77 B;  1PRL C;  2RN8 A;  5AT1 B;  2K4Y A;  2JS2 A;  1YJW T;  1XJW B;  2J06 A;  2MK5 A;  1VQ8 A;  4F16 A;  1NM7 A;  4JRQ A;  4RTX A;  1N8R C;  1Q7Y R;  1VQK T;  3HFO A;  5FU7 B;  3I35 A;  1WJS A;  4OML A;  1U1S A;  3ER0 A;  4A63 B;  3QPH A;  2EQJ A;  1G3T A;  3VUB A;  1WXU A;  4BAC A;  2DNU A;  2IVW A;  2DL7 A;  2LP5 A;  2ENM A;  1UHF A;  2FRY A;  2EZW A;  2F5K A;  3GWH A;  1NPP A;  5EG2 A;  1X27 A;  1YIJ Q;  2X3X D;  2Z0W A;  4BI8 B;  4HCB A;  3GPL A;  4M4Z A;  1T3L A;  3RER A;  1VQ9 T;  4CC3 A;  4DA4 A;  1S72 T;  1NLO C;  4M77 G;  5KYY A;  3QYH B;  2F2V A;  3QSU A;  3CD6 T;  2CQT A;  2QQS A;  3MPU B;  5KYY B;  1OX9 A;  4FM4 B;  1KC8 U;  1YIJ A;  1NLP C;  4IUR A;  2D8H A;  2L3P A;  2VKN A;  2V8I A;  4LUD A;  1ZBJ A;  2KT8 A;  3VS1 A;  4DEY A;  2JMA A;  5GAO n;  4M78 G;  4J8O A;  1Q86 C;  4QVZ A;  2M02 A;  2DET A;  4HCZ A;  1T0J A;  2YXY A;  3CCJ T;  4DBR A;  2RB6 A;  3GNG A;  3TSW A;  3LWH A;  5KYU A;  3M4G A;  4KT0 E;  5A0D A;  3OSS C;  2IG0 A;  3EGD A;  3HRS A;  1YI2 T;  1AEY A;  4DEX A;  1IZ6 A;  2HQX A;  2WSE E;  4HCK A;  2ZPF B;  5KYU B;  3EGD B;  2YDL A;  1BKB A;  1VQ4 Q;  2IPO B;  5HK3 A;  3OYN A;  2X3W D;  2K9Q A;  3OYF A;  3OW2 S;  2XIC A;  5A2Q E;  1YJN Q;  4QQ6 A;  2DXB A;  3E1S A;  3CBP A;  1G83 A;  1EFN A;  2FRW A;  5GAM d;  3JCM e;  2X4W A;  1ABQ A;  2HL3 A;  4F7U E;  2KRO A;  2LVM A;  2B86 A;  1VQ4 A;  1IHW A;  3NTK A;  3JV3 A;  1IHV A;  2HSE B;  4A54 A;  1Y57 A;  5GMK l;  2CT4 A;  1YJN A;  1IXD A;  2LJ1 A;  3RDV A;  1QP3 A;  1X69 A;  2JTE A;  2DE0 X;  3ZBD A;  5AYF A;  3F70 A;  2DTI A;  1JQQ A;  2L2P A;  2YRD A;  4J9D A;  3PIP A;  2D0N A;  4R56 A;  4HVV A;  2K3Y A;  5FRN A;  2YUN A;  1YIT A;  5GMK h;  1K0X A;  3V8L A;  2KVQ G;  2VAS A;  2LQ8 A;  1I0C A;  1WHH A;  1BI0 A;  2K9G A;  3REA B;  3CCU T;  1BIA A;  1MV3 A;  4LD6 A;  2KI7 A;  2KNG A;  2DL3 A;  5LJ5 f;  2NWM A;  5FLX E;  1ZA2 B;  2FO0 A;  1Z9Q A;  3FEO A;  2DX1 A;  3M53 A;  1ZHI A;  1K73 R;  2VV5 A;  1QP2 A;  1UEB A;  4KH1 B;  5IHK A;  1YIT T;  2RHX A;  4J9F A;  1UGV A;  1VYT A;  3JCM V;  4IUQ A;  3CME Q;  2HEQ A;  2NYS A;  2RQT A;  1BCM A;  3JRZ A;  1OU8 A;  5LJ5 e;  2KXD A;  3OYY A;  5GAO r;  1SSF A;  1VQL T;  3PVL A;  1M3A A;  2ZAE A;  1UB4 A;  1YWP A;  5GJV B;  1M90 R;  5D6X A;  3I55 A;  1WDX A;  8AT1 B;  1BB9 A;  1QVG P;  4RUG A;  2MOX A;  3CME A;  2C0O A;  1KK7 A;  3QII A;  1I07 A;  3L2Q A;  2OI3 A;  1YHQ T;  4J9G A;  3EG0 A;  3NTH A;  3L1A A;  4NL3 A;  1SEM A;  1D1B A;  4OB3 B;  4XAX B;  2ZZD A;  3OB9 A;  3GOX A;  2M51 A;  1RAC B;  5HK0 A;  1BYM A;  1NBE B;  3BDU A;  3MHX A;  1G3W A;  2JT4 A;  4BY6 B;  5KCO A;  1WQ7 A;  1FMV A;  2EKO A;  2PU9 B;  6AT1 B;  3I55 T;  1ZBX A;  4OMN A;  2RJF A;  5CK9 A;  2E3I A;  2XD0 A;  3TVT A;  1KD1 R;  4MML A;  1FMK A;  3CCL Q;  1L6E A;  1W2B S;  2QTX A;  2FPF A;  2LJ3 A;  3M54 A;  4OGE A;  4PK4 A;  1T0H A;  2A0F B;  1UJY A;  2DXC A;  2DTH A;  3QFY A;  3KUF A;  2AHJ B;  1BCO A;  4LXC A;  4CC2 A;  5I21 A;  4FCY A;  2EGE A;  1M1K R;  1GL5 A;  4A4H A;  3CCL A;  4JRI A;  2O31 A;  2MI6 A;  2DEQ A;  2K3X A;  5M9O A;  4FT2 A;  3RKY A;  2RQU A;  2KR3 A;  2E65 A;  1W4S A;  3PGG A;  4RMO A;  1XQH A;  2GCX A;  3V8J A;  3S4B A;  2WAC A;  3M55 A;  4PJM A;  1PSF A;  2QQ9 A;  2GTO A;  3WVE B;  2SEM A;  1KC8 C;  2E6N A;  1QCN A;  2C06 A;  2CP7 A;  1K76 A;  4X9C A;  1M2O A;  4JRK A;  1ZA1 B;  2NLU A;  4J6W A;  2RQV A;  1OZ3 A;  1KQ2 A;  4EMH A;  4C0G A;  1AWJ A;  3EG2 A;  1MMG A;  4J7I A;  4A4K A;  2MF2 A;  4O5V A;  8ATC B;  3CCQ T;  1Q86 R;  3GBQ A;  2ZPH B;  2CP2 A;  1K9A A;  1UGP B;  2JXB A;  4KUI A;  2K6D A;  1PNJ A;  4IUV A;  1SF9 A;  2LT1 A;  4JJN K;  5CQY A;  4ELZ C;  4PJJ A;  4FIB A;  3QZ9 B;  1RAD B;  2RA2 A;  4D8K A;  1PKS A;  1X01 A;  3VS6 A;  5HCK A;  3QKJ A;  3JB9 I;  2YUP A;  2QXF A;  1BI1 A;  1HK9 A;  3M58 A;  4RG2 A;  2P0Q A;  1OYX A;  3HL8 A;  2DL5 A;  1W6X A;  1GFD A;  4F7U A;  5HVZ A;  3G4S T;  3MEW A;  3OMG A;  1QVG A;  2DPP B;  2A3L A;  3M4Y A;  2CB9 A;  1B3Q A;  2CQS A;  1OZ2 A;  4F7U B;  1I4K 1;  1WHK A;  4M7A A;  2LCL A;  4RTV A;  4BDY A;  2D9T A;  1NYG A;  3TU4 K;  3G6E T;  4FL6 A;  1FMW A;  4M7A B;  2GQV A;  3GLX A;  2HSP A;  4WF2 A;  3V8K A;  2HMA A;  3P8H A;  3HHT B;  1W2B P;  5I2S A;  3QUI A;  3CBO A;  1H64 1;  3I9Q A;  2O88 A;  1VQ5 T;  3REB B;  4OB2 B;  3FIF A;  2SRC A;  2X9H A;  3DB4 A;  4IIM A;  2DL4 A;  1OUL A;  3GIB A;  2RI2 A;  5LJ3 e;  4OGC A;  1O75 A;  1BI2 A;  2JJ9 A;  5LJ5 j;  1ZUU A;  3MP8 A;  1PG5 B;  4ZGD B;  1YFN A;  1U06 A;  3CC2 T;  1NG2 A;  3VYH B;  2VGN A;  4F7U G;  1TUD A;  2XKO C;  3CC4 T;  1X75 C;  2AIR B;  2QQA A;  3A98 A;  1IGQ A;  1WQW A;  3I56 T;  2EAY A;  4NOY A;  3L2Z A;  3VRY A;  3VUZ A;  3CXC S;  1EIF A;  1ZQ1 A;  4XTX A;  2YUO A;  3NMZ C;  1RAH B;  1WHG A;  3PMT A;  3HTR A;  1M5Q 1;  2OTL A;  3OYJ A;  4GY5 A;  1KSW A;  1FWZ A;  2C0I A;  1M1F A;  1OEB A;  5CVI A;  1Y96 A;  4E2F B;  3QJ6 A;  1CSK A;  2RF0 A;  2P4R A;  1N9S A;  2DVE A;  1Y96 B;  3SB2 A;  2CUD A;  1VIE A;  2M0Y A;  4BD3 A;  4BE0 A;  1VQ7 Q;  2DF6 A;  1QVF S;  4HT9 A;  2QYZ A;  4N4I A;  2A36 A;  3UT1 A;  1XTD A;  1X43 A;  2OTL T;  4L6V 5;  1YBY A;  3MJX A;  4FYX B;  1HD3 A;  1MUZ A;  1BIB A;  4AT1 B;  2DFU A;  3MP6 A;  3J80 E;  1GBQ A;  1VQ7 A;  2NUP A;  3JCM X;  4MZT A;  4JJC A;  3UF4 A;  4FT4 A;  5KH6 A;  2HZY A;  3UFE A;  1WJR A;  3OYE A;  1U1T A;  4LD9 K;  1JO8 A;  3GP8 A;  1VQO Q;  4CI0 C;  2JW4 A;  2DL8 A;  1H3Z A;  3EFO A;  2L5Q A;  1NEB A;  3RKX A;  3URG A;  3N5B B;  1CKB A;  3HKS A;  3EFO B;  3X20 B;  1MGQ A;  1PSE A;  2EIF A;  2RQW A;  3UWN A;  2H8H A;  2QDL A;  1JBM A;  1ZUY A;  1VQO A;  4GBQ A;  5DLO A;  2ED0 A;  5KYN A;  5KE2 A;  3MP1 A;  2CZ7 B;  4AG1 C;  2XDD A;  5LJ5 d;  3HSB A;  2QDY B;  2LCC A;  2AKK A;  4A53 A;  5CO7 A;  5GAN 7;  3QG0 A;  1M2V A;  1WZO A;  2PZ1 A;  1D09 B;  3SDZ A;  2QK0 A;  1W2B A;  1TS9 A;  4EDU A;  1KHC A;  1K9M U;  4RTU A;  1M2V B;  1YNZ A;  1RAG B;  4XU2 A;  1N9R A;  1VQ6 T;  2M1H A;  4PJL A;  1X2K A;  2KMT A;  2BKD N;  2LNV A;  3A8L B;  5IHN A;  1U8R A;  4OMQ A;  1UGQ B;  7AT1 B;  3VJP A;  1C0M A;  2MWP A;  4ZTF A;  3OYD A;  5DY9 A;  2EGA A;  2EYW A;  2B8A A;  3EFR A;  2AZS A;  2RK1 A;  1VQP T;  3RR6 A;  4ESR A;  4C5I A;  5IXB A;  3CXC P;  4F9K A;  4EMK C;  3C94 A;  5GAN g;  1P92 A;  2RNA A;  3OS5 A;  1JJ2 S;  2DXU A;  3QXE B;  4DBQ A;  3CMA T;  5FU6 C;  2OTJ Q;  1M3C A;  2FHD A;  2L3R A;  4X1V A;  2O9S A;  3CCS Q;  5GAN h;  1K8A C;  3SHW A;  2O4X A;  5L23 A;  1KG1 A;  1TH7 A;  4CRI A;  4C5H A;  2V1R A;  1VQ8 T;  4ZP3 A;  2O4X B;  3TQ7 P;  1V29 B;  2L3S A;  3H8Z A;  4RG8 A;  1TUC A;  2OTJ A;  3DLL A;  3JSC A;  3H6Z A;  3QZ5 B;  4N4H A;  4E7Z A;  3CCS A;  1I8F A;  3G71 Q;  4Z88 A;  2ZGW A;  5CR2 A;  2VYT A;  5GAN 6;  1VYU A;  5LJ3 j;  2XHC A;  4PJN A;  4ZN3 A;  4OVA A;  4FSS A;  2KYB A;  3GNF B;  2EQU A;  3PVQ A;  2RI5 A;  4QVC A;  1ARK A;  4N0A C;  3DB3 A;  2CSQ A;  2DJQ A;  4M7D C;  3OS0 A;  3CEY A;  5DM7 R;  3G71 A;  2QG9 B;  3U23 A;  2FZK B;  4RTZ A;  1B34 A;  2PVD B;  3O8V A;  4M75 C;  2F2X A;  5GAO q;  1H8K A;  4XTW A;  2DIL A;  4M7D F;  1B34 B;  1MV0 B;  3CCM Q;  2IIM A;  3J7A F;  2RMO A;  2DKG A;  1YIJ T;  1M8M A;  4M75 F;  2QA4 Q;  5IHI A;  3HPW A;  4P5N A;  4V2S A;  1KQS S;  1TU0 B;  1NJI R;  2G3R A;  2ROT A;  1NE8 A;  2R5M A;  3CCV Q;  1I1J A;  3R6N A;  3CCM A;  1Q7Y U;  1AHJ B;  2O01 E;  1G3S A;  1RLP C;  2QA4 A;  1QQJ A;  4AFQ C;  1N6A A;  2CRE A;  4M7A E;  3PMI A;  3CCV A;  4EIK A;  2XK0 A;  2EW3 A;  3JAM E;  2CKK A;  2F1L A;  3TRE A;  1WX6 A;  3V7C A;  4QQD A;  3PNW C;  3IQL A;  3T9N A;  2VGM A;  1VA7 A;  1WA7 A;  2RHY A;  3QDR B;  4XK8 E;  4E7K A;  2FEI A;  5CQX A;  4JZ4 A;  3HP9 A;  1UTI A;  2J7I A;  2DA9 A;  1VUB A;  1BU1 A;  4BE2 A;  1VQ4 T;  1M9S A;  2LX9 A;  1G5V A;  4LDU A;  2E5K A;  5D7U A;  2KYG A;  1SSH A;  1YJN T;  1R0B G;  2HNI A;  4M77 F;  1TTH B;  3CXC A;  3CBM A;  1ABO A;  2DRK A;  1JJ2 P;  4M78 C;  4GLK A;  4B6M A;  5GMK e;  1ZX6 A;  1NEG A;  2YT6 A;  1GCP A;  1Q81 U;  2COZ A;  2OUT A;  4J9E A;  4M78 F;  3X25 B;  2CSI A;  4ZN1 A;  4KRT A;  1M1G A;  1R2A A;  1VQN Q;  5LJ3 d;  2HAX A;  4DBH A;  2EYY A;  4XQ3 A;  4E7S A;  2PVG B;  3INZ A;  2LTO A;  1UDL A;  2JN0 A;  2K2M A;  3D7S B;  4JS5 A;  2J05 A;  4OMF B;  2E5Q A;  5CKE A;  1EZZ B;  1VQN A;  3BY7 A;  1KJW A;  3MET A;  1WGS A;  3E9G A;  4TVR A;  4C8Q C;  3OYK A;  1K9M C;  3RIR A;  2HD0 A;  4OP0 A;  1UG1 A;  2KGT A;  4RTY A;  3UDC A;  2DYB A;  4FW2 A;  2AT1 B;  5GAN 4;  1D1C A;  2CP5 A;  3HFN A;  3EH1 A;  1K0S A;  4C8Q F;  2K5F A;  5GAO p;  4WCI A;  2MMP A;  2BE9 B;  3H0I A;  3MEU A;  3OYH A;  1X6B A;  3CC7 Q;  3H0H A;  2R58 A;  1RI9 A;  1AVZ C;  1GFC A;  1YCS B;  3CME T;  2I2L A;  4JDS A;  1M30 A;  2XDP A;  3OW2 P;  3BFM A;  1F1B B;  2JTM A;  3V7S A;  4J9B A;  3LH5 A;  5EC7 A;  1OPL A;  4ZGE B;  4DOW A;  1IB8 A;  3CC7 A;  3MKD A;  2OAU A;  3OYM A;  2A08 A;  1N8R R;  5CIU A;  3MEV A;  2VXF A;  4IKF A;  2LRQ A;  2X4X A;  4C5E A;  4A4F A;  4KH0 B;  5CKD A;  3TSZ A;  2OJ2 A;  5IT9 E;  3OYI A;  1K73 U;  5A0G A;  5IH2 A;  4LDW A;  1UFF A;  2X4Y A;  2D1X A;  1K8A R;  4AMC A;  2RJE A;  3CCE Q;  2X4J A;  4HCC A;  3HRT A;  3EG3 A;  2K79 A;  2CGH A;  1LVK A;  1JXM A;  3RSY A;  3EAE A;  1UJ0 A;  5IAY A;  1M90 U;  1GCQ C;  2K7A A;  3CCL T;  2GFU A;  4M7A D;  3CCE A;  2PTK A;  3JCM J;  4J9I A;  2ZPB B;  1SKU B;  2E70 A;  3WXM B;  2I15 A;  1JJ2 A;  1YJ9 Q;  4AFS C;  2QEX Q;  5GAM g;  2G6F X;  4PNO A;  2GF7 A;  3C12 A;  2JZ2 A;  2COY A;  1M27 C;  3JCM P;  2JTF A;  1W70 A;  2RHZ A;  4PJO C;  5GAM h;  4J6X A;  2KAF A;  3JB9 F;  4FYW B;  2ROL A;  2V1Q A;  3QDE A;  3RES A;  2DER A;  2DIG A;  2ZPG B;  2EQM A;  1YJ9 A;  2EFI A;  2QEX A;  4X9D A;  1UUE A;  2BE7 D;  1Q7Y C;  4HT8 A;  1TOV A;  4PJO F;  2CP0 A;  1MND A;  2V8J A;  3THK A;  3A8G B;  3X24 B;  3PTA A;  1KD1 U;  2XI9 A;  1HSQ A;  2DJZ A;  3H9N A;  1SHG A;  4F14 A;  1HXD A;  1N5Z A;  1ZUK A;  1JB0 E;  4NL2 A;  1PD0 A;  5I2M A;  1AD5 A;  2JNG A;  1JU5 C;  2EYZ A;  4X34 A;  3LH0 A;  2DTO A;  1M1K U;  4L5G A;  4MMK A;  2DRN A;  4XU0 A;  1ZSZ C;  2P0K A;  4JUV A;  2F2W A;  2E6Z A;  2LMJ A;  2L3Q A;  3C95 A;  4ME7 A;  2DBM A;  1E7O A;  4MDW A;  2AKL A;  2JMC A;  1QCF A;  4OB1 B;  4JJD A;  2BUD A;  5GMK j;  1OOT A;  3QHS A;  9ATC B;  3OW2 A;  4PFO A;  5CKF A;  1IRE B;  3LWI A;  3S4D A;  5I22 A;  1BBZ A;  2EJG A;  3S3N A;  3PIO A;  1Q81 C;  2FPD A;  3NHN A;  4C0F A;  3M0Q A;  4XU3 A;  3DKM A;  1Y7X A;  3ASK A;  3S4C A;  2DBK A;  1QVP A;  2F69 A;  5KYX A;  3L2U A;  2ESW A;  4HVW A;  2YRV A;  4M7A G;  1JRI A;  4DBF A;  5KYX B;  3JB9 H;  2EPD A;  5J3B A;  2Y4X A;  2ED1 A;  4M7D D;  4EMK A;  2LQN A;  2VXE A;  1WPY A;  3OYC A;  4A4G A;  4F17 A;  2YWW A;  5I11 A;  4M75 D;  4E47 A;  1M3B A;  1SHF A;  3OSV A;  4EMK B;  2DM1 A;  3SWN C;  4C92 C;  2BZX A;  2ZPI B;  3JCM Q;  5FU6 B;  2HBP A;  2LNH B;  3LW5 E;  2CP3 A;  2I0N A;  2CUB A;  1RAE B;  4C92 F;  2YRC A;  4Y28 E;  1MHN A;  1SRM A;  1VIF A;  3UA6 A;  1RL2 A;  2FG0 A;  1WJQ A;  4WTO B;  1E6G A;  4LDX A;  4E6R A;  2K57 A;  1AT1 B;  2DZC A;  3UAT A;  5FRM A;  2CT3 A;  2HKQ B;  1I5O B;  1UGR B;  1DJ7 B;  3OYG A;  4N0A A;  3QJY A;  4M7D A;  3X28 B;  1IRX A;  4RTA A;  1FXX A;  1QWE A;  3ACS A;  2HKN A;  1EX4 A;  4F04 B;  4M75 A;  2LT4 A;  2ECZ A;  4M7D B;  3LX7 A;  4FU6 A;  1K73 C;  3CCR Q;  3VS7 A;  4PLI A;  1S1N A;  4M75 B;  5CKB A;  4KGZ B;  2CBG A;  2XG8 D;  1WYX A;  2EBP A;  3VYG A;  3CQT A;  1VQM Q;  1VQ7 T;  1QWF A;  1WIE A;  2E41 A;  4JJB A;  3FDR A;  2EYX A;  2K5I A;  2W10 A;  3CCR A;  4CC7 A;  3EGU A;  3H41 A;  5DLQ E;  1YJW Q;  1Y07 A;  1M90 C;  3SEM A;  3FC3 A;  2WSF E;  3S4A A;  1R8O B;  2DIQ A;  4PLL A;  2ABL A;  2LQW A;  3MEA A;  1KC8 R;  1VQK Q;  4Z89 A;  3M57 A;  1VQM A;  1OV3 A;  4VUB A;  4LN2 A;  4JPB W;  4KGV B;  1JEG A;  3MCA B;  1H92 A;  3HRU A;  2V26 A;  3OMC A;  1YJW A;  5J26 A;  4M7D G;  2GTJ A;  1WLP B;  1VQO T;  2DRM A;  4N4G A;  3QYG B;  4A4E A;  1VQK A;  1HYO A;  4M75 G;  1RAI B;  3RRS A;  1XOV A;  1BI3 A;  5L8R E;  3IM3 A;  1YWO A;  4J9H A;  2H3E B;  1Q82 U;  1VQ9 Q;  4C8Q D;  1QMC A;  1S72 Q;  1D0Y A;  1KD1 C;  4IIO A;  3QBY A;  3JB9 J;  3OS1 A;  3CD6 Q;  3EG1 A;  1KFZ A;  5GAN f;  1U3O A;  4EPC A;  2R5A A;  4FYV B;  4M78 A;  1GXI E;  1VQ9 A;  2KRS A;  3OY9 A;  1S72 A;  1Y71 A;  1I5L A;  3S6W A;  3ZEH A;  1M1K C;  4M78 B;  4BE1 A;  2CYZ B;  3OQ5 A;  2EKH A;  4MZM A;  3CCJ Q;  3CD6 A;  1D0Z A;  1QVF P;  2V8K A;  1G8X A;  4C0D C;  2JM8 A;  1YI2 Q;  1HJD A;  2EQK A;  4QQG A;  1FX7 A;  1MMA A;  2RH2 A;  2HBW A;  3M9Q A;  5GAN e;  1SG5 A;  2KK4 A;  2OAW A;  3CCJ A;  1LPL A;  2E12 A;  4JRP A;  3VV0 A;  4C8Q A;  3CPW S;  1RI0 A;  1MMD A;  4PKC C;  1YI2 A;  1WXT A;  4C92 E;  2GQI A;  5D6Y A;  4DQ2 A;  2CH4 A;  4C8Q B;  2DVJ A;  2WSC E;  3L42 A;  1T3S A;  1WHJ A;  3OYB A;  4LDV A;  2OTJ T;  2KE9 A;  3CCS T;  5GJW B;  2FZC B;  3G1J A;  1QVG S;  2K3B A;  3M5A A;  2KRN A;  3EG9 A;  2KEA A;  1UE9 A;  5D6W A;  2DD4 A;  2D8J A;  3JCM g;  5IN1 A;  1Q81 R;  3EG9 B;  3JCM f;  3EGX A;  2VC8 A;  2YSQ A;  5KYW A;  4QKU A;  1PD1 A;  5C6S A;  3S3M A;  1LCK A;  2K2V A;  4ATO A;  1K4U S;  4QT7 A;  3G71 T;  4NS5 A;  3JCM h;  2KBT A;  1AZG B;  3EGX B;  3ULR B;  1VOM A;  4HVU A;  2D0Q B;  1R77 A;  5KYW B;  1AZE A;  4II1 A;  2YLB A;  4ZGJ B;  2FPE A;  1TUG B;  2GGR A;  2AK5 A;  1D0X A;  1KIK A;  1JXO A;  3KXT A;  3CCU Q;  2J6F A;  1C1A A;  3JB9 D;  1ZSG A;  3RNJ A;  2A37 A;  3A5Z B;  3RUX A;  3NPF A;  4B9W A;  4J9C A;  2QTV A;  3GF5 A;  1ACM B;  2BZ8 A;  2E10 A;  3FJ5 A;  3AHU A;  4C8Q G;  1OI1 A;  4RCC A;  2RPN A;  2EWN A;  4PJO D;  2YHT A;  4OMP A;  5IXF A;  4OMM A;  5GAO m;  3M0P A;  3I5S A;  1B7T A;  3NGP A;  3VS0 A;  4D6W A;  3LGL A;  2EVR A;  5GMK m;  3CCU A; 
#chains in the Genus database with same CATH homology
 5A0G A;  3CC2 T;  3VYH B;  2VGN A;  3MO8 A;  4M77 A;  4LDW A;  4IUU A;  2XKO C;  2CZ6 B;  4F7U G;  5GAO l;  3CC4 T;  3CCM T;  1X75 C;  5GMK i;  3CMA A;  2QQA A;  3UPU A;  2X4Y A;  1M8V A;  2PUK B;  1LJO A;  4M77 C;  5GAM j;  1VQM T;  3OS2 A;  3A8H B;  2QQR A;  2RJE A;  1I81 A;  4M77 B;  1WQW A;  2QA4 T;  2X4J A;  5CCA A;  3I56 T;  2DXT A;  2EAY A;  2K4Y A;  4NOY A;  3L2Z A;  4HCC A;  1YJW T;  3HRT A;  2CGH A;  3VUZ A;  3RMS A;  1VQ8 A;  4ZTJ A;  3CXC S;  3EAE A;  1EIF A;  1ZQ1 A;  4MZP A;  4XTX A;  3CCV T;  4JRQ A;  3PMT A;  5IAY A;  3S3O A;  2FL7 A;  1N8R C;  1M90 U;  1M5Q 1;  4RKU E;  2OTL A;  5FU7 C;  3CCL T;  1VQK T;  3OYJ A;  3HFO A;  2GFU A;  5FRO A;  5FU7 B;  3R6O A;  4GY5 A;  4M7A D;  1FWZ A;  5LJ5 g;  1M1F A;  1WJS A;  3CCE A;  1U1S A;  3ER0 A;  5CVI A;  1Y96 A;  3JCM J;  3QJ6 A;  2ZPB B;  2E70 A;  3QPH A;  3WXM B;  2EQJ A;  1K73 U;  1G3T A;  3DLM A;  1JJ2 A;  3VUB A;  1VQL A;  5GAM g;  3E19 A;  3LLR A;  4BAC A;  1N9S A;  2DVE A;  4PNO A;  2IVW A;  1Y96 B;  2GF7 A;  5LJ5 h;  3C12 A;  3PT9 A;  2JZ2 A;  3EFS A;  3SB2 A;  4PJO A;  1VIE A;  2KQW A;  4BD3 A;  3JCM P;  2F5K A;  2JTF A;  3GWH A;  1NPP A;  2RHZ A;  5EG2 A;  4BE0 A;  1QVF S;  4HT9 A;  1QVF A;  4PJO C;  4N4I A;  4BI8 B;  5GAM h;  4HCB A;  2RM4 A;  4J6X A;  2KAF A;  3UT1 A;  1XTD A;  1O9S A;  3GPL A;  3JB9 F;  4PJO B;  3RES A;  5J39 A;  3RER A;  1VQ9 T;  2DIG A;  1G3Y A;  2EQM A;  2ZPG B;  4DA4 A;  1S72 T;  4L6V 5;  1YBY A;  4M77 G;  4R55 A;  1YHQ A;  2OTL T;  3QYH B;  1YJ9 A;  2EFI A;  3JCM W;  1NJI U;  2QEX A;  4X9D A;  1Q7Y C;  4HT8 A;  3V7R A;  2RHI A;  4PJO F;  3VKI A;  1BIB A;  3QSU A;  2HQE A;  2V8J A;  3A8G B;  4JLI A;  3X24 B;  3PTA A;  3CD6 T;  1KD1 U;  2XI9 A;  2QQS A;  3MP6 A;  3J80 E;  3OYA A;  4FM4 B;  2DJZ A;  1KC8 U;  1YIJ A;  1VQ7 A;  3JCM X;  4IUR A;  4B9X A;  2EJ9 A;  4MZT A;  2V8I A;  1HXD A;  4FT4 A;  2PQW A;  5GAO n;  4M78 G;  4J8O A;  5KH6 A;  1Q86 C;  1JB0 E;  2H3J A;  4NL2 A;  5I2M A;  4BI4 A;  3UFE A;  1WJR A;  2L89 A;  2JNG A;  4QVZ A;  3OYE A;  1U1T A;  4LD9 K;  2M16 A;  4X34 A;  3LH0 A;  2DTO A;  4C5G A;  3GP8 A;  4HCZ A;  4CI0 C;  4DOV A;  2F5T X;  4L5G A;  3ZFJ A;  3CCJ T;  1M1K U;  3SFM A;  2DK3 A;  4MMK A;  1H3Z A;  2RB6 A;  2M9U A;  4BB7 A;  2L5Q A;  2L8D A;  4XU0 A;  3GNG A;  5GAN 3;  3LWH A;  1Q82 C;  2P0K A;  3JB9 G;  1M4Z A;  3M4G A;  4JUV A;  4KT0 E;  3RKX A;  5A0D A;  1VQN T;  3OSS C;  2E6Z A;  2IG0 A;  3N5B B;  3HRS A;  3URG A;  3HKS A;  4BDZ A;  1YI2 T;  3A8M B;  5GAN 5;  3C95 A;  3QO3 A;  1LNX A;  1WNL A;  1IZ6 A;  2HQX A;  1MGQ A;  2K5L A;  2WSE E;  3X20 B;  4ME7 A;  1PSE A;  2ZPF B;  2EIF A;  3UWN A;  4MDW A;  4KUL A;  2CS7 A;  4PJO G;  2JVV A;  1JBM A;  1VQO A;  1BKB A;  4OB1 B;  4C92 D;  5DLO A;  2BUD A;  4M7D E;  5GMK j;  5HK3 A;  3OYN A;  4XU1 A;  5KE2 A;  2K9Q A;  2LDM A;  3MP1 A;  3QHS A;  2CZ7 B;  3OYF A;  2XDD A;  5LJ5 d;  2PUO B;  3OW2 S;  2XIC A;  3RKW A;  5A2Q E;  3OW2 A;  3HSB A;  4QQ6 A;  1IRE B;  4M75 E;  2QDY B;  2LCC A;  5CKF A;  3LWI A;  4J6Y A;  2DXB A;  4A53 A;  3E1S A;  5CO7 A;  5KE3 A;  3CBP A;  4Z02 A;  5GAN 7;  2KDS A;  2KSS A;  2EJG A;  3SDZ A;  5GAM d;  3S3N A;  3JCM e;  3PIO A;  2X4W A;  1W2B A;  4EDU A;  4F7U E;  3OBY A;  1Q81 C;  2LVM A;  2M0O A;  5GAN j;  1KHC A;  1K9M U;  4HKE A;  4C0F A;  4XU2 A;  4XU3 A;  1VQ4 A;  3DKM A;  4O6J A;  1N9R A;  2ZPE B;  1VQ6 T;  3NTK A;  1Y7X A;  2M1H A;  3ASK A;  4A54 A;  1QVP A;  5GMK l;  2F69 A;  1YJN A;  2KMT A;  2BKD N;  2LNV A;  3L2U A;  3A8L B;  1QP3 A;  1U8R A;  4J83 A;  1UGQ B;  2YRV A;  4M7A G;  3CC7 T;  1JRI A;  3ZBD A;  5AYF A;  3F70 A;  3VJP A;  2DTI A;  3JB9 H;  5J3B A;  3PIP A;  2XID A;  1KHI A;  2MWP A;  2Y4X A;  4HA8 A;  4R56 A;  4ZTF A;  2K3Y A;  3OYD A;  5DY9 A;  5FRN A;  4M7D D;  2B8A A;  3EFR A;  4EMK A;  3CCQ A;  2RK1 A;  2VXE A;  1YIT A;  5GMK h;  1VQP T;  1WPY A;  3E9F A;  3V8L A;  2BIV A;  2KVQ G;  4A4G A;  4C5I A;  3OYC A;  1YCY A;  2LQ8 A;  2Y4Y A;  4M75 D;  4EMK C;  4E47 A;  1BI0 A;  3C94 A;  3SWN A;  5GAN g;  4JS4 A;  1P92 A;  4C92 A;  3CCU T;  3OSV A;  4EMK B;  1BIA A;  4LD6 A;  4Q5W A;  2KNG A;  5LJ5 f;  3OS5 A;  1JJ2 S;  2DXU A;  3SWN C;  1N27 A;  3QXE B;  3CMA T;  5FU6 C;  4C92 C;  2Y90 A;  5FLX E;  2RJC A;  1NPR A;  2FHD A;  1X6O A;  2L3R A;  3SWN B;  2ZPI B;  3JCM Q;  5FU6 B;  4C92 B;  2HBP A;  3FEO A;  2XU8 A;  4OB0 B;  5GAN h;  3LW5 E;  3X26 B;  5GAM f;  1K8A C;  2O4X A;  5C0M A;  4XTY A;  4QW2 A;  1KG1 A;  3M59 A;  3M53 A;  1TH7 A;  4CRI A;  4C5H A;  4C92 F;  1ZHI A;  5GAN 8;  1VQ8 T;  2VV5 A;  3Q1J A;  4M77 E;  5LL6 S;  2O4X B;  4Y28 E;  3A8O B;  1QP2 A;  1UEB A;  1V29 B;  1MHN A;  3H8Z A;  4RG8 A;  3L2W A;  4KUD K;  1VIF A;  3BDL A;  2OTJ A;  3DLL A;  3JSC A;  1RL2 A;  3CPF A;  2RHX A;  3H6Z A;  1YIT T;  3QZ5 B;  4N4H A;  3CCS A;  3G4S A;  3NTI A;  4E7J A;  4J7F A;  3JCM V;  4IUQ A;  2JOY A;  1I8F A;  4EMG A;  1WJQ A;  3CCE T;  2ZGW A;  3LGF A;  3JRZ A;  4LDX A;  2K57 A;  2DZC A;  5LJ5 e;  2RHU A;  5FRM A;  5CR2 A;  2VYT A;  4M78 E;  2RO0 A;  3OYY A;  5GAN 6;  5GAO r;  1SSF A;  1VQL T;  2MWO A;  2RQY A;  2DD5 A;  1UGR B;  5LJ3 j;  1UB4 A;  2XHC A;  1DJ7 B;  3OYG A;  4ZN3 A;  4OVA A;  4N0A A;  3QJY A;  5GAM e;  5D6X A;  3X28 B;  3GNF B;  2EQU A;  3G6E A;  4M7D A;  2RI5 A;  3I55 A;  3CPW A;  4QVC A;  2EJF A;  3NFC A;  4N0A C;  3DB3 A;  2GFA A;  1FXX A;  1N8R U;  4M7D C;  3OS0 A;  3CEY A;  4M75 A;  5DM7 R;  3G71 A;  3CME A;  1D3B A;  2LT4 A;  5GAN 2;  4M7D B;  3QII A;  3LX7 A;  4XTU A;  4FU6 A;  3QG1 A;  1B34 A;  2PVD B;  3O8V A;  4C92 G;  4QVD A;  3L2Q A;  1K73 C;  4M75 C;  1YHQ T;  4PLI A;  1YJ9 T;  3NTH A;  5GAO q;  4M75 B;  3L1A A;  4XTW A;  4NL3 A;  1D3B B;  2QEX T;  5CKB A;  3G7Z A;  3L2R A;  2CBG A;  2XG8 D;  4OB3 B;  4XAX B;  4M7D F;  1B34 B;  2ZZD A;  3OB9 A;  3VYG A;  3GOX A;  2CZ0 B;  5HK0 A;  1VQ5 A;  3J7A F;  1BYM A;  2RJD A;  2DKG A;  3BDU A;  1YIJ T;  1VQ7 T;  4BY6 C;  1K8A U;  4M75 F;  3MHX A;  1G3W A;  5KCH A;  5HKC A;  2JUF A;  2E41 A;  3FJP A;  2RD1 A;  3HPW A;  4BY6 B;  4P5N A;  5KCO A;  5LJ3 g;  3FDR A;  2EYQ A;  4V2S A;  2K5I A;  1KQS S;  4C8Q E;  1WQ7 A;  1KQS A;  3CCR A;  5LJ3 f;  3FB9 A;  2EKO A;  2PU9 B;  5DLQ E;  2G3R A;  2LC4 A;  3I55 T;  1Y07 A;  1ZBX A;  4E7H A;  1M90 C;  5GAN d;  2RJF A;  1NE8 A;  3FC3 A;  4PL6 A;  2WSF E;  5CK9 A;  2A7Y A;  1QW1 A;  3CC2 A;  2R5M A;  1R8O B;  2DIQ A;  3OA6 A;  2XD0 A;  2YLC A;  2RK2 A;  4PLL A;  3CC4 A;  5LJ3 h;  4LDY A;  3CCM A;  4MML A;  3MEA A;  1Q7Y U;  1AHJ B;  3P8B B;  1W2B S;  1NZ9 A;  2O01 E;  2QTX A;  3M57 A;  1VQM A;  3M54 A;  1G3S A;  2KY9 A;  4OGE A;  4VUB A;  2QA4 A;  5CKH A;  2FB7 A;  3I56 A;  4OF1 A;  4YTL A;  3MCA B;  3HRU A;  2DXC A;  2DTH A;  3OMC A;  1YJW A;  3PFS A;  1UGS B;  3KUF A;  2AHJ B;  5J26 A;  4M7D G;  1N6A A;  5I21 A;  1Q86 U;  4M7A E;  1VQO T;  3M56 A;  4N4G A;  3PMI A;  3QYG B;  3CCV A;  3L2V A;  4A4E A;  4A4H A;  3RMQ A;  2XK0 A;  1VQK A;  3CCL A;  4JRI A;  4M75 G;  2FVU A;  3JAM E;  2CKK A;  2MI6 A;  2DEQ A;  2K3X A;  3TRE A;  4FT2 A;  3V7C A;  3RKY A;  5M9O A;  4FSX A;  1XOV A;  1BI3 A;  4QQD A;  5L8R E;  2E65 A;  3P8D A;  3PNW C;  1NJI C;  1W4S A;  3T9N A;  2VGM A;  3PGG A;  4RMO A;  1XQH A;  2GCX A;  1Q82 U;  2RHY A;  3V8J A;  4C8Q D;  3QDR B;  4XK8 E;  4E7K A;  2WAC A;  3M55 A;  1KD1 C;  1PSF A;  5CQX A;  3QBY A;  2QQ9 A;  3HP9 A;  3WVE B;  3JB9 J;  1KC8 C;  5HY6 A;  1VUB A;  3OS1 A;  4KBM B;  2E6N A;  4BE2 A;  1VQ4 T;  2C06 A;  1M9S A;  2LX9 A;  5GAN f;  4LDU A;  1G5V A;  1LOJ A;  2RI3 A;  3ME9 A;  4X9C A;  4EPC A;  2R5A A;  2E64 A;  2FYK A;  4M78 A;  4JRK A;  4UC4 A;  1YJN T;  2QI2 A;  2NLU A;  4XTV A;  2D6F A;  2HNI A;  4J6W A;  4M77 F;  1KQ1 A;  3CXC A;  1GXI E;  3CBM A;  3WVD B;  1VQ9 A;  4BI3 A;  3OY9 A;  4M78 C;  1S72 A;  1Y71 A;  1I5L A;  3S6W A;  3ZEH A;  1M1K C;  1OZ3 A;  1KQ2 A;  4EMH A;  4GLK A;  4M78 B;  4C0G A;  5CAI A;  2CYZ B;  3OQ5 A;  4BE1 A;  2DO3 A;  4J7I A;  5GMK e;  4MZM A;  1XNI A;  3CD6 A;  2X35 A;  1Q81 U;  4A4K A;  2OUT A;  2PVO B;  2MF2 A;  4O5V A;  3CCQ T;  2R57 A;  4M78 F;  3X25 B;  4JLG A;  4ZN1 A;  1M1G A;  2V8K A;  4C0D C;  5LJ3 d;  3JCM d;  3J81 E;  4E7I A;  2ZPH B;  2EQK A;  1UGP B;  4QQG A;  2HAX A;  4KUI A;  3KBG A;  4C0D B;  4XQ3 A;  1FX7 A;  4IUV A;  3TCJ A;  2PVG B;  2RH2 A;  2DAQ A;  3VU3 C;  3M9Q A;  5GAN e;  3INZ A;  2LT1 A;  4JJN K;  5CQY A;  4Y91 A;  4ELZ C;  3FLG A;  4FIB A;  2LTO A;  2KK4 A;  3QZ9 B;  2JN0 A;  2MAM A;  4MDX A;  4JS5 A;  3CCJ A;  4OMF B;  2E12 A;  2RA2 A;  1X01 A;  2E5Q A;  5CKE A;  4JRP A;  3VV0 A;  2DZ9 A;  3JB9 I;  4C8Q A;  3QKJ A;  3CPW S;  2E1H A;  2QXF A;  1VQN A;  3BY7 A;  1RI0 A;  4PKC C;  1YI2 A;  1BI1 A;  3MET A;  1HK9 A;  1WGS A;  4C92 E;  4BUG A;  3E9G A;  4TVR A;  4C8Q C;  3LYI A;  3M58 A;  4RG2 A;  3OYK A;  2P0Q A;  5D6Y A;  4DQ2 A;  2P0P A;  4C8Q B;  1K9M C;  3RIR A;  2HD0 A;  1OYX A;  3HL8 A;  4OP0 A;  2WSC E;  3L42 A;  3OYB A;  4LDV A;  2OTJ T;  3UDC A;  2XDB A;  4F7U A;  5GAN 4;  3CCS T;  3HFN A;  3G4S T;  4M77 D;  3JCM c;  3MEW A;  3TEE A;  3OMG A;  1QVG S;  1QVG A;  4PJO E;  2DPP B;  4C8Q F;  3OYL A;  2K5F A;  2A3L A;  3M5A A;  2CB9 A;  3M4Y A;  5GAO p;  4ELY C;  1OZ2 A;  2MMP A;  4F7U B;  1I4K 1;  5D6W A;  2DD4 A;  3MEU A;  3JCM g;  2LCL A;  5IN1 A;  3OYH A;  4BDY A;  3FRN A;  2D9T A;  4M7A A;  3SD4 A;  4J5Y A;  3JCM f;  3TU4 K;  3G6E T;  2VC8 A;  4M7A C;  4M78 D;  4F7U F;  4E7L A;  2R58 A;  3S3M A;  4FL6 A;  5C6S A;  2QQB A;  4M7A B;  2K2V A;  4ATO A;  3CME T;  2GQV A;  3G71 T;  2I2L A;  4NS5 A;  3JCM h;  1VQ6 A;  2VUB A;  4JDS A;  3GLX A;  4WF2 A;  2XDP A;  2D0Q B;  4IUP A;  3BFM A;  4II1 A;  2YLB A;  3V8K A;  2CZ1 B;  4ZGJ B;  2P4T A;  4M7A F;  2JTM A;  4XTZ A;  3V7S A;  3KXT A;  3P8H A;  3JB9 D;  3C4S A;  4ZGE B;  3HHT B;  3A5Z B;  4DOW A;  5I2S A;  3RUX A;  3CC7 A;  3QUI A;  3CBO A;  4B9W A;  1H64 1;  3GF5 A;  2ZCF B;  1VQ5 T;  2LQK A;  2E10 A;  4OB2 B;  3JCM b;  2OAU A;  3OYM A;  3AHU A;  4C8Q G;  1OI1 A;  3FIF A;  4RCC A;  5CIU A;  4IUT A;  2EWN A;  2VXF A;  3DB4 A;  3MEV A;  4IKF A;  2LRQ A;  3BW1 A;  2X4X A;  4PJO D;  2YHT A;  4L59 A;  4C5E A;  4RCB A;  4A4F A;  3GIB A;  5GAO m;  2RI2 A;  3CCR T;  1VQP A;  4C0Z A;  5CKD A;  5LJ3 e;  4OGC A;  1O75 A;  1BI2 A;  5A0L A;  4D6W A;  5IT9 E;  5LJ5 j;  3MP8 A;  3OBW A;  4ZGD B;  3LGL A;  3OYI A;  5GMK m;  3CCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...