3PMIA

Pwwp domain of human mutated melanoma-associated antigen 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
SFEVGMLVWHKHKKYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQAREDFNQDIGWCVSLITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PWWP domain-containing protein MUM1
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.60 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3pmiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pmiA01
4BE2A 5FRNA 2R57A 3L42A 4E7HA 3ZEHA 3ASKA 3OYGA 2E5QA 1OZ2A 2L3RA 3LH0A 3MEWA 2X4WA 5D6YA 3F70A 4B9WA 3NTKA 2WACA 2M1HA 2RJFA 4NS5A 5IN1A 4Q5WA 3OYKA 3ME9A 3MP6A 1OZ3A 3NTIA 2O4XB 2D9TA 2RI3A 2LCCA 2RHYA 4A4HA 2XK0A 2YRVA 4QQGA 4A4EA 3O8VA 4ZTJA 3QIIA 5IAYA 2X4XA 3PFSA 3PNWC 5D6WA 3OYDA 3LX7A 3OYMA 3PMTA 3OYNA 3MP1A 2K3XA 2QQSA 2HQEA 2L8DA 4QVZA 4HCZA 3OYFA 3L2WA 2LTOA 1N27A 5KH6A 5FRMA 2X35A 4N4GA 3MO8A 2M16A 2O4XA 4IURA 3QKJA 3L2UA 3FLGA 3OYAA 2E6NA 4IUQA 3PMIA 1WJSA 3BDLA 3LLRA 2LRQA 2RHZA 3M9QA 3OMCA 4N4HA 4QQDA 5J26A 5J39A 1OI1A 4BE1A 1WJQA 2B8AA 3LYIA 2K3YA 5M9OA 3LGLA 4PLIA 4E7LA 4ZTFA 3NTHA 2FHDA 3DLMA 4B9XA 4FL6A 3L2RA 4C5HA 4PLLA 4QW2A 4C5IA 3OYCA 2IG0A 1WGSA 2JTFA 2XDPA 2BUDA 2P0KA 3P8DA 3UT1A 4X34A 3QBYA 4E7JA 3CEYA 2R58A 3META 5CIUA 3Q1JA 2EQUA 5D6XA 4IUTA 1OYXA 2LDMA 4GY5A 5C6SA 2X4YA 4UC4A 2M0OA 2HQXA 3OMGA 4IKFA 3E9FA 4IUPA 3SD4A 3S3MA 2CKKA 4FU6A 4A4FA 2RHUA 1G5VA 2DIGA 3E9GA 3FEOA 4Z02A 3MEAA 2RJDA 2EQMA 3GOXA 3EAEA 3QJ6A 2GFUA 2RI5A 4E7IA 5KE3A 2DIQA 2RJEA 2PQWA 3OB9A 4BDZA 1MHNA 1WJRA 2MWOA 4PL6A 4C5EA 2LVMA 3KUFA 2DAQA 2MWPA 3DB3A 3MEVA 2G3RA 3OYEA 3OYLA 3OYJA 3LGFA 3OS1A 4OVAA 3C4SA 2F5KA 4EDUA 5KE2A 3OYBA 3L2VA 3FC3A 3S6WA 4BE0A 3MP8A 5FROA 4BDYA 3DB4A 3H6ZA 2EKOA 4IUUA 3OS0A 2JZ2A 2EFIA 2GFAA 3OQ5A 5KCHA 4E7KA 2NLUA 2EQKA 2L89A 4BACA 3MEUA 2R5MA 3S3OA 2RO0A 4N4IA 3OYHA 3OS2A 3P8HA 4IUVA 1RI0A 2QQRA 3S3NA 4A4GA 2RJCA 4RG2A 3FDRA 3L2QA 1H3ZA 2GF7A 3H8ZA 2R5AA 2VYTA 3UWNA 1KHCA 4CRIA 3OY9A 3OYIA 2RHXA 1XNIA 1SSFA 2RHIA 2BIVA 4L59A 5KCOA 2EQJA 4BD3A 5C0MA 4LD6A 4C5GA 2RI2A 3OA6A 4II1A 2BKDN 4QQ6A
chains in the Genus database with same CATH superfamily
2CDTA 2VKNA 2XU8A 2EGAA 4DBRA 1YJWT 2DL5A 5GMKe 5DLOA 5LJ3e 3CXCA 2K7AA 1X01A 1D0ZA 4HT8A 1EIFA 2GTOA 1E6HA 3QWXX 3JCMP 2DF6A 3D7SB 3PNWC 4J7FA 1KQSS 5LJ3d 3EHQA 2K3XA 2GGRA 2HQEA 3AHUA 5FW9A 2KSSA 2ENMA 2XG8D 4P5NA 3HSBA 4M7AE 3THKA 1WJSA 1QVGS 1M1KU 2RHZA 5J26A 2CREA 2B8AA 2FPEA 1Q81C 2DTIA 4C92C 3M0SA 2A37A 3HP9A 2P0KA 2LQKA 1Y71A 2W10A 1YP5A 1BCMA 2R58A 5GAN6 2H9RA 4C8QA 4C8QG 4M78B 1M90R 1YITT 1YIJT 2LDMA 4M77B 4OMLA 1WHMA 3G71A 2BZ8A 2CP3A 3CQTA 2HQXA 2RMOA 3V8LA 1K73U 4M7DB 2FRYA 5KYWB 1FMWA 3I56A 2EVRA 1YHQA 3EHRA 4PJJA 2V8IA 2EJ9A 5DLQE 2M51A 3GP8A 1XOVA 1PRLC 1CKAA 2OAWA 4IIOA 1G3WA 3URGA 3H0HA 3G36A 4CC7A 2FVUA 2DL4A 2EQKA 4BACA 1YJNA 3HFNA 3FRNA 4IUVA 2VXEA 2CUBA 3S3NA 1U1SA 4M7AF 3CD6A 1I5LA 3UFEA 1B34B 4KGZB 1KD1U 2RI2A 1BIBA 1WHGA 4JLIA 4BE2A 5GANe 2K2VA 3JB9D 1WPYA 4KH0B 2HKQB 2A36A 3P8BB 1GFCA 3CCRA 4M78C 2AIRB 3OYKA 4AMCA 4J9GA 4M7DC 2OTLQ 2DBKA 5IAYA 3A98A 2I2LA 5HCKA 1NJIU 3G7ZA 3E19A 3J7AF 3EGXB 3PMTA 5IXFA 1RL2A 1H641 4XTUA 3IM3A 2JXBA 1VQOQ 1X27A 3CPWS 3FLGA 2KYGA 3PMIA 2RB6A 3LLRA 5CK9A 2J6OA 2YWWA 1WJQA 4HVUA 1SF9A 4F7UG 4F7UA 3DLMA 2NUTA 2BE7D 4C5HA 4QW2A 3OW2S 2DZ9A 2VXFA 4AFZC 4XU3A 1RAEB 5A0GA 1YJ9T 3JB9I 1KG1A 2KBTA 3MPUB 3QZ9B 2EQUA 2E10A 2JW4A 4MZMA 3QFYA 3TSZA 1Q82R 5GAMj 5IH2A 1KC8U 2MF2A 2OX7A 2P84A 5GAOm 2P4TA 2RHUA 1GBQA 1W2BP 2QQBA 1Y96A 3QDRB 5KE3A 5AT1B 4M75C 1JU5C 4JDSA 1QWEA 2EYYA 1I0CA 1TU0B 3AT1B 2KGTA 1IZ6A 1YBYA 1W2BA 4RT4A 2P0QA 2OTLT 2JN0A 1FMVA 1BI2A 4J9HA 5GAMh 4B6MA 3UPUA 2YUPA 1BBZA 4E47A 1VQOT 1UUEA 4JLGA 4C0FA 2L0AA 1SSFA 1PKSA 4PFZA 5C0MA 3JCMg 2BKDN 2E12A 1M30A 1KFZA 4RIQA 2HSEB 2MPXC 3CBMA 1YCSB 1Z9ZA 2QEXQ 2RH2A 1Q86R 1EZZB 3QFZA 1LJOA 1Q95G 5CKDA 2RQRA 2MMPA 2CUDA 5GMKm 3O8VA 1LNXA 2D0QB 4JRQA 2PVGB 2X4XA 3I55T 4A54A 1NG2A 2CZ1B 2ED0A 3OYNA 3MJXA 3UATA 4OB2B 1K9MC 4FIBA 3L2WA 2A0FB 2O4XA 1N8RU 1TTHB 2LNVA 1GFDA 3CCSQ 3QJYA 4C8QB 5M9OA 3LGLA 2F5TX 2EPDA 3ACTA 1MUZA 2ZPIB 1XTDA 4FT2A 1RAAB 5LJ5j 1Y7XA 2RQYA 3RMSA 3VS2A 1X2KA 4A53A 2FZGB 3U23A 2JTEA 4Y28E 3X26B 4E7IA 4QT7A 2QEXT 3OB9A 1VQPA 1SKUB 1QWFA 2AHJB 3S4BA 2ROTA 2LJ3A 2LMJA 5KE2A 3S6WA 6AT1B 1NPPA 1L6EA 4OB0B 5LJ5h 1QP2A 4LXCA 2KDSA 3OYHA 1K9AA 3TQ7P 4PJOG 4PJOA 2K5FA 3QG0A 3E1SA 2CZ7B 3CCST 4XTZA 4C8QC 2HEQA 5DY9A 3VU3C 1K8AU 4OB3B 3CC7T 1M90C 3ASKA 2E41A 3MEWA 3HPWA 1CKBA 3CMEA 1KQSP 3JCMW 1ZBXA 2DL7A 1WHKA 1D0YA 4AFQC 2RQWA 1TUDA 1SRMA 3VS1A 2DO3A 3M0TA 1Q81R 1QVGP 4F7UB 3CCUQ 4HCZA 2ZPHB 2KT8A 1QVGA 2H8HA 2RPNA 2ED1A 3VUZA 2XD0A 1I5OB 1LVKA 1D09B 1U3OA 1IRXA 2Y90A 1TSFA 3M53A 3CCEA 3LH5A 4FCYA 1QCNA 1AZGB 1NPRA 1WQ7A 1Y96B 1JO8A 2DBMA 4X9DA 1ABOA 1VA7A 2I0NA 4NL3A 2WSCE 1PHTA 4ELYC 1JB0E 3JCMc 2ECZA 5CCAA 4A4KA 4OGEA 4XAXB 1M3CA 1BI3A 3RESA 2LT4A 4JS5A 5KYUB 3FEOA 4RG8A 1N5ZA 3WVDB 4JJBA 3KUFA 4M78D 2DAQA 3MEVA 3OYEA 3CCJQ 4M77D 1VQKA 2FB7A 4BI4A 4F9KA 1JRIA 2DLPA 4M7DD 2J7IA 4MDXA 3OSSC 1AWWA 1E7OA 3CCUT 3REBB 3SB2A 2F2WA 2D0NA 4LE9A 4KGVB 1JQQA 2AKKA 2Z0WA 1IHVA 1H3ZA 1QVFA 1OOTA 2NYSA 1YI2Q 4J6WA 3VYHB 3FJ5A 3LW5E 1PM3A 2YUQA 1D1CA 2E5QA 2MI6A 1Q82C 4J7IA 4L5GA 2QG9B 4OMFB 2JUFA 2COWA 1BCOA 3NTIA 2O4XB 2SRCA 2LCSA 4EMKA 2RHYA 2DL3A 2XK0A 1VYVA 4QQGA 2C06A 3CPWP 1NBEB 5GAMg 2FRWA 3LX7A 8AT1B 2IIMA 4VUBA 2WSFE 2P0PA 5I22A 3ULRB 5HKCA 3L2ZA 3CPWA 3OW2P 2M16A 3QKJA 3PVLA 4C92E 3CMAA 3CCJT 3DKMA 2PUOB 1VYUA 1YFNA 2BE9B 3M9QA 2Y4XA 4E7LA 1KHIA 2JT4A 3M59A 2QGGA 3EGUA 2E3IA 1MGQA 1G3TA 2DYIA 3PTAA 1KIKA 1UHFA 2JMCA 1G3YA 2QQAA 3A8LB 1VQ9Q 4PJMA 3ZL7C 2EYQA 1M9SA 4IUTA 1YI2T 3QPHA 3KBGA 4FW1A 2CH4A 1Q86C 4E6RA 4A4FA 1QLYA 2DYBA 3C0CA 1Q81U 3QJ6A 2GFUA 2XMFA 3VS4A 2NWMA 3EG3A 2LX9A 4DOWA 3DB3A 4M7AA 4M7AG 3M0PA 4PJOB 2ZGWA 2LJ1A 2H3JA 1U06A 2LCLA 2GNCA 4KUDK 1VQ8A 2XICA 4OMMA 1I8FA 3EH1A 3CCVQ 4DEXA 4N4IA 3OS2A 5LL6S 2JOYA 2DE0X 3OBWA 1ZBJA 2BZYA 4C92F 2D1XA 2DD5A 1C1AA 4AG2C 2DL8A 4Y91A 1VQ6T 2EQJA 3CCLQ 2DEUA 5KYNA 4QQ6A 3NPFA 4M78E 5FRNA 1GCQA 1K9MR 1QMCA 2YLBA 4DQ2A 1YJWA 4M7DE 2V1RA 2D6FA 2DXCA 1VQ9T 4F16A 2X3WD 2CB9A 1BI1A 5HY6A 1V76A 3BFMA 1QKXA 2JM9A 5LJ5g 1AWOA 1Y0MA 1RACB 2EYWA 3HKSA 2X35A 2JMAA 3MO8A 4L6V5 2ZCFB 4PJOC 4KBMB 3OMCA 1TH7A 3EG9A 1JJ2S 2EJFA 2LNHB 2DRMA 5LJ3h 5GMKh 3CCVT 3RBBB 3QBYA 2FZCB 1M2VA 1ZA2B 4C8QD 2M9UA 4X9CA 3VS5A 3CCLT 2KRMA 4GLKA 4M75E 2L5QA 5A0DA 3JRZA 4M78F 1MNDA 5J3BA 4PJLA 3GOXA 2RJDA 2EQMA 1S72Q 3EAEA 4M7DF 1IREB 3GNFB 4DA4A 5EG2A 3S4DA 4C5EA 2W0ZA 4AFUC 4FYXB 4LDYA 2OAUA 3M54A 1D0XA 1M1GA 1BKBA 1VQLQ 3FC3A 1I07A 3QXEB 2MCNA 4D8KA 4BDYA 1OPKA 2JVVA 3QSUA 3OS0A 3I56Q 2EFIA 2GFAA 2KEAA 3OQ5A 1YHQQ 4J6XA 3CC2T 2RQUA 1H8KA 2O31A 3P8HA 1WXUA 3TREA 3FDRA 2J6KA 2JJ9A 3UWNA 1XNIA 1N9SA 3BE3A 1SRLA 4LD6A 4EMKB 2RQVA 2KI7A 1IB8A 1ZLMA 3ZEHA 5CQYA 3G4SA 3OYYA 1C6VX 2F2VA 3LWIA 3LH0A 3QDFA 2M1HA 2YXYA 2X9HA 3CD6Q 2KE9A 1PWTA 3MP6A 3RRSA 1UGSB 1MV3A 3R6NA 3J80E 4M75F 3EG1A 2HL5C 1S72T 1F1BB 1T0HA 5FWBA 2FL7A 3M5AA 3EG2A 1N27A 3C12A 4IURA 1S1NA 4NL2A 5CKHA 3BDLA 1VQLT 1AOJA 5GANh 3KFVA 3RKWA 2E4HA 3I56T 4M77C 1YHQT 3VUBA 3GIBA 1U5SA 1GBRA 5GANd 1PNJA 1QKWA 1YJ9A 1T3LA 1G3SA 2VGMA 1QVPA 5GAN7 5GAOp 1RUWA 1K9MU 3UF4A 2DZCA 4M7AB 2M0OA 2OUTA 3SHWA 1M27C 4IKFA 3E9FA 1OX8A 1AWXA 2YLCA 3JSCA 4XTWA 4E2FB 1G5VA 1B07A 4HA8A 5GAN4 3CCQQ 2MWOA 2ZPGB 2E5KA 2OTLA 3JCMf 3MP8A 1BIAA 1M8VA 2EKOA 5CQXA 1LOJA 1WHHA 2M0YA 3H0IA 1VQOA 3VJPA 4YTLA 3S3OA 4BB7A 5I2MA 3UDCA 2YDLA 1K1ZA 1HSQA 1KJWA 2QAZA 3OY9A 2C0IA 4L59A 2DXUA 3V7SA 2DD4A 1UECA 3O5ZA 2NUZA 1WI7A 2EAYA 3BW1A 1SHGA 4Z89A 2J06A 3VKIA 1Q7YR 1AWJA 3NHNA 1X2QA 4QKUA 1PSEA 5GAN2 4LD9K 4OMQA 4IIMA 2YRVA 3M55A 4HVVA 3OSVA 4ZGJB 3CC4Q 3EG9B 1MMAA 1XJWB 3I55A 4F14A 3EGDA 1GXIE 3J81E 2CP6A 3A1PA 4EPCA 1YWOA 2SEMA 2ZPBB 3UA7A 1VQ7Q 3CCQT 2V1QA 1M90U 4CC3A 1X6OA 4KUIA 2E6NA 1JBMA 4N4HA 4BE1A 3CCMQ 2CQSA 3GBQA 2GTJA 2K3YA 1VQ5Q 3NTHA 2CH4W 3VS6A 1GCQC 3GLXA 2D8HA 1PC0A 2RF0A 5GJVB 2RM4A 1WZOA 1BYMA 4PFOA 1OPLA 4Z02A 2OTJQ 2DX1A 2QEXA 3NFCA 3KXTA 4HKEA 2G3RA 2CBGA 4LDWA 3A8HB 2AZVA 1UHCA 4ZGDB 1XQHA 3CC4T 2AK5A 3DB4A 2PVOB 1AEYA 5IHKA 4GLMA 2LX7A 1VQ7T 4RTWA 3PIPA 3CXCS 3VRYA 2R5MA 1VQPQ 2RO0A 2V26A 4MDWA 4A4GA 2RJCA 4F17A 4ATOA 3CCSA 4PJOD 1KHCA 3CCMT 4DBQA 2BIVA 1VQ5T 3CC7A 1B7TA 2M02A 3V7CA 1YCYA 2EWNA 2FO0A 2COYA 4B9WA 2X4WA 3EFOA 2G6FX 4NS5A 1JEGA 1RAIB 2DVJA 2XDDA 4LDXA 2E65A 2JNGA 1BB9A 3M0RA 4JUVA 4CC2A 4MMKA 2XI9A 5HK0A 3JB9F 4A63B 2AZSA 3PFSA 1FXXA 1VQMQ 2K3BA 3CMEQ 2OTJT 4QVZA 3H9NA 5EC7A 4ESRA 2DVEA 4PK4A 3OS5A 1M1FA 1Q82U 2PTKA 1ZHIA 1OU9A 2LRQA 2EW3A 4DBFA 2DJQA 1ZA1B 3OYCA 2JTFA 1KQSA 2NUTB 2KAFA 2XHCA 1A0NB 1OYXA 2X4YA 4J83A 1R2AA 1I1JA 3QHSA 3SEMA 3E2UA 4GBQA 1AZEA 4O6JA 2O2OA 1FMKA 2K5IA 4Z88A 2L2PA 1UE9A 1T3SA 4OMPA 1OV3A 2F1LA 4C92G 3I9QA 4C92A 4R55A 4OVAA 3M56A 3C4SA 1Y07A 2JZ2A 1D3BA 2CSQA 3JAME 1SHFA 2AKLA 1VQMT 3CCUA 2K4YA 3CMET 1Q86U 1NEBA 1VQ4Q 1H92A 5CR2A 1X75C 4JZ3A 3QYHB 3BDUA 4WF2A 1VQKQ 3V7RA 2DA9A 4BD3A 4ZP3A 2CS7A 2KNBB 5GAMf 2XIDA 3RIRA 1IXDA 5AYFA 3EGDB 4XU0A 5CKEA 3I5SA 1QW1A 3SDZA 1MMGA 4HCKA 1R77A 2LCCA 4A4EA 2FZKB 5KYYA 1G83A 2EGEA 2CT3A 1CSKA 2A08A 4PJOE 4LN2A 3LWHA 1ZQ1A 1AD5A 4RTAA 3X24B 5I21A 4FSXA 4RTXA 3RR6A 4RCBA 1VYTA 2QDYB 2O88A 3CCJA 5HK3A 1PRMC 1UGVA 2YUOA 3HRUA 2EKHA 1WLPB 1M8MA 1NYFA 3M0QA 4PLLA 4J6YA 1VQ4T 1HXDA 2XDPA 2QQ9A 4MMLA 5GAN8 3CMAQ 3NGPA 1VQKT 1P92A 4BI8B 1RLPC 1PG5B 1WDXA 1NLPC 9ATCB 1YI2A 1Q7YC 4J9IA 2HD0A 2KXCA 2X51A 3GPLA 3OMGA 1M1KR 1W4SA 4HCBA 1FYNA 1TXQA 2DIGA 3OW2A 1E6GA 2RI5A 4ZNXA 1VQNA 1WHJA 2V8JA 1ABQA 2RJEA 2KRNA 4BDZA 5DM7R 5GAN3 2K9QA 4RTZA 3OYJA 1QCFA 4M7AD 4EDUA 2HCKA 3OYBA 4BE0A 3M0UA 4IUUA 3X25B 1JXOA 2HMAA 4PJOF 1K73R 1IGUA 2GF7A 3GWHA 3H8ZA 3TCJA 2VYTA 5I11A 2PU9B 3PVQA 4BUGA 1U1TA 1VQ6A 1VQ8Q 4XQ3A 4J9DA 5LJ5f 4DEYA 3M4YA 4M75G 4M75A 2QA4Q 2EJGA 4J9FA 1J3TA 2A7YA 2RK1A 3HRTA 2L3SA 3QG1A 4DBHA 5FU6B 2J6FA 1YNZA 1WXTA 2JTMA 5L8RE 2EYXA 4XU1A 3QO3A 2VB6A 3EGXA 1M3BA 3PE0A 5FWCA 1VUBA 2JS0A 2KYMA 3QWYA 5D6WA 3OYDA 5CO7A 3G6EQ 1TOVA 1W70A 2DRKA 2EIFA 5KYXA 3JCMe 4NOYA 3ACSA 3VS0A 2HNIA 4M77E 1NE8A 3OYAA 4IUQA 2DEQA 3C95A 3QZ5B 3LYIA 5IHNA 4B9XA 3JCMd 1Z9QA 2JS2A 3CCVA 7AT1B 5GMKj 5LJ3j 2VV5A 4MZTA 2BUDA 4TVRA 1B3QA 3EFSA 2ZPEB 2EZWA 3CEYA 1AT1B 2LP5A 3DLLA 3SFMA 3CCLA 2VASA 3RERA 1M4ZA 2KXDA 2DTOA 2HBWA 2QA4T 1RAGB 2RQTA 4N0AA 3EH2A 1SEMA 3GNGA 1D3BB 3S4AA 5FU6C 3JB9J 3OBYA 3JCMQ 2L3QA 1WJRA 2YSQA 3RNJA 3CXCP 4ANJA 3SWNA 4F04B 2K6DA 3LGFA 2H3EB 2MYSA 2F5KA 1UG1A 3VS3A 2DXTA 2I15A 2KRSA 1YITA 2OJ2A 4PFPA 1UGPB 3G6ET 1YIJA 3CC2A 1MV0B 2DM1A 4RTYA 2KT1A 5IT9E 3MEUA 3M4GA 1KC8R 3PGGA 1RI0A 2XDBA 4BY6B 1DJ7B 4M77F 3MKDA 2R5AA 3JV3A 4CRIA 4BI3A 5KCOA 3JB9H 3H0FA 4II1A 3G71Q 1K76A 4CI0C 1ZUUA 3L42A 4E7HA 4ZN1A 5KYYB 4J5YA 4ORZA 3VRZA 3JCMV 2QK0A 4HT9A 2CZ0B 3M57A 2WACA 2BTTA 1OZ3A 2QXFA 3G4SQ 4XK8E 3QIIA 1N9RA 3MCAB 2AT1B 3MHXA 3OYMA 1BI0A 1S72A 1SG5A 3CBPA 4JPBW 1LPLA 1ZSGA 1H3HA 2QQSA 1YJNQ 4MZPA 3V8JA 2RA2A 1YN8A 1AVZC 1EX4A 1W1FA 3C94A 1VQLA 4KGXB 4PLIA 1K0XA 4ZTFA 2HAXA 5GANj 3T9NA 2K9GA 1SPKA 4X1VA 3FJPA 2KQWA 3RSYA 1UGRB 1MMDA 2CGHA 2IPOB 3UT1A 4BY6C 5L23A 1RADB 5FU7B 4E7JA 1X6BA 2B86A 1WYXA 1FWZA 4PJNA 4D6WA 3CCRQ 1TUGB 4GY5A 2MOXA 4UC4A 3G71T 3RKXA 1N8RR 2LZ6B 2PUKB 2CKKA 2CSIA 1YJ9Q 3MEAA 1NM7A 1HYOA 2PQWA 1QVFS 1YWPA 2VGNA 3TVTA 2YT6A 2MWPA 3OYLA 1VOMA 2QTVA 2J05A 4RMOA 2E3HA 3G4ST 2VUBA 2DNUA 4FYVB 4EMKC 4E7KA 2HSPA 1IO6A 4M75B 1YJNT 4OGCA 2XKOC 1R0BG 3IQLA 2NUPA 4RG2A 1RAFB 3CD6T 4HXJA 3A8GB 3AFJA 2DRNA 1WQWA 3JB9G 1QP3A 2COZA 4J9EA 5GJWB 1OZ2A 2EYZA 5FU7C 2KNGA 2RJFA 1X69A 1M1KC 1TWBA 5KYXB 1AHJB 2Y4YA 2YRCA 4C8QE 4XTXA 3ME9A 3QYGB 3CCRT 1BU1A 3RKYA 5ECAA 5CAIA 4XTVA 4JRKA 2D9TA 2O9VA 4ZTJA 5CKBA 4KRTA 4M4ZA 5FLXE 2KR3A 3I35A 1G8XA 1K8AR 1IHWA 1ACMB 1EFNA 3CCQA 2EQIA 2LTOA 3HL8A 5FRMA 3X28B 2YUNA 1K73C 1QQJA 8ATCB 3HHTB 3I55Q 2QI2A 2ZAEA 2RN8A 2FYKA 4RTUA 4M7AC 4Z8AA 5GAMe 4X34A 3WVEB 1SSHA 1UB4A 3META 2HL3A 3Q1JA 5KYUA 4JJNK 3SWNB 1N6AA 3UA6A 5LJ3f 1X43A 1M2VB 4WCIA 5GAMd 3E9GA 4QVCA 2ZZDA 1MNEA 4PL6A 1OULA 1RI9A 2LVMA 4C8QF 1KD1C 1ZSZA 3R6OA 3CPFA 1GL5A 4OMNA 1ZUKA 3ZBDA 3CC4A 4RTTA 2DXBA 5GAOl 5KCHA 4OP0A 2QASA 1VQ7A 1QCOA 2HDAA 1M2OA 1OX9A 2KY9A 2GQIA 2VWFA 3OYIA 3EFRA 3CCMA 4K11A 1VQ5A 4F7UE 1NJIC 2K2MA 2DERA 1WFWA 1D1AA 3M58A 2HKNA 1VIEA 4XU2A 3OYGA 4N0AC 5IXBA 2LC4A 5LJ3g 4AG1C 1K4US 4OMOA 1GCPA 1PD1A 2ATCB 3RMQA 1ZX6A 4C0DB 1UGQB 4CC4B 4FYYB 2HBPA 2RI3A 4LNPA 3SWNC 3CC7Q 1TUCA 1ZUYA 2CT4A 2JM8A 2WSEE 3S4CA 5GAOn 1HD3A 5GMKi 1RAHB 2OTJA 2KYBA 3WXMB 2KMTA 5KH6A 4N4GA 2DFUA 2E1HA 4JJDA 3L2UA 3JCMX 3REAB 1KQ1A 1TS9A 1KC8C 4QQDA 5GMKl 1Y57A 3G1JA 1UEBA 4JRIA 1HK9A 4PKCC 2K5LA 2D8JA 1MMNA 2LQNA 2LJ0A 2RK2A 5LJ5e 1VIFA 1JJ2P 3RUXA 2DKGA 2DETA 5GANf 1K0SA 1WHLA 1ARKA 4F7UF 3NMZC 2X3XD 1I4K1 2QGFB 4IUPA 2HZYA 3HFOA 1JJ2A 3S3MA 5LJ5d 1PCXA 5GAN5 1MHNA 1VQPT 4C0DC 3VS7A 2X4JA 2IVWA 2FG0A 2BZXA 2NUPB 3N5BB 5CVIA 2VVKA 4C92D 1PD0A 3ER0A 5FROA 1R0CB 1Q7YU 1VQMA 1WXBA 2NLUA 2PZ1A 4EIKA 2CYZB 1R8OB 2DILA 2E6ZA 3CCEQ 4PNOA 1D1BA 4QVDA 3L2QA 1JXMA 4LUDA 4D8DA 2MIOA 1KK7A 3H41A 4C5IA 2EGCA 5GANg 1OQKA 4E7ZA 2L3RA 3HRSA 3NTKA 3TU4K 1N8RC 4Q5WA 2O01E 1KSWA 4XTYA 4V2SA 4O5VA 3VYGA 2GQVA 2QTXA 4ELZC 2DTHA 3PT9A 2L3PA 3A8OB 1UJ0A 2C0TA 2GBQA 2ROLA 1PKTA 3RDVA 4KULA 3EG0A 3MP1A 1OEBA 1WNLA 3OYFA 5CKFA 2EBPA 2PNIA 4RCCA 2MAMA 4KT0E 2O9SA 4HCCA 5I2SA 5J39A 2KK4A 3BY7A 4LUEA 4J8OA 4LDVA 3L2RA 1VQ4A 1WX6A 4JZ4A 1WGSA 1RLQC 2E70A 2ZPFB 1OU8A 5A2QE 1U8RA 2K79A 3P8DA 4EMGA 3CCET 2PVDB 2KROA 4JRPA 2DMOA 2P4RA 5D6XA 2CZ6B 1QVFP 1ZSZB 3ZFJA 1O9SA 1C0MA 1NYGA 3FIFA 4FM4B 3HTRA 2CP5A 2C0OA 4DOVA 1UTIA 2DJZA 2RD1A 3IM4A 5IHIA 4R56A 1O75A 2DIQA 1M5Q1 3I5RA 4M78G 4M78A 5GAOq 2MK5A 3A5ZB 4M77A 4FT4A 4M77G 4RKUE 1K8AC 4J9BA 1X6GA 4M7DA 4M7DG 1WIEA 5A0LA 1W2BS 1GRIA 3H6ZA 5KYWA 2K57A 1VQNQ 1T0JA 2CP2A 2ABLA 4C0ZA 3FB9A 2QQRA 2RNAA 4J9CA 3JCMJ 2CP7A 2LQWA 1M3AA 1I81A 3OA6A 3TSWA 2QYZA 2YRDA 2R57A 3CBOA 4M75D 4JS4A 5D6YA 2E64A 3F70A 3L1AA 2DPPB 2CP0A 1KQ2A 3QUIA 5IN1A 1B34A 1VQ6Q 1RABB 2FPFA 3INZA 4E7SA 4A4HA 4EMHA 1ZSZC 3EFOB 4JJCA 3TEEA 2FEIA 4C0GA 1UDLA 4OF1A 2OI3A 1PSFA 3V8KA 2ESWA 5HVZA 2L8DA 3A8MB 2QDLA 4ZGEB 3CMAT 1VQ9A 3X20B 1OI1A 2KVQG 2A3LA 4FW2A 2FHDA 2IZYA 1HJDA 4FL6A 1VQNT 3PIOA 4WTOB 3JCMb 4R0KA 2IG0A 1V29B 3VV0A 2LQ8A 4AFSC 1YJWQ 1LCKA 4FYWB 1NZ9A 1KD1R 3GF5A 1TG0A 5CIUA 4ZN3A 1NEGA 5C6SA 2GCXA 2F69A 2DK3A 2QA4A 4KH1B 3JCMh 1BK2A 4FSSA 3SD4A 4FU6A 1UJYA 2FPDA 1IGQA 4OB1B 1NLOC 1G2BA 2V8KA 1FX7A 3OS1A 1NJIR 4ME7A 2HQHA 2VC8A 3L2VA 2LT1A 3G6EA 4HVWA 1VQ8T 4RUGA 4LDUA 4Y92A 4C92B 2L89A 5D7UA 1V1CA 2A28A 3QDEA 1W6XA 5GAOr 2CQTA 2YHTA 4AT1B 1UFFA 2RHXA 2RHIA 4RTVA 1YITQ 3CC2Q 1YIJQ 4C5GA 2F2XA 1WA7A
chains in the Genus database with same CATH topology
3CC7A 3JB9G 3LW5E 1QP3A 2XU8A 3V7CA 1YCYA 2EWNA 2E5QA 2MI6A 1OZ2A 4B9WA 5FU7C 2X4WA 4J7IA 1YJWT 1Q82C 4L5GA 2KNGA 2RJFA 4NS5A 5GMKe 4OMFB 5DLOA 5LJ3e 3CXCA 1M1KC 2JUFA 2XDDA 1AHJB 1X01A 2Y4YA 4C8QE 4LDXA 4XTXA 2E65A 3ME9A 2JNGA 3QYGB 3RKYA 3CCRT 5CAIA 4JUVA 4HT8A 3NTIA 1EIFA 4JRKA 2O4XB 2D9TA 4XTVA 4EMKA 4MMKA 2RHYA 2XI9A 3JCMP 2XK0A 4QQGA 5HK0A 4ZTJA 5CKBA 2C06A 3JB9F 5GAMg 3PFSA 3PNWC 4J7FA 5FLXE 3LX7A 1KQSS 4VUBA 2WSFE 1FXXA 5LJ3d 2P0PA 2K3XA 2OTJT 5HKCA 3L2ZA 2HQEA 3CCQA 4QVZA 3AHUA 3CPWA 2KSSA 2DVEA 2LTOA 3HL8A 5FRMA 3OS5A 2XG8D 1M1FA 2M16A 1Q82U 4P5NA 3QKJA 3X28B 4C92E 3CMAA 3HSBA 3CCJT 1ZHIA 3DKMA 4M7AE 2PUOB 1K73C 1M1KU 1WJSA 1QVGS 2LRQA 2RHZA 3M9QA 5J26A 2Y4XA 4E7LA 2B8AA 1KHIA 3HHTB 2QI2A 3M59A 2FYKA 1MGQA 1Q81C 1G3TA 2DTIA 4C92C 4M7AC 3OYCA 3PTAA 2JTFA 1KQSA 3HP9A 2P0KA 2LQKA 5GAMe 1G3YA 1Y71A 2QQAA 4X34A 3WVEB 3A8LB 2KAFA 1UB4A 2XHCA 2R58A 3META 5GAN6 2EYQA 1M9SA 3Q1JA 4M78B 4C8QA 4C8QG 4IUTA 4JJNK 1YI2T 1YITT 1YIJT 1OYXA 2LDMA 3QPHA 4M77B 3KBGA 2X4YA 4J83A 3G71A 3SWNB 1N6AA 2HQXA 3V8LA 1Q86C 1K73U 4M7DB 5LJ3f 3QHSA 4A4FA 5GAMd 3E9GA 3I56A 1Q81U 3QJ6A 4O6JA 2GFUA 4QVCA 1YHQA 2K5IA 2ZZDA 4PL6A 2V8IA 2LVMA 2EJ9A 2LX9A 5DLQE 4C8QF 1KD1C 4DOWA 3DB3A 4C92G 4C92A 4M7AA 4M7AG 4PJOB 4R55A 2ZGWA 4OVAA 3M56A 3CPFA 3C4SA 2H3JA 1XOVA 2LCLA 3R6OA 3GP8A 1G3WA 3URGA 3ZBDA 1Y07A 3CC4A 4KUDK 2JZ2A 2DXBA 2XICA 5GAOl 1D3BA 3JAME 1VQ8A 5KCHA 1VQMT 1I8FA 2K4YA 4OP0A 3CMET 3CCUA 2FVUA 2EQKA 1Q86U 1VQ7A 4BACA 1YJNA 5CR2A 1X75C 3HFNA 4N4IA 3OS2A 3FRNA 4IUVA 2VXEA 5LL6S 2JOYA 2KY9A 3OBWA 3QYHB 3S3NA 1U1SA 3BDUA 4WF2A 4C92F 4M7AF 2DD5A 3OYIA 3EFRA 3V7RA 3CD6A 3CCMA 1I5LA 3UFEA 1B34B 1VQ5A 4Y91A 1VQ6T 2EQJA 4BD3A 4F7UE 1KD1U 2CS7A 1NJIC 2RI2A 1BIBA 4QQ6A 5GAMf 4M78E 4JLIA 4BE2A 5FRNA 3M58A 2XIDA 5GANe 1VIEA 3RIRA 2K2VA 4XU2A 3JB9D 1WPYA 3OYGA 4N0AC 4DQ2A 2LC4A 2YLBA 5AYFA 5LJ3g 1YJWA 4M7DE 4XU0A 5CKEA 2D6FA 2DXCA 1VQ9T 3P8BB 3CCRA 4M78C 3SDZA 1QW1A 3RMQA 2CB9A 3OYKA 4C0DB 1UGQB 1BI1A 2HBPA 5HY6A 2RI3A 3SWNC 2LCCA 3BFMA 4M7DC 4A4EA 2WSEE 5GAOn 5IAYA 5LJ5g 2I2LA 5GMKi 4PJOE 1U8RA 3LWHA 3G7ZA 1ZQ1A 3E19A 1NJIU 3J7AF 3PMTA 2OTJA 3X24B 1RL2A 5I21A 1H641 4XTUA 3WXMB 3HKSA 2KMTA 4FSXA 4RCBA 5KH6A 2X35A 4N4GA 3MO8A 2QDYB 4L6V5 2E1HA 2ZCFB 3L2UA 3CPWS 3CCJA 3FLGA 3JCMX 4PJOC 5HK3A 3PMIA 1KQ1A 2RB6A 3LLRA 4KBMB 1KC8C 3OMCA 4QQDA 5GMKl 5CK9A 1TH7A 3HRUA 1WJQA 1UEBA 4JRIA 4F7UG 4F7UA 1JJ2S 1HK9A 2EJFA 3DLMA 4PKCC 2K5LA 4C5HA 4PLLA 4J6YA 4QW2A 3OW2S 5LJ3h 5GMKh 1HXDA 1VQ4T 3CCVT 2DZ9A 2VXFA 2XDPA 2QQ9A 4MMLA 2RK2A 4XU3A 5GAN8 5LJ5e 5A0GA 1YJ9T 3QBYA 3JB9I 1KG1A 3QZ9B 1VQKT 1P92A 1VIFA 4BI8B 2EQUA 1YI2A 3RUXA 2DKGA 2E10A 4MZMA 3VYHB 4C8QD 2M9UA 4X9CA 5GANf 3CCLT 1Q7YC 2HD0A 4F7UF 4GLKA 5GAMj 3GPLA 3OMGA 4M75E 1I4K1 1KC8U 2L5QA 4IUPA 2MF2A 1W4SA 3JRZA 5A0DA 3HFOA 4M78F 1JJ2A 5GAOm 4HCBA 5J3BA 3S3MA 2P4TA 5LJ5d 2RHUA 2DIGA 3GOXA 3OW2A 2RJDA 2EQMA 2QQBA 3EAEA 1Y96A 2RI5A 5GAN5 1VQNA 3QDRB 4M7DF 2V8JA 5KE3A 2RJEA 1IREB 3GNFB 4BDZA 1MHNA 5DM7R 4M75C 5EG2A 4JDSA 4DA4A 1VQPT 4C5EA 4C0DC 2X4JA 2IVWA 5GAN3 2K9QA 4LDYA 1IZ6A 2OAUA 1YBYA 5CVIA 3M54A 3N5BB 3OYJA 1W2BA 1M1GA 4C92D 1BKBA 4M7AD 2P0QA 4EDUA 3OYBA 3FC3A 2JN0A 4BE0A 3ER0A 3QXEB 2OTLT 5FROA 1BI2A 4BDYA 2JVVA 3QSUA 4IUUA 3OS0A 3X25B 1Q7YU 2EFIA 2GFAA 3CC2T 3OQ5A 1VQMA 4J6XA 5GAMh 4PJOF 3UPUA 2NLUA 4E47A 1VQOT 3P8HA 2CYZB 1R8OB 2E6ZA 4JLGA 3TREA 4PNOA 4C0FA 3FDRA 4QVDA 3L2QA 2GF7A 3GWHA 3H8ZA 3TCJA 2VYTA 3UWNA 2PU9B 1XNIA 1SSFA 1U1TA 4BUGA 1VQ6A 1N9SA 5C0MA 4LD6A 3JCMg 4EMKB 2BKDN 4XQ3A 4C5IA 5LJ5f 5GANg 2E12A 3M4YA 4M75G 4M75A 2EJGA 3ZEHA 5CQYA 3G4SA 3OYYA 3LWIA 2L3RA 3HRSA 2A7YA 3LH0A 2RK1A 3HRTA 3NTKA 3TU4K 2M1HA 3QG1A 1N8RC 3CBMA 5FU6B 4Q5WA 2JTMA 2RH2A 2O01E 4XTYA 5L8RE 4V2SA 4O5VA 4XU1A 3MP6A 1LJOA 3QO3A 3VYGA 2GQVA 5CKDA 2QTXA 4ELZC 2DTHA 3PT9A 2MMPA 1UGSB 3A8OB 5GMKm 1VUBA 3O8VA 1LNXA 3J80E 2D0QB 4JRQA 2PVGB 2X4XA 4M75F 5D6WA 3OYDA 3I55T 5CO7A 4A54A 4KULA 2CZ1B 1S72T 2EIFA 3MP1A 3OYNA 3JCMe 4NOYA 4OB2B 1WNLA 2HNIA 4FIBA 3OYFA 3L2WA 2FL7A 5CKFA 1K9MC 3M5AA 1N27A 4M77E 3C12A 2MAMA 4RCCA 1NE8A 2O4XA 4IURA 4KT0E 4NL2A 3OYAA 1N8RU 4HCCA 5CKHA 4IUQA 2DEQA 2LNVA 3BDLA 1VQLT 5I2SA 5J39A 3C95A 2KK4A 3QZ5B 3QJYA 3BY7A 3LYIA 4C8QB 5M9OA 3RKWA 3LGLA 5GANh 4B9XA 3I56T 4J8OA 4LDVA 4M77C 3L2RA 1YHQT 3VUBA 3JCMd 2F5TX 1VQ4A 3GIBA 3CCVA 5GANd 1WGSA 5GMKj 5LJ3j 2E70A 2VV5A 2BUDA 2ZPFB 2ZPIB 4MZTA 3P8DA 4TVRA 3EFSA 2ZPEB 4EMGA 5A2QE 3CCET 2PVDB 1YJ9A 1XTDA 1G3SA 2VGMA 4JRPA 1QVPA 3CEYA 5GAN7 5GAOp 1K9MU 5D6XA 3DLLA 3SFMA 2DZCA 4FT2A 3CCLA 3RERA 1M4ZA 2CZ6B 4M7AB 2M0OA 2DTOA 5LJ5j 2OUTA 1Y7XA 3ZFJA 2RQYA 1O9SA 3RMSA 4A53A 3E9FA 2QA4T 3FIFA 4IKFA 2YLCA 4FM4B 3JSCA 4N0AA 4DOVA 4XTWA 1G5VA 2DJZA 2RD1A 3GNGA 1D3BB 4HA8A 4Y28E 5GAN4 3X26B 4HT9A 4R56A 4E7IA 5FU6C 3JB9J 1O75A 2DIQA 3OBYA 1M5Q1 3OB9A 3JCMQ 4M78G 1WJRA 4M78A 2MWOA 2QEXT 1VQPA 5GAOq 2ZPGB 4RKUE 3A5ZB 4FT4A 4M77G 4M77A 1K8AC 2AHJB 3SWNA 3LGFA 4M7DA 4M7DG 2OTLA 5A0LA 2F5KA 5KE2A 2DXTA 3S6WA 1W2BS 3JCMf 3MP8A 1BIAA 1M8VA 1NPPA 3H6ZA 2EKOA 1YITA 5CQXA 4OB0B 1UGPB 3G6ET 1YIJA 3CC2A 2K57A 1LOJA 5LJ5h 1QP2A 1VQOA 3VJPA 5IT9E 3MEUA 3M4GA 4YTLA 3S3OA 2KDSA 4C0ZA 3OYHA 3FB9A 3PGGA 1RI0A 2QQRA 2XDBA 4BY6B 4BB7A 5I2MA 3UDCA 1DJ7B 4PJOG 2K5FA 4M77F 4PJOA 3OY9A 2R5AA 3JCMJ 4CRIA 3E1SA 2CZ7B 3CCST 4XTZA 4BI3A 4C8QC 4L59A 5DY9A 2DXUA 5KCOA 3JB9H 3VU3C 3V7SA 1I81A 4OB3B 1K8AU 3OA6A 4II1A 4CI0C 2DD4A 3CC7T 2R57A 3L42A 4E7HA 1M90C 3CBOA 3ASKA 4ZN1A 4J5YA 2EAYA 4M75D 3BW1A 2E41A 3JCMV 4JS4A 3MEWA 5D6YA 2E64A 2CZ0B 3F70A 2WACA 3HPWA 2DPPB 3L1AA 3M57A 3QUIA 3VKIA 1KQ2A 5IN1A 3CMEA 3JCMW 1ZBXA 1B34A 1PSEA 5GAN2 3INZA 1OZ3A 4LD9K 4A4HA 4EMHA 3TEEA 2YRVA 3M55A 2DO3A 4C0GA 2QXFA 3OSVA 3QIIA 4XK8E 4ZGJB 1N9RA 3MCAB 4OF1A 3I55A 1GXIE 4F7UB 3MHXA 1PSFA 3J81E 1BI0A 3OYMA 1S72A 3CBPA 3V8KA 4EPCA 2ZPBB 2QQSA 2L8DA 4HCZA 3CCQT 1M90U 2ZPHB 3A8MB 4MZPA 3V8JA 4ZGEB 1X6OA 1QVGA 4KUIA 2RA2A 3CMAT 2E6NA 1VQ9A 1JBMA 3C94A 3X20B 1VQLA 4N4HA 4BE1A 3VUZA 1OI1A 2K3YA 4PLIA 2KVQG 2A3LA 4ZTFA 3NTHA 2FHDA 5GANj 2HAXA 4FL6A 2XD0A 3T9NA 1VQNT 3PIOA 3FJPA 3JCMb 2IG0A 1V29B 2KQWA 3GLXA 2Y90A 2LQ8A 3VV0A 1UGRB 2CGHA 3M53A 3UT1A 4BY6C 3CCEA 5FU7B 1NZ9A 4E7JA 1NPRA 1Y96B 1WQ7A 3GF5A 1FWZA 5CIUA 4D6WA 4X9DA 4NL3A 2RM4A 2WSCE 4ZN3A 4GY5A 5C6SA 2GCXA 4ELYC 1JB0E 4UC4A 2F69A 3JCMc 5CCAA 3G71T 2DK3A 3RKXA 4A4KA 2QA4A 4OGEA 4XAXB 3JCMh 1BYMA 2PUKB 1BI3A 3RESA 2LT4A 3SD4A 2CKKA 4FU6A 4JS5A 3FEOA 4Z02A 3MEAA 4RG8A 4OB1B 3WVDB 2QEXA 3NFCA 2PQWA 3KXTA 1QVFS 4HKEA 3KUFA 4M78D 2VGNA 2DAQA 2MWPA 3MEVA 2V8KA 2G3RA 1FX7A 3OYEA 3OYLA 2CBGA 4M77D 4LDWA 3A8HB 3OS1A 1VQKA 4ME7A 2FB7A 4BI4A 2VC8A 4ZGDB 1JRIA 3L2VA 4RMOA 2LT1A 3G4ST 1XQHA 3CC4T 4M7DD 3DB4A 2VUBA 3G6EA 1VQ8T 2PVOB 4MDXA 3OSSC 4LDUA 4EMKC 4E7KA 3CCUT 4C92B 2L89A 3SB2A 1VQ7T 4M75B 3PIPA 3CXCS 2R5MA 1YJNT 2RO0A 5GAOr 4OGCA 4MDWA 2XKOC 2YHTA 4A4GA 2RJCA 4RG2A 4ATOA 1H3ZA 3CCSA 1QVFA 4PJOD 1KHCA 3CD6T 2RHXA 3CCMT 2RHIA 3A8GB 2BIVA 1VQ5T 4C5GA 4J6WA 1WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BE2 A;  5FRN A;  2R57 A;  3L42 A;  4E7H A;  3ZEH A;  3ASK A;  3OYG A;  2E5Q A;  1OZ2 A;  2L3R A;  3LH0 A;  3MEW A;  2X4W A;  5D6Y A;  3F70 A;  4B9W A;  3NTK A;  2WAC A;  2M1H A;  2RJF A;  4NS5 A;  5IN1 A;  4Q5W A;  3OYK A;  3ME9 A;  3MP6 A;  1OZ3 A;  3NTI A;  2O4X B;  2D9T A;  2RI3 A;  2LCC A;  2RHY A;  4A4H A;  2XK0 A;  2YRV A;  4QQG A;  4A4E A;  3O8V A;  4ZTJ A;  3QII A;  5IAY A;  2X4X A;  3PFS A;  3PNW C;  5D6W A;  3OYD A;  3LX7 A;  3OYM A;  3PMT A;  3OYN A;  3MP1 A;  2K3X A;  2QQS A;  2HQE A;  2L8D A;  4QVZ A;  4HCZ A;  3OYF A;  3L2W A;  2LTO A;  1N27 A;  5KH6 A;  5FRM A;  2X35 A;  4N4G A;  3MO8 A;  2M16 A;  2O4X A;  4IUR A;  3QKJ A;  3L2U A;  3FLG A;  3OYA A;  2E6N A;  4IUQ A;  3PMI A;  1WJS A;  3BDL A;  3LLR A;  2LRQ A;  2RHZ A;  3M9Q A;  3OMC A;  4N4H A;  4QQD A;  5J26 A;  5J39 A;  1OI1 A;  4BE1 A;  1WJQ A;  2B8A A;  3LYI A;  2K3Y A;  5M9O A;  3LGL A;  4PLI A;  4E7L A;  4ZTF A;  3NTH A;  2FHD A;  3DLM A;  4B9X A;  4FL6 A;  3L2R A;  4C5H A;  4PLL A;  4QW2 A;  4C5I A;  3OYC A;  2IG0 A;  1WGS A;  2JTF A;  2XDP A;  2BUD A;  2P0K A;  3P8D A;  3UT1 A;  4X34 A;  3QBY A;  4E7J A;  3CEY A;  2R58 A;  3MET A;  5CIU A;  3Q1J A;  2EQU A;  5D6X A;  4IUT A;  1OYX A;  2LDM A;  4GY5 A;  5C6S A;  2X4Y A;  4UC4 A;  2M0O A;  2HQX A;  3OMG A;  4IKF A;  3E9F A;  4IUP A;  3SD4 A;  3S3M A;  2CKK A;  4FU6 A;  4A4F A;  2RHU A;  1G5V A;  2DIG A;  3E9G A;  3FEO A;  4Z02 A;  3MEA A;  2RJD A;  2EQM A;  3GOX A;  3EAE A;  3QJ6 A;  2GFU A;  2RI5 A;  4E7I A;  5KE3 A;  2DIQ A;  2RJE A;  2PQW A;  3OB9 A;  4BDZ A;  1MHN A;  1WJR A;  2MWO A;  4PL6 A;  4C5E A;  2LVM A;  3KUF A;  2DAQ A;  2MWP A;  3DB3 A;  3MEV A;  2G3R A;  3OYE A;  3OYL A;  3OYJ A;  3LGF A;  3OS1 A;  4OVA A;  3C4S A;  2F5K A;  4EDU A;  5KE2 A;  3OYB A;  3L2V A;  3FC3 A;  3S6W A;  4BE0 A;  3MP8 A;  5FRO A;  4BDY A;  3DB4 A;  3H6Z A;  2EKO A;  4IUU A;  3OS0 A;  2JZ2 A;  2EFI A;  2GFA A;  3OQ5 A;  5KCH A;  4E7K A;  2NLU A;  2EQK A;  2L89 A;  4BAC A;  3MEU A;  2R5M A;  3S3O A;  2RO0 A;  4N4I A;  3OYH A;  3OS2 A;  3P8H A;  4IUV A;  1RI0 A;  2QQR A;  3S3N A;  4A4G A;  2RJC A;  4RG2 A;  3FDR A;  3L2Q A;  1H3Z A;  2GF7 A;  3H8Z A;  2R5A A;  2VYT A;  3UWN A;  1KHC A;  4CRI A;  3OY9 A;  3OYI A;  2RHX A;  1XNI A;  1SSF A;  2RHI A;  2BIV A;  4L59 A;  5KCO A;  2EQJ A;  4BD3 A;  5C0M A;  4LD6 A;  4C5G A;  2RI2 A;  3OA6 A;  4II1 A;  2BKD N;  4QQ6 A; 
#chains in the Genus database with same CATH topology
 2CDT A;  2VKN A;  2XU8 A;  2EGA A;  4DBR A;  1YJW T;  2DL5 A;  5GMK e;  5DLO A;  5LJ3 e;  3CXC A;  2K7A A;  1X01 A;  1D0Z A;  4HT8 A;  1EIF A;  2GTO A;  1E6H A;  3QWX X;  3JCM P;  2DF6 A;  3D7S B;  3PNW C;  4J7F A;  1KQS S;  5LJ3 d;  3EHQ A;  2K3X A;  2GGR A;  2HQE A;  3AHU A;  5FW9 A;  2KSS A;  2ENM A;  2XG8 D;  4P5N A;  3HSB A;  4M7A E;  3THK A;  1WJS A;  1QVG S;  1M1K U;  2RHZ A;  5J26 A;  2CRE A;  2B8A A;  2FPE A;  1Q81 C;  2DTI A;  4C92 C;  3M0S A;  2A37 A;  3HP9 A;  2P0K A;  2LQK A;  1Y71 A;  2W10 A;  1YP5 A;  1BCM A;  2R58 A;  5GAN 6;  2H9R A;  4C8Q A;  4C8Q G;  4M78 B;  1M90 R;  1YIT T;  1YIJ T;  2LDM A;  4M77 B;  4OML A;  1WHM A;  3G71 A;  2BZ8 A;  2CP3 A;  3CQT A;  2HQX A;  2RMO A;  3V8L A;  1K73 U;  4M7D B;  2FRY A;  5KYW B;  1FMW A;  3I56 A;  2EVR A;  1YHQ A;  3EHR A;  4PJJ A;  2V8I A;  2EJ9 A;  5DLQ E;  2M51 A;  3GP8 A;  1XOV A;  1PRL C;  1CKA A;  2OAW A;  4IIO A;  1G3W A;  3URG A;  3H0H A;  3G36 A;  4CC7 A;  2FVU A;  2DL4 A;  2EQK A;  4BAC A;  1YJN A;  3HFN A;  3FRN A;  4IUV A;  2VXE A;  2CUB A;  3S3N A;  1U1S A;  4M7A F;  3CD6 A;  1I5L A;  3UFE A;  1B34 B;  4KGZ B;  1KD1 U;  2RI2 A;  1BIB A;  1WHG A;  4JLI A;  4BE2 A;  5GAN e;  2K2V A;  3JB9 D;  1WPY A;  4KH0 B;  2HKQ B;  2A36 A;  3P8B B;  1GFC A;  3CCR A;  4M78 C;  2AIR B;  3OYK A;  4AMC A;  4J9G A;  4M7D C;  2OTL Q;  2DBK A;  5IAY A;  3A98 A;  2I2L A;  5HCK A;  1NJI U;  3G7Z A;  3E19 A;  3J7A F;  3EGX B;  3PMT A;  5IXF A;  1RL2 A;  1H64 1;  4XTU A;  3IM3 A;  2JXB A;  1VQO Q;  1X27 A;  3CPW S;  3FLG A;  2KYG A;  3PMI A;  2RB6 A;  3LLR A;  5CK9 A;  2J6O A;  2YWW A;  1WJQ A;  4HVU A;  1SF9 A;  4F7U G;  4F7U A;  3DLM A;  2NUT A;  2BE7 D;  4C5H A;  4QW2 A;  3OW2 S;  2DZ9 A;  2VXF A;  4AFZ C;  4XU3 A;  1RAE B;  5A0G A;  1YJ9 T;  3JB9 I;  1KG1 A;  2KBT A;  3MPU B;  3QZ9 B;  2EQU A;  2E10 A;  2JW4 A;  4MZM A;  3QFY A;  3TSZ A;  1Q82 R;  5GAM j;  5IH2 A;  1KC8 U;  2MF2 A;  2OX7 A;  2P84 A;  5GAO m;  2P4T A;  2RHU A;  1GBQ A;  1W2B P;  2QQB A;  1Y96 A;  3QDR B;  5KE3 A;  5AT1 B;  4M75 C;  1JU5 C;  4JDS A;  1QWE A;  2EYY A;  1I0C A;  1TU0 B;  3AT1 B;  2KGT A;  1IZ6 A;  1YBY A;  1W2B A;  4RT4 A;  2P0Q A;  2OTL T;  2JN0 A;  1FMV A;  1BI2 A;  4J9H A;  5GAM h;  4B6M A;  3UPU A;  2YUP A;  1BBZ A;  4E47 A;  1VQO T;  1UUE A;  4JLG A;  4C0F A;  2L0A A;  1SSF A;  1PKS A;  4PFZ A;  5C0M A;  3JCM g;  2BKD N;  2E12 A;  1M30 A;  1KFZ A;  4RIQ A;  2HSE B;  2MPX C;  3CBM A;  1YCS B;  1Z9Z A;  2QEX Q;  2RH2 A;  1Q86 R;  1EZZ B;  3QFZ A;  1LJO A;  1Q95 G;  5CKD A;  2RQR A;  2MMP A;  2CUD A;  5GMK m;  3O8V A;  1LNX A;  2D0Q B;  4JRQ A;  2PVG B;  2X4X A;  3I55 T;  4A54 A;  1NG2 A;  2CZ1 B;  2ED0 A;  3OYN A;  3MJX A;  3UAT A;  4OB2 B;  1K9M C;  4FIB A;  3L2W A;  2A0F B;  2O4X A;  1N8R U;  1TTH B;  2LNV A;  1GFD A;  3CCS Q;  3QJY A;  4C8Q B;  5M9O A;  3LGL A;  2F5T X;  2EPD A;  3ACT A;  1MUZ A;  2ZPI B;  1XTD A;  4FT2 A;  1RAA B;  5LJ5 j;  1Y7X A;  2RQY A;  3RMS A;  3VS2 A;  1X2K A;  4A53 A;  2FZG B;  3U23 A;  2JTE A;  4Y28 E;  3X26 B;  4E7I A;  4QT7 A;  2QEX T;  3OB9 A;  1VQP A;  1SKU B;  1QWF A;  2AHJ B;  3S4B A;  2ROT A;  2LJ3 A;  2LMJ A;  5KE2 A;  3S6W A;  6AT1 B;  1NPP A;  1L6E A;  4OB0 B;  5LJ5 h;  1QP2 A;  4LXC A;  2KDS A;  3OYH A;  1K9A A;  3TQ7 P;  4PJO G;  4PJO A;  2K5F A;  3QG0 A;  3E1S A;  2CZ7 B;  3CCS T;  4XTZ A;  4C8Q C;  2HEQ A;  5DY9 A;  3VU3 C;  1K8A U;  4OB3 B;  3CC7 T;  1M90 C;  3ASK A;  2E41 A;  3MEW A;  3HPW A;  1CKB A;  3CME A;  1KQS P;  3JCM W;  1ZBX A;  2DL7 A;  1WHK A;  1D0Y A;  4AFQ C;  2RQW A;  1TUD A;  1SRM A;  3VS1 A;  2DO3 A;  3M0T A;  1Q81 R;  1QVG P;  4F7U B;  3CCU Q;  4HCZ A;  2ZPH B;  2KT8 A;  1QVG A;  2H8H A;  2RPN A;  2ED1 A;  3VUZ A;  2XD0 A;  1I5O B;  1LVK A;  1D09 B;  1U3O A;  1IRX A;  2Y90 A;  1TSF A;  3M53 A;  3CCE A;  3LH5 A;  4FCY A;  1QCN A;  1AZG B;  1NPR A;  1WQ7 A;  1Y96 B;  1JO8 A;  2DBM A;  4X9D A;  1ABO A;  1VA7 A;  2I0N A;  4NL3 A;  2WSC E;  1PHT A;  4ELY C;  1JB0 E;  3JCM c;  2ECZ A;  5CCA A;  4A4K A;  4OGE A;  4XAX B;  1M3C A;  1BI3 A;  3RES A;  2LT4 A;  4JS5 A;  5KYU B;  3FEO A;  4RG8 A;  1N5Z A;  3WVD B;  4JJB A;  3KUF A;  4M78 D;  2DAQ A;  3MEV A;  3OYE A;  3CCJ Q;  4M77 D;  1VQK A;  2FB7 A;  4BI4 A;  4F9K A;  1JRI A;  2DLP A;  4M7D D;  2J7I A;  4MDX A;  3OSS C;  1AWW A;  1E7O A;  3CCU T;  3REB B;  3SB2 A;  2F2W A;  2D0N A;  4LE9 A;  4KGV B;  1JQQ A;  2AKK A;  2Z0W A;  1IHV A;  1H3Z A;  1QVF A;  1OOT A;  2NYS A;  1YI2 Q;  4J6W A;  3VYH B;  3FJ5 A;  3LW5 E;  1PM3 A;  2YUQ A;  1D1C A;  2E5Q A;  2MI6 A;  1Q82 C;  4J7I A;  4L5G A;  2QG9 B;  4OMF B;  2JUF A;  2COW A;  1BCO A;  3NTI A;  2O4X B;  2SRC A;  2LCS A;  4EMK A;  2RHY A;  2DL3 A;  2XK0 A;  1VYV A;  4QQG A;  2C06 A;  3CPW P;  1NBE B;  5GAM g;  2FRW A;  3LX7 A;  8AT1 B;  2IIM A;  4VUB A;  2WSF E;  2P0P A;  5I22 A;  3ULR B;  5HKC A;  3L2Z A;  3CPW A;  3OW2 P;  2M16 A;  3QKJ A;  3PVL A;  4C92 E;  3CMA A;  3CCJ T;  3DKM A;  2PUO B;  1VYU A;  1YFN A;  2BE9 B;  3M9Q A;  2Y4X A;  4E7L A;  1KHI A;  2JT4 A;  3M59 A;  2QGG A;  3EGU A;  2E3I A;  1MGQ A;  1G3T A;  2DYI A;  3PTA A;  1KIK A;  1UHF A;  2JMC A;  1G3Y A;  2QQA A;  3A8L B;  1VQ9 Q;  4PJM A;  3ZL7 C;  2EYQ A;  1M9S A;  4IUT A;  1YI2 T;  3QPH A;  3KBG A;  4FW1 A;  2CH4 A;  1Q86 C;  4E6R A;  4A4F A;  1QLY A;  2DYB A;  3C0C A;  1Q81 U;  3QJ6 A;  2GFU A;  2XMF A;  3VS4 A;  2NWM A;  3EG3 A;  2LX9 A;  4DOW A;  3DB3 A;  4M7A A;  4M7A G;  3M0P A;  4PJO B;  2ZGW A;  2LJ1 A;  2H3J A;  1U06 A;  2LCL A;  2GNC A;  4KUD K;  1VQ8 A;  2XIC A;  4OMM A;  1I8F A;  3EH1 A;  3CCV Q;  4DEX A;  4N4I A;  3OS2 A;  5LL6 S;  2JOY A;  2DE0 X;  3OBW A;  1ZBJ A;  2BZY A;  4C92 F;  2D1X A;  2DD5 A;  1C1A A;  4AG2 C;  2DL8 A;  4Y91 A;  1VQ6 T;  2EQJ A;  3CCL Q;  2DEU A;  5KYN A;  4QQ6 A;  3NPF A;  4M78 E;  5FRN A;  1GCQ A;  1K9M R;  1QMC A;  2YLB A;  4DQ2 A;  1YJW A;  4M7D E;  2V1R A;  2D6F A;  2DXC A;  1VQ9 T;  4F16 A;  2X3W D;  2CB9 A;  1BI1 A;  5HY6 A;  1V76 A;  3BFM A;  1QKX A;  2JM9 A;  5LJ5 g;  1AWO A;  1Y0M A;  1RAC B;  2EYW A;  3HKS A;  2X35 A;  2JMA A;  3MO8 A;  4L6V 5;  2ZCF B;  4PJO C;  4KBM B;  3OMC A;  1TH7 A;  3EG9 A;  1JJ2 S;  2EJF A;  2LNH B;  2DRM A;  5LJ3 h;  5GMK h;  3CCV T;  3RBB B;  3QBY A;  2FZC B;  1M2V A;  1ZA2 B;  4C8Q D;  2M9U A;  4X9C A;  3VS5 A;  3CCL T;  2KRM A;  4GLK A;  4M75 E;  2L5Q A;  5A0D A;  3JRZ A;  4M78 F;  1MND A;  5J3B A;  4PJL A;  3GOX A;  2RJD A;  2EQM A;  1S72 Q;  3EAE A;  4M7D F;  1IRE B;  3GNF B;  4DA4 A;  5EG2 A;  3S4D A;  4C5E A;  2W0Z A;  4AFU C;  4FYX B;  4LDY A;  2OAU A;  3M54 A;  1D0X A;  1M1G A;  1BKB A;  1VQL Q;  3FC3 A;  1I07 A;  3QXE B;  2MCN A;  4D8K A;  4BDY A;  1OPK A;  2JVV A;  3QSU A;  3OS0 A;  3I56 Q;  2EFI A;  2GFA A;  2KEA A;  3OQ5 A;  1YHQ Q;  4J6X A;  3CC2 T;  2RQU A;  1H8K A;  2O31 A;  3P8H A;  1WXU A;  3TRE A;  3FDR A;  2J6K A;  2JJ9 A;  3UWN A;  1XNI A;  1N9S A;  3BE3 A;  1SRL A;  4LD6 A;  4EMK B;  2RQV A;  2KI7 A;  1IB8 A;  1ZLM A;  3ZEH A;  5CQY A;  3G4S A;  3OYY A;  1C6V X;  2F2V A;  3LWI A;  3LH0 A;  3QDF A;  2M1H A;  2YXY A;  2X9H A;  3CD6 Q;  2KE9 A;  1PWT A;  3MP6 A;  3RRS A;  1UGS B;  1MV3 A;  3R6N A;  3J80 E;  4M75 F;  3EG1 A;  2HL5 C;  1S72 T;  1F1B B;  1T0H A;  5FWB A;  2FL7 A;  3M5A A;  3EG2 A;  1N27 A;  3C12 A;  4IUR A;  1S1N A;  4NL2 A;  5CKH A;  3BDL A;  1VQL T;  1AOJ A;  5GAN h;  3KFV A;  3RKW A;  2E4H A;  3I56 T;  4M77 C;  1YHQ T;  3VUB A;  3GIB A;  1U5S A;  1GBR A;  5GAN d;  1PNJ A;  1QKW A;  1YJ9 A;  1T3L A;  1G3S A;  2VGM A;  1QVP A;  5GAN 7;  5GAO p;  1RUW A;  1K9M U;  3UF4 A;  2DZC A;  4M7A B;  2M0O A;  2OUT A;  3SHW A;  1M27 C;  4IKF A;  3E9F A;  1OX8 A;  1AWX A;  2YLC A;  3JSC A;  4XTW A;  4E2F B;  1G5V A;  1B07 A;  4HA8 A;  5GAN 4;  3CCQ Q;  2MWO A;  2ZPG B;  2E5K A;  2OTL A;  3JCM f;  3MP8 A;  1BIA A;  1M8V A;  2EKO A;  5CQX A;  1LOJ A;  1WHH A;  2M0Y A;  3H0I A;  1VQO A;  3VJP A;  4YTL A;  3S3O A;  4BB7 A;  5I2M A;  3UDC A;  2YDL A;  1K1Z A;  1HSQ A;  1KJW A;  2QAZ A;  3OY9 A;  2C0I A;  4L59 A;  2DXU A;  3V7S A;  2DD4 A;  1UEC A;  3O5Z A;  2NUZ A;  1WI7 A;  2EAY A;  3BW1 A;  1SHG A;  4Z89 A;  2J06 A;  3VKI A;  1Q7Y R;  1AWJ A;  3NHN A;  1X2Q A;  4QKU A;  1PSE A;  5GAN 2;  4LD9 K;  4OMQ A;  4IIM A;  2YRV A;  3M55 A;  4HVV A;  3OSV A;  4ZGJ B;  3CC4 Q;  3EG9 B;  1MMA A;  1XJW B;  3I55 A;  4F14 A;  3EGD A;  1GXI E;  3J81 E;  2CP6 A;  3A1P A;  4EPC A;  1YWO A;  2SEM A;  2ZPB B;  3UA7 A;  1VQ7 Q;  3CCQ T;  2V1Q A;  1M90 U;  4CC3 A;  1X6O A;  4KUI A;  2E6N A;  1JBM A;  4N4H A;  4BE1 A;  3CCM Q;  2CQS A;  3GBQ A;  2GTJ A;  2K3Y A;  1VQ5 Q;  3NTH A;  2CH4 W;  3VS6 A;  1GCQ C;  3GLX A;  2D8H A;  1PC0 A;  2RF0 A;  5GJV B;  2RM4 A;  1WZO A;  1BYM A;  4PFO A;  1OPL A;  4Z02 A;  2OTJ Q;  2DX1 A;  2QEX A;  3NFC A;  3KXT A;  4HKE A;  2G3R A;  2CBG A;  4LDW A;  3A8H B;  2AZV A;  1UHC A;  4ZGD B;  1XQH A;  3CC4 T;  2AK5 A;  3DB4 A;  2PVO B;  1AEY A;  5IHK A;  4GLM A;  2LX7 A;  1VQ7 T;  4RTW A;  3PIP A;  3CXC S;  3VRY A;  2R5M A;  1VQP Q;  2RO0 A;  2V26 A;  4MDW A;  4A4G A;  2RJC A;  4F17 A;  4ATO A;  3CCS A;  4PJO D;  1KHC A;  3CCM T;  4DBQ A;  2BIV A;  1VQ5 T;  3CC7 A;  1B7T A;  2M02 A;  3V7C A;  1YCY A;  2EWN A;  2FO0 A;  2COY A;  4B9W A;  2X4W A;  3EFO A;  2G6F X;  4NS5 A;  1JEG A;  1RAI B;  2DVJ A;  2XDD A;  4LDX A;  2E65 A;  2JNG A;  1BB9 A;  3M0R A;  4JUV A;  4CC2 A;  4MMK A;  2XI9 A;  5HK0 A;  3JB9 F;  4A63 B;  2AZS A;  3PFS A;  1FXX A;  1VQM Q;  2K3B A;  3CME Q;  2OTJ T;  4QVZ A;  3H9N A;  5EC7 A;  4ESR A;  2DVE A;  4PK4 A;  3OS5 A;  1M1F A;  1Q82 U;  2PTK A;  1ZHI A;  1OU9 A;  2LRQ A;  2EW3 A;  4DBF A;  2DJQ A;  1ZA1 B;  3OYC A;  2JTF A;  1KQS A;  2NUT B;  2KAF A;  2XHC A;  1A0N B;  1OYX A;  2X4Y A;  4J83 A;  1R2A A;  1I1J A;  3QHS A;  3SEM A;  3E2U A;  4GBQ A;  1AZE A;  4O6J A;  2O2O A;  1FMK A;  2K5I A;  4Z88 A;  2L2P A;  1UE9 A;  1T3S A;  4OMP A;  1OV3 A;  2F1L A;  4C92 G;  3I9Q A;  4C92 A;  4R55 A;  4OVA A;  3M56 A;  3C4S A;  1Y07 A;  2JZ2 A;  1D3B A;  2CSQ A;  3JAM E;  1SHF A;  2AKL A;  1VQM T;  3CCU A;  2K4Y A;  3CME T;  1Q86 U;  1NEB A;  1VQ4 Q;  1H92 A;  5CR2 A;  1X75 C;  4JZ3 A;  3QYH B;  3BDU A;  4WF2 A;  1VQK Q;  3V7R A;  2DA9 A;  4BD3 A;  4ZP3 A;  2CS7 A;  2KNB B;  5GAM f;  2XID A;  3RIR A;  1IXD A;  5AYF A;  3EGD B;  4XU0 A;  5CKE A;  3I5S A;  1QW1 A;  3SDZ A;  1MMG A;  4HCK A;  1R77 A;  2LCC A;  4A4E A;  2FZK B;  5KYY A;  1G83 A;  2EGE A;  2CT3 A;  1CSK A;  2A08 A;  4PJO E;  4LN2 A;  3LWH A;  1ZQ1 A;  1AD5 A;  4RTA A;  3X24 B;  5I21 A;  4FSX A;  4RTX A;  3RR6 A;  4RCB A;  1VYT A;  2QDY B;  2O88 A;  3CCJ A;  5HK3 A;  1PRM C;  1UGV A;  2YUO A;  3HRU A;  2EKH A;  1WLP B;  1M8M A;  1NYF A;  3M0Q A;  4PLL A;  4J6Y A;  1VQ4 T;  1HXD A;  2XDP A;  2QQ9 A;  4MML A;  5GAN 8;  3CMA Q;  3NGP A;  1VQK T;  1P92 A;  4BI8 B;  1RLP C;  1PG5 B;  1WDX A;  1NLP C;  9ATC B;  1YI2 A;  1Q7Y C;  4J9I A;  2HD0 A;  2KXC A;  2X51 A;  3GPL A;  3OMG A;  1M1K R;  1W4S A;  4HCB A;  1FYN A;  1TXQ A;  2DIG A;  3OW2 A;  1E6G A;  2RI5 A;  4ZNX A;  1VQN A;  1WHJ A;  2V8J A;  1ABQ A;  2RJE A;  2KRN A;  4BDZ A;  5DM7 R;  5GAN 3;  2K9Q A;  4RTZ A;  3OYJ A;  1QCF A;  4M7A D;  4EDU A;  2HCK A;  3OYB A;  4BE0 A;  3M0U A;  4IUU A;  3X25 B;  1JXO A;  2HMA A;  4PJO F;  1K73 R;  1IGU A;  2GF7 A;  3GWH A;  3H8Z A;  3TCJ A;  2VYT A;  5I11 A;  2PU9 B;  3PVQ A;  4BUG A;  1U1T A;  1VQ6 A;  1VQ8 Q;  4XQ3 A;  4J9D A;  5LJ5 f;  4DEY A;  3M4Y A;  4M75 G;  4M75 A;  2QA4 Q;  2EJG A;  4J9F A;  1J3T A;  2A7Y A;  2RK1 A;  3HRT A;  2L3S A;  3QG1 A;  4DBH A;  5FU6 B;  2J6F A;  1YNZ A;  1WXT A;  2JTM A;  5L8R E;  2EYX A;  4XU1 A;  3QO3 A;  2VB6 A;  3EGX A;  1M3B A;  3PE0 A;  5FWC A;  1VUB A;  2JS0 A;  2KYM A;  3QWY A;  5D6W A;  3OYD A;  5CO7 A;  3G6E Q;  1TOV A;  1W70 A;  2DRK A;  2EIF A;  5KYX A;  3JCM e;  4NOY A;  3ACS A;  3VS0 A;  2HNI A;  4M77 E;  1NE8 A;  3OYA A;  4IUQ A;  2DEQ A;  3C95 A;  3QZ5 B;  3LYI A;  5IHN A;  4B9X A;  3JCM d;  1Z9Q A;  2JS2 A;  3CCV A;  7AT1 B;  5GMK j;  5LJ3 j;  2VV5 A;  4MZT A;  2BUD A;  4TVR A;  1B3Q A;  3EFS A;  2ZPE B;  2EZW A;  3CEY A;  1AT1 B;  2LP5 A;  3DLL A;  3SFM A;  3CCL A;  2VAS A;  3RER A;  1M4Z A;  2KXD A;  2DTO A;  2HBW A;  2QA4 T;  1RAG B;  2RQT A;  4N0A A;  3EH2 A;  1SEM A;  3GNG A;  1D3B B;  3S4A A;  5FU6 C;  3JB9 J;  3OBY A;  3JCM Q;  2L3Q A;  1WJR A;  2YSQ A;  3RNJ A;  3CXC P;  4ANJ A;  3SWN A;  4F04 B;  2K6D A;  3LGF A;  2H3E B;  2MYS A;  2F5K A;  1UG1 A;  3VS3 A;  2DXT A;  2I15 A;  2KRS A;  1YIT A;  2OJ2 A;  4PFP A;  1UGP B;  3G6E T;  1YIJ A;  3CC2 A;  1MV0 B;  2DM1 A;  4RTY A;  2KT1 A;  5IT9 E;  3MEU A;  3M4G A;  1KC8 R;  3PGG A;  1RI0 A;  2XDB A;  4BY6 B;  1DJ7 B;  4M77 F;  3MKD A;  2R5A A;  3JV3 A;  4CRI A;  4BI3 A;  5KCO A;  3JB9 H;  3H0F A;  4II1 A;  3G71 Q;  1K76 A;  4CI0 C;  1ZUU A;  3L42 A;  4E7H A;  4ZN1 A;  5KYY B;  4J5Y A;  4ORZ A;  3VRZ A;  3JCM V;  2QK0 A;  4HT9 A;  2CZ0 B;  3M57 A;  2WAC A;  2BTT A;  1OZ3 A;  2QXF A;  3G4S Q;  4XK8 E;  3QII A;  1N9R A;  3MCA B;  2AT1 B;  3MHX A;  3OYM A;  1BI0 A;  1S72 A;  1SG5 A;  3CBP A;  4JPB W;  1LPL A;  1ZSG A;  1H3H A;  2QQS A;  1YJN Q;  4MZP A;  3V8J A;  2RA2 A;  1YN8 A;  1AVZ C;  1EX4 A;  1W1F A;  3C94 A;  1VQL A;  4KGX B;  4PLI A;  1K0X A;  4ZTF A;  2HAX A;  5GAN j;  3T9N A;  2K9G A;  1SPK A;  4X1V A;  3FJP A;  2KQW A;  3RSY A;  1UGR B;  1MMD A;  2CGH A;  2IPO B;  3UT1 A;  4BY6 C;  5L23 A;  1RAD B;  5FU7 B;  4E7J A;  1X6B A;  2B86 A;  1WYX A;  1FWZ A;  4PJN A;  4D6W A;  3CCR Q;  1TUG B;  4GY5 A;  2MOX A;  4UC4 A;  3G71 T;  3RKX A;  1N8R R;  2LZ6 B;  2PUK B;  2CKK A;  2CSI A;  1YJ9 Q;  3MEA A;  1NM7 A;  1HYO A;  2PQW A;  1QVF S;  1YWP A;  2VGN A;  3TVT A;  2YT6 A;  2MWP A;  3OYL A;  1VOM A;  2QTV A;  2J05 A;  4RMO A;  2E3H A;  3G4S T;  2VUB A;  2DNU A;  4FYV B;  4EMK C;  4E7K A;  2HSP A;  1IO6 A;  4M75 B;  1YJN T;  4OGC A;  2XKO C;  1R0B G;  3IQL A;  2NUP A;  4RG2 A;  1RAF B;  3CD6 T;  4HXJ A;  3A8G B;  3AFJ A;  2DRN A;  1WQW A;  3JB9 G;  1QP3 A;  2COZ A;  4J9E A;  5GJW B;  1OZ2 A;  2EYZ A;  5FU7 C;  2KNG A;  2RJF A;  1X69 A;  1M1K C;  1TWB A;  5KYX B;  1AHJ B;  2Y4Y A;  2YRC A;  4C8Q E;  4XTX A;  3ME9 A;  3QYG B;  3CCR T;  1BU1 A;  3RKY A;  5ECA A;  5CAI A;  4XTV A;  4JRK A;  2D9T A;  2O9V A;  4ZTJ A;  5CKB A;  4KRT A;  4M4Z A;  5FLX E;  2KR3 A;  3I35 A;  1G8X A;  1K8A R;  1IHW A;  1ACM B;  1EFN A;  3CCQ A;  2EQI A;  2LTO A;  3HL8 A;  5FRM A;  3X28 B;  2YUN A;  1K73 C;  1QQJ A;  8ATC B;  3HHT B;  3I55 Q;  2QI2 A;  2ZAE A;  2RN8 A;  2FYK A;  4RTU A;  4M7A C;  4Z8A A;  5GAM e;  4X34 A;  3WVE B;  1SSH A;  1UB4 A;  3MET A;  2HL3 A;  3Q1J A;  5KYU A;  4JJN K;  3SWN B;  1N6A A;  3UA6 A;  5LJ3 f;  1X43 A;  1M2V B;  4WCI A;  5GAM d;  3E9G A;  4QVC A;  2ZZD A;  1MNE A;  4PL6 A;  1OUL A;  1RI9 A;  2LVM A;  4C8Q F;  1KD1 C;  1ZSZ A;  3R6O A;  3CPF A;  1GL5 A;  4OMN A;  1ZUK A;  3ZBD A;  3CC4 A;  4RTT A;  2DXB A;  5GAO l;  5KCH A;  4OP0 A;  2QAS A;  1VQ7 A;  1QCO A;  2HDA A;  1M2O A;  1OX9 A;  2KY9 A;  2GQI A;  2VWF A;  3OYI A;  3EFR A;  3CCM A;  4K11 A;  1VQ5 A;  4F7U E;  1NJI C;  2K2M A;  2DER A;  1WFW A;  1D1A A;  3M58 A;  2HKN A;  1VIE A;  4XU2 A;  3OYG A;  4N0A C;  5IXB A;  2LC4 A;  5LJ3 g;  4AG1 C;  1K4U S;  4OMO A;  1GCP A;  1PD1 A;  2ATC B;  3RMQ A;  1ZX6 A;  4C0D B;  1UGQ B;  4CC4 B;  4FYY B;  2HBP A;  2RI3 A;  4LNP A;  3SWN C;  3CC7 Q;  1TUC A;  1ZUY A;  2CT4 A;  2JM8 A;  2WSE E;  3S4C A;  5GAO n;  1HD3 A;  5GMK i;  1RAH B;  2OTJ A;  2KYB A;  3WXM B;  2KMT A;  5KH6 A;  4N4G A;  2DFU A;  2E1H A;  4JJD A;  3L2U A;  3JCM X;  3REA B;  1KQ1 A;  1TS9 A;  1KC8 C;  4QQD A;  5GMK l;  1Y57 A;  3G1J A;  1UEB A;  4JRI A;  1HK9 A;  4PKC C;  2K5L A;  2D8J A;  1MMN A;  2LQN A;  2LJ0 A;  2RK2 A;  5LJ5 e;  1VIF A;  1JJ2 P;  3RUX A;  2DKG A;  2DET A;  5GAN f;  1K0S A;  1WHL A;  1ARK A;  4F7U F;  3NMZ C;  2X3X D;  1I4K 1;  2QGF B;  4IUP A;  2HZY A;  3HFO A;  1JJ2 A;  3S3M A;  5LJ5 d;  1PCX A;  5GAN 5;  1MHN A;  1VQP T;  4C0D C;  3VS7 A;  2X4J A;  2IVW A;  2FG0 A;  2BZX A;  2NUP B;  3N5B B;  5CVI A;  2VVK A;  4C92 D;  1PD0 A;  3ER0 A;  5FRO A;  1R0C B;  1Q7Y U;  1VQM A;  1WXB A;  2NLU A;  2PZ1 A;  4EIK A;  2CYZ B;  1R8O B;  2DIL A;  2E6Z A;  3CCE Q;  4PNO A;  1D1B A;  4QVD A;  3L2Q A;  1JXM A;  4LUD A;  4D8D A;  2MIO A;  1KK7 A;  3H41 A;  4C5I A;  2EGC A;  5GAN g;  1OQK A;  4E7Z A;  2L3R A;  3HRS A;  3NTK A;  3TU4 K;  1N8R C;  4Q5W A;  2O01 E;  1KSW A;  4XTY A;  4V2S A;  4O5V A;  3VYG A;  2GQV A;  2QTX A;  4ELZ C;  2DTH A;  3PT9 A;  2L3P A;  3A8O B;  1UJ0 A;  2C0T A;  2GBQ A;  2ROL A;  1PKT A;  3RDV A;  4KUL A;  3EG0 A;  3MP1 A;  1OEB A;  1WNL A;  3OYF A;  5CKF A;  2EBP A;  2PNI A;  4RCC A;  2MAM A;  4KT0 E;  2O9S A;  4HCC A;  5I2S A;  5J39 A;  2KK4 A;  3BY7 A;  4LUE A;  4J8O A;  4LDV A;  3L2R A;  1VQ4 A;  1WX6 A;  4JZ4 A;  1WGS A;  1RLQ C;  2E70 A;  2ZPF B;  1OU8 A;  5A2Q E;  1U8R A;  2K79 A;  3P8D A;  4EMG A;  3CCE T;  2PVD B;  2KRO A;  4JRP A;  2DMO A;  2P4R A;  5D6X A;  2CZ6 B;  1QVF P;  1ZSZ B;  3ZFJ A;  1O9S A;  1C0M A;  1NYG A;  3FIF A;  4FM4 B;  3HTR A;  2CP5 A;  2C0O A;  4DOV A;  1UTI A;  2DJZ A;  2RD1 A;  3IM4 A;  5IHI A;  4R56 A;  1O75 A;  2DIQ A;  1M5Q 1;  3I5R A;  4M78 G;  4M78 A;  5GAO q;  2MK5 A;  3A5Z B;  4M77 A;  4FT4 A;  4M77 G;  4RKU E;  1K8A C;  4J9B A;  1X6G A;  4M7D A;  4M7D G;  1WIE A;  5A0L A;  1W2B S;  1GRI A;  3H6Z A;  5KYW A;  2K57 A;  1VQN Q;  1T0J A;  2CP2 A;  2ABL A;  4C0Z A;  3FB9 A;  2QQR A;  2RNA A;  4J9C A;  3JCM J;  2CP7 A;  2LQW A;  1M3A A;  1I81 A;  3OA6 A;  3TSW A;  2QYZ A;  2YRD A;  2R57 A;  3CBO A;  4M75 D;  4JS4 A;  5D6Y A;  2E64 A;  3F70 A;  3L1A A;  2DPP B;  2CP0 A;  1KQ2 A;  3QUI A;  5IN1 A;  1B34 A;  1VQ6 Q;  1RAB B;  2FPF A;  3INZ A;  4E7S A;  4A4H A;  4EMH A;  1ZSZ C;  3EFO B;  4JJC A;  3TEE A;  2FEI A;  4C0G A;  1UDL A;  4OF1 A;  2OI3 A;  1PSF A;  3V8K A;  2ESW A;  5HVZ A;  2L8D A;  3A8M B;  2QDL A;  4ZGE B;  3CMA T;  1VQ9 A;  3X20 B;  1OI1 A;  2KVQ G;  2A3L A;  4FW2 A;  2FHD A;  2IZY A;  1HJD A;  4FL6 A;  1VQN T;  3PIO A;  4WTO B;  3JCM b;  4R0K A;  2IG0 A;  1V29 B;  3VV0 A;  2LQ8 A;  4AFS C;  1YJW Q;  1LCK A;  4FYW B;  1NZ9 A;  1KD1 R;  3GF5 A;  1TG0 A;  5CIU A;  4ZN3 A;  1NEG A;  5C6S A;  2GCX A;  2F69 A;  2DK3 A;  2QA4 A;  4KH1 B;  3JCM h;  1BK2 A;  4FSS A;  3SD4 A;  4FU6 A;  1UJY A;  2FPD A;  1IGQ A;  4OB1 B;  1NLO C;  1G2B A;  2V8K A;  1FX7 A;  3OS1 A;  1NJI R;  4ME7 A;  2HQH A;  2VC8 A;  3L2V A;  2LT1 A;  3G6E A;  4HVW A;  1VQ8 T;  4RUG A;  4LDU A;  4Y92 A;  4C92 B;  2L89 A;  5D7U A;  1V1C A;  2A28 A;  3QDE A;  1W6X A;  5GAO r;  2CQT A;  2YHT A;  4AT1 B;  1UFF A;  2RHX A;  2RHI A;  4RTV A;  1YIT Q;  3CC2 Q;  1YIJ Q;  4C5G A;  2F2X A;  1WA7 A; 
#chains in the Genus database with same CATH homology
 3CC7 A;  3JB9 G;  3LW5 E;  1QP3 A;  2XU8 A;  3V7C A;  1YCY A;  2EWN A;  2E5Q A;  2MI6 A;  1OZ2 A;  4B9W A;  5FU7 C;  2X4W A;  4J7I A;  1YJW T;  1Q82 C;  4L5G A;  2KNG A;  2RJF A;  4NS5 A;  5GMK e;  4OMF B;  5DLO A;  5LJ3 e;  3CXC A;  1M1K C;  2JUF A;  2XDD A;  1AHJ B;  1X01 A;  2Y4Y A;  4C8Q E;  4LDX A;  4XTX A;  2E65 A;  3ME9 A;  2JNG A;  3QYG B;  3RKY A;  3CCR T;  5CAI A;  4JUV A;  4HT8 A;  3NTI A;  1EIF A;  4JRK A;  2O4X B;  2D9T A;  4XTV A;  4EMK A;  4MMK A;  2RHY A;  2XI9 A;  3JCM P;  2XK0 A;  4QQG A;  5HK0 A;  4ZTJ A;  5CKB A;  2C06 A;  3JB9 F;  5GAM g;  3PFS A;  3PNW C;  4J7F A;  5FLX E;  3LX7 A;  1KQS S;  4VUB A;  2WSF E;  1FXX A;  5LJ3 d;  2P0P A;  2K3X A;  2OTJ T;  5HKC A;  3L2Z A;  2HQE A;  3CCQ A;  4QVZ A;  3AHU A;  3CPW A;  2KSS A;  2DVE A;  2LTO A;  3HL8 A;  5FRM A;  3OS5 A;  2XG8 D;  1M1F A;  2M16 A;  1Q82 U;  4P5N A;  3QKJ A;  3X28 B;  4C92 E;  3CMA A;  3HSB A;  3CCJ T;  1ZHI A;  3DKM A;  4M7A E;  2PUO B;  1K73 C;  1M1K U;  1WJS A;  1QVG S;  2LRQ A;  2RHZ A;  3M9Q A;  5J26 A;  2Y4X A;  4E7L A;  2B8A A;  1KHI A;  3HHT B;  2QI2 A;  3M59 A;  2FYK A;  1MGQ A;  1Q81 C;  1G3T A;  2DTI A;  4C92 C;  4M7A C;  3OYC A;  3PTA A;  2JTF A;  1KQS A;  3HP9 A;  2P0K A;  2LQK A;  5GAM e;  1G3Y A;  1Y71 A;  2QQA A;  4X34 A;  3WVE B;  3A8L B;  2KAF A;  1UB4 A;  2XHC A;  2R58 A;  3MET A;  5GAN 6;  2EYQ A;  1M9S A;  3Q1J A;  4M78 B;  4C8Q A;  4C8Q G;  4IUT A;  4JJN K;  1YI2 T;  1YIT T;  1YIJ T;  1OYX A;  2LDM A;  3QPH A;  4M77 B;  3KBG A;  2X4Y A;  4J83 A;  3G71 A;  3SWN B;  1N6A A;  2HQX A;  3V8L A;  1Q86 C;  1K73 U;  4M7D B;  5LJ3 f;  3QHS A;  4A4F A;  5GAM d;  3E9G A;  3I56 A;  1Q81 U;  3QJ6 A;  4O6J A;  2GFU A;  4QVC A;  1YHQ A;  2K5I A;  2ZZD A;  4PL6 A;  2V8I A;  2LVM A;  2EJ9 A;  2LX9 A;  5DLQ E;  4C8Q F;  1KD1 C;  4DOW A;  3DB3 A;  4C92 G;  4C92 A;  4M7A A;  4M7A G;  4PJO B;  4R55 A;  2ZGW A;  4OVA A;  3M56 A;  3CPF A;  3C4S A;  2H3J A;  1XOV A;  2LCL A;  3R6O A;  3GP8 A;  1G3W A;  3URG A;  3ZBD A;  1Y07 A;  3CC4 A;  4KUD K;  2JZ2 A;  2DXB A;  2XIC A;  5GAO l;  1D3B A;  3JAM E;  1VQ8 A;  5KCH A;  1VQM T;  1I8F A;  2K4Y A;  4OP0 A;  3CME T;  3CCU A;  2FVU A;  2EQK A;  1Q86 U;  1VQ7 A;  4BAC A;  1YJN A;  5CR2 A;  1X75 C;  3HFN A;  4N4I A;  3OS2 A;  3FRN A;  4IUV A;  2VXE A;  5LL6 S;  2JOY A;  2KY9 A;  3OBW A;  3QYH B;  3S3N A;  1U1S A;  3BDU A;  4WF2 A;  4C92 F;  4M7A F;  2DD5 A;  3OYI A;  3EFR A;  3V7R A;  3CD6 A;  3CCM A;  1I5L A;  3UFE A;  1B34 B;  1VQ5 A;  4Y91 A;  1VQ6 T;  2EQJ A;  4BD3 A;  4F7U E;  1KD1 U;  2CS7 A;  1NJI C;  2RI2 A;  1BIB A;  4QQ6 A;  5GAM f;  4M78 E;  4JLI A;  4BE2 A;  5FRN A;  3M58 A;  2XID A;  5GAN e;  1VIE A;  3RIR A;  2K2V A;  4XU2 A;  3JB9 D;  1WPY A;  3OYG A;  4N0A C;  4DQ2 A;  2LC4 A;  2YLB A;  5AYF A;  5LJ3 g;  1YJW A;  4M7D E;  4XU0 A;  5CKE A;  2D6F A;  2DXC A;  1VQ9 T;  3P8B B;  3CCR A;  4M78 C;  3SDZ A;  1QW1 A;  3RMQ A;  2CB9 A;  3OYK A;  4C0D B;  1UGQ B;  1BI1 A;  2HBP A;  5HY6 A;  2RI3 A;  3SWN C;  2LCC A;  3BFM A;  4M7D C;  4A4E A;  2WSE E;  5GAO n;  5IAY A;  5LJ5 g;  2I2L A;  5GMK i;  4PJO E;  1U8R A;  3LWH A;  3G7Z A;  1ZQ1 A;  3E19 A;  1NJI U;  3J7A F;  3PMT A;  2OTJ A;  3X24 B;  1RL2 A;  5I21 A;  1H64 1;  4XTU A;  3WXM B;  3HKS A;  2KMT A;  4FSX A;  4RCB A;  5KH6 A;  2X35 A;  4N4G A;  3MO8 A;  2QDY B;  4L6V 5;  2E1H A;  2ZCF B;  3L2U A;  3CPW S;  3CCJ A;  3FLG A;  3JCM X;  4PJO C;  5HK3 A;  3PMI A;  1KQ1 A;  2RB6 A;  3LLR A;  4KBM B;  1KC8 C;  3OMC A;  4QQD A;  5GMK l;  5CK9 A;  1TH7 A;  3HRU A;  1WJQ A;  1UEB A;  4JRI A;  4F7U G;  4F7U A;  1JJ2 S;  1HK9 A;  2EJF A;  3DLM A;  4PKC C;  2K5L A;  4C5H A;  4PLL A;  4J6Y A;  4QW2 A;  3OW2 S;  5LJ3 h;  5GMK h;  1HXD A;  1VQ4 T;  3CCV T;  2DZ9 A;  2VXF A;  2XDP A;  2QQ9 A;  4MML A;  2RK2 A;  4XU3 A;  5GAN 8;  5LJ5 e;  5A0G A;  1YJ9 T;  3QBY A;  3JB9 I;  1KG1 A;  3QZ9 B;  1VQK T;  1P92 A;  1VIF A;  4BI8 B;  2EQU A;  1YI2 A;  3RUX A;  2DKG A;  2E10 A;  4MZM A;  3VYH B;  4C8Q D;  2M9U A;  4X9C A;  5GAN f;  3CCL T;  1Q7Y C;  2HD0 A;  4F7U F;  4GLK A;  5GAM j;  3GPL A;  3OMG A;  4M75 E;  1I4K 1;  1KC8 U;  2L5Q A;  4IUP A;  2MF2 A;  1W4S A;  3JRZ A;  5A0D A;  3HFO A;  4M78 F;  1JJ2 A;  5GAO m;  4HCB A;  5J3B A;  3S3M A;  2P4T A;  5LJ5 d;  2RHU A;  2DIG A;  3GOX A;  3OW2 A;  2RJD A;  2EQM A;  2QQB A;  3EAE A;  1Y96 A;  2RI5 A;  5GAN 5;  1VQN A;  3QDR B;  4M7D F;  2V8J A;  5KE3 A;  2RJE A;  1IRE B;  3GNF B;  4BDZ A;  1MHN A;  5DM7 R;  4M75 C;  5EG2 A;  4JDS A;  4DA4 A;  1VQP T;  4C5E A;  4C0D C;  2X4J A;  2IVW A;  5GAN 3;  2K9Q A;  4LDY A;  1IZ6 A;  2OAU A;  1YBY A;  5CVI A;  3M54 A;  3N5B B;  3OYJ A;  1W2B A;  1M1G A;  4C92 D;  1BKB A;  4M7A D;  2P0Q A;  4EDU A;  3OYB A;  3FC3 A;  2JN0 A;  4BE0 A;  3ER0 A;  3QXE B;  2OTL T;  5FRO A;  1BI2 A;  4BDY A;  2JVV A;  3QSU A;  4IUU A;  3OS0 A;  3X25 B;  1Q7Y U;  2EFI A;  2GFA A;  3CC2 T;  3OQ5 A;  1VQM A;  4J6X A;  5GAM h;  4PJO F;  3UPU A;  2NLU A;  4E47 A;  1VQO T;  3P8H A;  2CYZ B;  1R8O B;  2E6Z A;  4JLG A;  3TRE A;  4PNO A;  4C0F A;  3FDR A;  4QVD A;  3L2Q A;  2GF7 A;  3GWH A;  3H8Z A;  3TCJ A;  2VYT A;  3UWN A;  2PU9 B;  1XNI A;  1SSF A;  1U1T A;  4BUG A;  1VQ6 A;  1N9S A;  5C0M A;  4LD6 A;  3JCM g;  4EMK B;  2BKD N;  4XQ3 A;  4C5I A;  5LJ5 f;  5GAN g;  2E12 A;  3M4Y A;  4M75 G;  4M75 A;  2EJG A;  3ZEH A;  5CQY A;  3G4S A;  3OYY A;  3LWI A;  2L3R A;  3HRS A;  2A7Y A;  3LH0 A;  2RK1 A;  3HRT A;  3NTK A;  3TU4 K;  2M1H A;  3QG1 A;  1N8R C;  3CBM A;  5FU6 B;  4Q5W A;  2JTM A;  2RH2 A;  2O01 E;  4XTY A;  5L8R E;  4V2S A;  4O5V A;  4XU1 A;  3MP6 A;  1LJO A;  3QO3 A;  3VYG A;  2GQV A;  5CKD A;  2QTX A;  4ELZ C;  2DTH A;  3PT9 A;  2MMP A;  1UGS B;  3A8O B;  5GMK m;  1VUB A;  3O8V A;  1LNX A;  3J80 E;  2D0Q B;  4JRQ A;  2PVG B;  2X4X A;  4M75 F;  5D6W A;  3OYD A;  3I55 T;  5CO7 A;  4A54 A;  4KUL A;  2CZ1 B;  1S72 T;  2EIF A;  3MP1 A;  3OYN A;  3JCM e;  4NOY A;  4OB2 B;  1WNL A;  2HNI A;  4FIB A;  3OYF A;  3L2W A;  2FL7 A;  5CKF A;  1K9M C;  3M5A A;  1N27 A;  4M77 E;  3C12 A;  2MAM A;  4RCC A;  1NE8 A;  2O4X A;  4IUR A;  4KT0 E;  4NL2 A;  3OYA A;  1N8R U;  4HCC A;  5CKH A;  4IUQ A;  2DEQ A;  2LNV A;  3BDL A;  1VQL T;  5I2S A;  5J39 A;  3C95 A;  2KK4 A;  3QZ5 B;  3QJY A;  3BY7 A;  3LYI A;  4C8Q B;  5M9O A;  3RKW A;  3LGL A;  5GAN h;  4B9X A;  3I56 T;  4J8O A;  4LDV A;  4M77 C;  3L2R A;  1YHQ T;  3VUB A;  3JCM d;  2F5T X;  1VQ4 A;  3GIB A;  3CCV A;  5GAN d;  1WGS A;  5GMK j;  5LJ3 j;  2E70 A;  2VV5 A;  2BUD A;  2ZPF B;  2ZPI B;  4MZT A;  3P8D A;  4TVR A;  3EFS A;  2ZPE B;  4EMG A;  5A2Q E;  3CCE T;  2PVD B;  1YJ9 A;  1XTD A;  1G3S A;  2VGM A;  4JRP A;  1QVP A;  3CEY A;  5GAN 7;  5GAO p;  1K9M U;  5D6X A;  3DLL A;  3SFM A;  2DZC A;  4FT2 A;  3CCL A;  3RER A;  1M4Z A;  2CZ6 B;  4M7A B;  2M0O A;  2DTO A;  5LJ5 j;  2OUT A;  1Y7X A;  3ZFJ A;  2RQY A;  1O9S A;  3RMS A;  4A53 A;  3E9F A;  2QA4 T;  3FIF A;  4IKF A;  2YLC A;  4FM4 B;  3JSC A;  4N0A A;  4DOV A;  4XTW A;  1G5V A;  2DJZ A;  2RD1 A;  3GNG A;  1D3B B;  4HA8 A;  4Y28 E;  5GAN 4;  3X26 B;  4HT9 A;  4R56 A;  4E7I A;  5FU6 C;  3JB9 J;  1O75 A;  2DIQ A;  3OBY A;  1M5Q 1;  3OB9 A;  3JCM Q;  4M78 G;  1WJR A;  4M78 A;  2MWO A;  2QEX T;  1VQP A;  5GAO q;  2ZPG B;  4RKU E;  3A5Z B;  4FT4 A;  4M77 G;  4M77 A;  1K8A C;  2AHJ B;  3SWN A;  3LGF A;  4M7D A;  4M7D G;  2OTL A;  5A0L A;  2F5K A;  5KE2 A;  2DXT A;  3S6W A;  1W2B S;  3JCM f;  3MP8 A;  1BIA A;  1M8V A;  1NPP A;  3H6Z A;  2EKO A;  1YIT A;  5CQX A;  4OB0 B;  1UGP B;  3G6E T;  1YIJ A;  3CC2 A;  2K57 A;  1LOJ A;  5LJ5 h;  1QP2 A;  1VQO A;  3VJP A;  5IT9 E;  3MEU A;  3M4G A;  4YTL A;  3S3O A;  2KDS A;  4C0Z A;  3OYH A;  3FB9 A;  3PGG A;  1RI0 A;  2QQR A;  2XDB A;  4BY6 B;  4BB7 A;  5I2M A;  3UDC A;  1DJ7 B;  4PJO G;  2K5F A;  4M77 F;  4PJO A;  3OY9 A;  2R5A A;  3JCM J;  4CRI A;  3E1S A;  2CZ7 B;  3CCS T;  4XTZ A;  4BI3 A;  4C8Q C;  4L59 A;  5DY9 A;  2DXU A;  5KCO A;  3JB9 H;  3VU3 C;  3V7S A;  1I81 A;  4OB3 B;  1K8A U;  3OA6 A;  4II1 A;  4CI0 C;  2DD4 A;  3CC7 T;  2R57 A;  3L42 A;  4E7H A;  1M90 C;  3CBO A;  3ASK A;  4ZN1 A;  4J5Y A;  2EAY A;  4M75 D;  3BW1 A;  2E41 A;  3JCM V;  4JS4 A;  3MEW A;  5D6Y A;  2E64 A;  2CZ0 B;  3F70 A;  2WAC A;  3HPW A;  2DPP B;  3L1A A;  3M57 A;  3QUI A;  3VKI A;  1KQ2 A;  5IN1 A;  3CME A;  3JCM W;  1ZBX A;  1B34 A;  1PSE A;  5GAN 2;  3INZ A;  1OZ3 A;  4LD9 K;  4A4H A;  4EMH A;  3TEE A;  2YRV A;  3M55 A;  2DO3 A;  4C0G A;  2QXF A;  3OSV A;  3QII A;  4XK8 E;  4ZGJ B;  1N9R A;  3MCA B;  4OF1 A;  3I55 A;  1GXI E;  4F7U B;  3MHX A;  1PSF A;  3J81 E;  1BI0 A;  3OYM A;  1S72 A;  3CBP A;  3V8K A;  4EPC A;  2ZPB B;  2QQS A;  2L8D A;  4HCZ A;  3CCQ T;  1M90 U;  2ZPH B;  3A8M B;  4MZP A;  3V8J A;  4ZGE B;  1X6O A;  1QVG A;  4KUI A;  2RA2 A;  3CMA T;  2E6N A;  1VQ9 A;  1JBM A;  3C94 A;  3X20 B;  1VQL A;  4N4H A;  4BE1 A;  3VUZ A;  1OI1 A;  2K3Y A;  4PLI A;  2KVQ G;  2A3L A;  4ZTF A;  3NTH A;  2FHD A;  5GAN j;  2HAX A;  4FL6 A;  2XD0 A;  3T9N A;  1VQN T;  3PIO A;  3FJP A;  3JCM b;  2IG0 A;  1V29 B;  2KQW A;  3GLX A;  2Y90 A;  2LQ8 A;  3VV0 A;  1UGR B;  2CGH A;  3M53 A;  3UT1 A;  4BY6 C;  3CCE A;  5FU7 B;  1NZ9 A;  4E7J A;  1NPR A;  1Y96 B;  1WQ7 A;  3GF5 A;  1FWZ A;  5CIU A;  4D6W A;  4X9D A;  4NL3 A;  2RM4 A;  2WSC E;  4ZN3 A;  4GY5 A;  5C6S A;  2GCX A;  4ELY C;  1JB0 E;  4UC4 A;  2F69 A;  3JCM c;  5CCA A;  3G71 T;  2DK3 A;  3RKX A;  4A4K A;  2QA4 A;  4OGE A;  4XAX B;  3JCM h;  1BYM A;  2PUK B;  1BI3 A;  3RES A;  2LT4 A;  3SD4 A;  2CKK A;  4FU6 A;  4JS5 A;  3FEO A;  4Z02 A;  3MEA A;  4RG8 A;  4OB1 B;  3WVD B;  2QEX A;  3NFC A;  2PQW A;  3KXT A;  1QVF S;  4HKE A;  3KUF A;  4M78 D;  2VGN A;  2DAQ A;  2MWP A;  3MEV A;  2V8K A;  2G3R A;  1FX7 A;  3OYE A;  3OYL A;  2CBG A;  4M77 D;  4LDW A;  3A8H B;  3OS1 A;  1VQK A;  4ME7 A;  2FB7 A;  4BI4 A;  2VC8 A;  4ZGD B;  1JRI A;  3L2V A;  4RMO A;  2LT1 A;  3G4S T;  1XQH A;  3CC4 T;  4M7D D;  3DB4 A;  2VUB A;  3G6E A;  1VQ8 T;  2PVO B;  4MDX A;  3OSS C;  4LDU A;  4EMK C;  4E7K A;  3CCU T;  4C92 B;  2L89 A;  3SB2 A;  1VQ7 T;  4M75 B;  3PIP A;  3CXC S;  2R5M A;  1YJN T;  2RO0 A;  5GAO r;  4OGC A;  4MDW A;  2XKO C;  2YHT A;  4A4G A;  2RJC A;  4RG2 A;  4ATO A;  1H3Z A;  3CCS A;  1QVF A;  4PJO D;  1KHC A;  3CD6 T;  2RHX A;  3CCM T;  2RHI A;  3A8G B;  2BIV A;  1VQ5 T;  4C5G A;  4J6W A;  1WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...