3PMIA

Pwwp domain of human mutated melanoma-associated antigen 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
SFEVGMLVWHKHKKYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQAREDFNQDIGWCVSLITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords PWWP domain-containing protein MUM1
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.890.60 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3pmiA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pmiA01
2RHXA 2EKOA 3OS2A 4C5GA 3EAEA 4IUVA 4C5IA 3OMGA 2O4XB 3S6WA 3OS0A 3QJ6A 3LGFA 4IKFA 2O4XA 3OQ5A 3OY9A 3OYJA 3OYKA 4CRIA 2NLUA 2EFIA 3L2UA 2RHIA 1WGSA 3E9FA 2XK0A 3OYMA 3OA6A 4BDYA 2EQMA 4LD6A 3ME9A 2BKDN 2M1HA 5J39A 5FRNA 2HQXA 3H8ZA 4BD3A 1KHCA 2VYTA 5D6YA 4BDZA 2MWPA 2RI2A 2G3RA 3OMCA 2JZ2A 2DIGA 2LCCA 4PL6A 4QQ6A 4X34A 4QQDA 4A4EA 3GOXA 4BE1A 3UT1A 3S3NA 2WACA 2L8DA 4BACA 4PLIA 4IUUA 2RHZA 5CIUA 2EQKA 1XNIA 4EDUA 5FRMA 4GY5A 3PFSA 4HCZA 2K3YA 3OYHA 2L89A 5D6XA 3MEUA 3PMIA 2RJEA 2X4XA 3NTIA 1OYXA 2EQUA 3MP1A 3P8HA 5KE3A 3PMTA 1RI0A 3KUFA 4E7KA 2X35A 3L2WA 4OVAA 2RJDA 5IN1A 3Q1JA 4B9WA 1MHNA 3META 2RHUA 2RI5A 3H6ZA 3OYCA 3DLMA 4BE0A 2YRVA 3C4SA 3ASKA 3DB3A 3LGLA 4N4IA 2D9TA 4FU6A 1WJSA 4IUQA 2R5MA 3P8DA 2IG0A 3LYIA 3OYBA 3S3MA 3OYDA 3L2RA 2GFUA 2BIVA 2L3RA 2R57A 4NS5A 3OS1A 1OZ3A 5J26A 3LLRA 4QW2A 2DAQA 3NTKA 4IUTA 2LTOA 2JTFA 2LRQA 2RHYA 2XDPA 3MP6A 2E6NA 5M9OA 4IURA 4II1A 5KCHA 3MEAA 4E7HA 4PLLA 3CEYA 3NTHA 2F5KA 2K3XA 3F70A 2DIQA 2HQEA 2QQRA 4QQGA 3FLGA 1OI1A 3QKJA 3FDRA 4A4GA 3BDLA 3MO8A 4B9XA 1OZ2A 3L2QA 3FC3A 2CKKA 3OYGA 4E7IA 4FL6A 5D6WA 4IUPA 1WJQA 2R58A 3ZEHA 2BUDA 3MEVA 5C6SA 2B8AA 2RJCA 3M9QA 4Q5WA 3DB4A 3FEOA 3MEWA 2LVMA 3E9GA 3O8VA 4UC4A 3SD4A 5KCOA 4E7JA 4E7LA 2R5AA 1H3ZA 1SSFA 4QVZA 3OYEA 2RJFA 1N27A 2X4YA 3UWNA 3MP8A 2FHDA 4RG2A 3QIIA 2GFAA 3QBYA 1G5VA 3OB9A 2P0KA 4Z02A 5KH6A 4A4FA 5FROA 4L59A 3S3OA 2GF7A 2M0OA 3LH0A 3LX7A 3OYIA 4C5HA 3OYFA 4BE2A 2RI3A 3OYLA 4C5EA 2EQJA 5C0MA 4ZTFA 1WJRA 2M16A 2X4WA 3L2VA 2QQSA 2PQWA 5KE2A 2E5QA 3OYAA 4ZTJA 4A4HA 4N4GA 2MWOA 5IAYA 2RO0A 4N4HA 2LDMA 3PNWC 3L42A 3OYNA
chains in the Genus database with same CATH superfamily
1X2QA 1RABB 4C5GA 1OOTA 3OMGA 4KUDK 1E6GA 1TUGB 1MNDA 1Y7XA 4AG1C 1KQSS 1I81A 2D0QB 2BKDN 4OB2B 8AT1B 3G4ST 2DEUA 3E2UA 2LJ1A 2LT1A 4FYXB 1WLPB 2KAFA 3V7RA 2L8DA 1RAEB 2HAXA 2V8JA 2L89A 3HKSA 2E41A 3FB9A 3CMEA 1ARKA 5LJ5j 2DL5A 4M78F 2HKNA 2KBTA 3JAME 4F16A 5A0GA 2KXCA 1M3CA 3EH2A 4X1VA 4M7AD 4OGCA 1XOVA 1WFWA 3SWNA 3OS1A 4J9FA 4PJOC 2EBPA 1X69A 3CCSQ 3CD6A 2DE0X 3GLXA 4JRPA 1D1AA 3NFCA 4BB7A 2CP7A 2JT4A 4QVCA 7AT1B 3NPFA 1ZA1B 3MO8A 1OZ2A 1D1BA 4M77A 4M78D 4IIMA 2AZVA 3TSZA 3CCST 2Z0WA 3VJPA 3ZBDA 3CC2A 2RNAA 3GWHA 2L2PA 4ME7A 2V8KA 1WX6A 1YHQA 2K2VA 1NPPA 1FX7A 2E70A 1QKXA 2CZ7B 1H8KA 2HKQB 1KSWA 2AKLA 1Q86U 4KGXB 3I55Q 1NPRA 1I5OB 2QQ9A 2CT4A 4XTZA 2EQIA 3OYNA 5LJ3h 2O4XB 2DERA 3RUXA 1M3BA 1WHMA 3G6EA 1VQ9A 1D1CA 2OX7A 3E9FA 4PJOF 4BY6B 2CQSA 1ZHIA 1BCMA 3N5BB 4E7SA 5L8RE 2DJZA 4QQ6A 4PL6A 4BE1A 3RBBB 2RQRA 1YCSB 2H3JA 3VYGA 3QJYA 1KG1A 3S4BA 4XTYA 3CMAT 1D0YA 2YXYA 4GLMA 2D8HA 3A8GB 5HCKA 2HSPA 4PJOD 2JTMA 1JXMA 4E7KA 2O9SA 4M77G 2RJDA 1KD1C 3META 3A1PA 3EGUA 2FZCB 2K2MA 3OYCA 1I4K1 3DLMA 5J3BA 4J7FA 1ZUYA 2M9UA 2LQNA 5GAMj 1JQQA 1G83A 1ZSZA 5IXBA 4AMCA 3CCMA 3JCMQ 4P5NA 1TXQA 3EGDA 2QEXQ 3JB9F 2E6NA 3ACSA 3QDEA 2HEQA 3PIOA 4V2SA 1OEBA 1XTDA 1OI1A 3RKYA 2HMAA 2CSQA 3RKXA 2JJ9A 2I15A 1XQHA 2QEXT 2AKKA 1M1GA 8ATCB 2DPPB 3FJ5A 2GQVA 4EIKA 2X4YA 4XTVA 4HXJA 2MYSA 2GFAA 2DFUA 5LJ3d 5KH6A 1JB0E 2DZ9A 3S3OA 3SDZA 3JB9D 1KHIA 2AT1B 4C5HA 5IXFA 3MCAB 3QO3A 2J7IA 2LQ8A 2E12A 2YDLA 4K11A 4ZTFA 1FMKA 3L2VA 2IPOB 1K9AA 2A28A 1W2BS 4LE9A 3S6WA 6AT1B 1IHVA 2D0NA 3CC4A 2RD1A 1ZUUA 4DEYA 2KR3A 2V1QA 4BI8B 2EFIA 3PT9A 3OYMA 2OTLA 2DTHA 2LT4A 3CCLQ 1E7OA 1FYNA 4AFSC 3QZ5B 1R8OB 1UJYA 4KUIA 1D09B 5GMKe 4F7UA 5D6YA 2PVDB 1VQMQ 1M90C 1ZSGA 3PE0A 3CCLT 2VVKA 5CIUA 2EQKA 1AWWA 4OF1A 4XAXB 2DMOA 3M0RA 2OJ2A 1VQMT 5KE3A 1YBYA 1PKSA 2F2WA 1RI0A 1EFNA 4GBQA 2YRVA 3C4SA 2CYZB 4WCIA 1Q82C 2VASA 3JRZA 1WYXA 5CKHA 3LYIA 3V8KA 1X6BA 3CCUQ 3INZA 1NJIU 3M0QA 3LWHA 2GGRA 2FRWA 3VV0A 2E3IA 3JSCA 1QP3A 3ACTA 3NMZC 3F70A 1VQ6A 1S1NA 2HQEA 2QQRA 4Z88A 4MZTA 3CCUT 1NEGA 2VUBA 2MI6A 3FC3A 4O5VA 4E7IA 1ZBJA 1G3TA 4MDXA 1UGQB 2RJCA 4Q5WA 3CXCP 1VUBA 3I5SA 4HKEA 1AZGB 1Y71A 1JJ2S 3QBYA 1PSEA 1ABQA 2EJ9A 2GF7A 2COYA 2AK5A 2VXEA 3C12A 3VS1A 3OYIA 5KYXA 4OP0A 4F7UG 1G2BA 3RKWA 3IQLA 1W1FA 2A08A 3QFZA 2KT8A 5KYWA 2ECZA 4N4GA 5GAN4 3G4SA 1N9RA 1RAGB 1TG0A 4EMKC 3CPWP 1I0CA 2EYQA 2JUFA 2V1RA 3UFEA 3OQ5A 3X25B 3HP9A 1LOJA 2M1HA 2JVVA 2RQWA 4J9IA 5DY9A 2JZ2A 5D7UA 1VIFA 4FSSA 3M0SA 2CDTA 2HL5C 4DBHA 4BACA 2CT3A 4C0DC 3DLLA 4ZGDB 4ANJA 2K6DA 5FRMA 2K3YA 5LJ3g 3V8JA 3PVLA 3CPWS 4M7AA 1Q86R 2J6OA 3NTIA 3G71Q 4XU2A 5DM7R 1NJIC 3H9NA 4JRIA 1I5LA 1UGSB 2QDYB 3HHTB 1NG2A 1SF9A 2LX7A 3ASKA 4RTXA 2EYZA 2K3BA 4R56A 1VQPQ 1IGQA 1WJSA 3OBWA 1BI2A 4OMMA 3G71T 1IHWA 2H3EB 2J06A 2V26A 1OULA 2GFUA 4RTTA 1I1JA 1JU5C 1OZ3A 2EVRA 2EYXA 2FZGB 1N8RU 3CCSA 1WHJA 5GANh 2LC4A 1VQPT 4AFUC 3VS3A 2PVGB 1PHTA 3FDRA 4A4GA 1L6EA 3EFRA 2RA2A 1M1KU 1WZOA 3RIRA 4JS5A 2RJFA 4DBQA 1JEGA 4L5GA 4RG2A 2HL3A 3A8OB 4RTZA 2XU8A 1MV0B 2M02A 3JB9H 1M9SA 3I55A 1WDXA 3C95A 2KROA 4C92C 2QI2A 1NLOC 2X4WA 2CQTA 4JRQA 3OYAA 3JCMb 2L3QA 4N4HA 1M2VA 2FL7A 1R0BG 4CC7A 2RK1A 1WHGA 2OAUA 3BFMA 5AT1B 4LXCA 4M7AG 3QPHA 1QLYA 3OY9A 3G7ZA 4FT4A 1R0CB 2ED0A 3EG9A 4JJCA 2F1LA 2RH2A 4JZ3A 4KGZB 1YJ9Q 2E64A 2YUPA 5IHIA 2JS2A 2RI2A 3OMCA 1WQ7A 4BY6C 2DIGA 2W10A 2CBGA 1NZ9A 3FJPA 3UT1A 4M78G 1IXDA 2DZCA 4ZGEB 2DL3A 1Y57A 1MV3A 3RMSA 2B86A 1M8VA 2LMJA 4JUVA 4C92E 3C94A 5GANd 1MHNA 2RI5A 1VQOQ 1VQLQ 4KRTA 4C92F 2CH4A 4XU3A 3VRYA 2JMAA 4RCCA 5CKBA 3CCJQ 3JB9J 1C1AA 3SWNB 2O9VA 4KH0B 4NS5A 2QEXA 3IM3A 4L6V5 1U5SA 1JXOA 1VQOT 4IURA 1VQLT 2YRCA 3WVEB 1UG1A 2QXFA 1NBEB 1BKBA 3CCJT 3QKJA 2FEIA 1M27C 5EG2A 4C92D 2CZ0B 4FSXA 2RMOA 5GMKi 5IT9E 2MPXC 2XKOC 2JTEA 3EFOA 1AWXA 2ED1A 1U1TA 2K7AA 1G5VA 2HBWA 4ZN3A 3LH0A 4RKUE 2DRKA 2X51A 4FIBA 1MUZA 2EQJA 2DXCA 2GTJA 4PJOG 2VC8A 2I0NA 5KE2A 4ZTJA 2F69A 1QW1A 1PCXA 2BZXA 4OMOA 2CH4W 3SFMA 1BBZA 3JCMW 1TUDA 2BZYA 4KULA 3CCLA 1KIKA 3LH5A 3UDCA 4DBFA 2FRYA 3EFSA 1VQMA 5CKDA 1PNJA 4OMLA 1M2OA 3J81E 4J9BA 3JCMe 3A98A 1WIEA 4MZMA 4J9CA 2XDBA 3E19A 3GIBA 3HRTA 2X35A 3L2WA 1W4SA 4QKUA 2RHUA 1YFNA 2CZ6B 4C0DB 4YTLA 5GAN3 4N4IA 4C8QA 1ZSZB 2YUNA 1FWZA 3CCUA 5HK3A 3OYDA 3QDFA 1QVPA 3M0UA 4C0ZA 2AIRB 5J26A 1D3BB 3JCMX 2RK2A 1YWOA 3V7SA 4QW2A 4Y28E 1AT1B 2LTOA 2XDPA 4RTAA 4J9GA 4HT9A 5KCHA 3H0FA 5CQXA 2DIQA 1U1SA 4XTUA 4BUGA 1UEBA 1TSFA 4B9XA 1GXIE 5LJ3e 1KK7A 1YIJQ 5GAN6 1QVFA 3RMQA 4NL3A 4RT4A 3BY7A 1X2KA 2A37A 4M75C 2EJFA 1KD1U 4RIQA 2JM8A 3JCMh 3OB9A 1YIJT 2KI7A 1KQ2A 1YI2Q 4RTWA 1VQNQ 3TU4K 2COZA 5GANg 2DVJA 2ZPEB 3EGXB 2E5QA 4Z89A 1YP5A 1UUEA 3OW2A 2D6FA 4CC4B 1YI2T 1N8RR 1VQNT 2BZ8A 1EIFA 3OYJA 1WHHA 2JMCA 3GBQA 3M4YA 2A0FB 1KJWA 5HY6A 4C92B 1YJWT 2KK4A 1MMGA 3L2ZA 2CP5A 5CO7A 1K73U 3QSUA 2KYGA 1WQWA 5FU7B 4C8QG 1M1KR 1VQ4T 5I22A 4QQDA 1KQ1A 2WACA 3T9NA 2EGCA 4M75E 1K8AC 2HSEB 3PFSA 1C6VX 1UECA 4M75F 1WHLA 3G71A 1Y96B 2X4XA 4LN2A 1PKTA 3KUFA 2A3LA 1HJDA 4OVAA 4AT1B 3CMAQ 1Y0MA 3HFOA 2BE7D 1B34B 2RQUA 1PSFA 2AZSA 2XDDA 1VQPA 2EZWA 5DLQE 3M59A 2NUPA 1U8RA 5AYFA 1Y07A 3QFYA 2O2OA 3S3MA 3L2RA 4E2FB 4LDXA 2R57A 4J8OA 4OMPA 3GPLA 1V29B 2CGHA 3R6OA 1X6GA 3RESA 1MMNA 2JTFA 1JO8A 2LRQA 1B3QA 3M58A 3VRZA 4M75D 1M90U 2FPDA 3H0HA 1KQSA 2WSEE 1OX9A 4OB3B 2X9HA 3JCMd 3FLGA 2KDSA 4EMKA 3GNFB 2CKKA 1VQ7Q 4A53A 4LUEA 3UPUA 2NUZA 3E9GA 3SD4A 5HKCA 2E65A 4LDWA 4D6WA 4JJBA 4DBRA 5LJ3f 1RUWA 5FW9A 4PK4A 5LJ5h 2DRNA 2F2VA 1GCPA 1WXUA 1VQ7T 3CBMA 1YITQ 3L1AA 5CVIA 5GAOp 1Q82U 1GL5A 2K5LA 4N0AC 2M16A 5KYWB 2DL7A 1VQ8T 1G3SA 4R55A 2RO0A 4HVUA 1BU1A 1K73C 4XK8E 1YITT 4C5IA 1RLPC 3QWYA 2L5QA 2CB9A 1KC8C 2NLUA 1GCQA 2RHIA 5GMKj 1BI1A 1YJ9A 3EG1A 3VKIA 2VV5A 2VYTA 4RTVA 1B7TA 5A0DA 1LPLA 4X34A 3MPUB 1YJNQ 4ELZC 2XICA 4PFOA 2P0QA 4PLIA 2CP3A 1UHFA 4EDUA 5GAMe 2CREA 1SSHA 2JW4A 4M7DA 5I11A 2FYKA 2YUOA 1YJNT 2GNCA 2DYBA 2HNIA 1ZQ1A 4DEXA 5KYYB 1VQOA 1VQLA 4HVWA 4DA4A 2DVEA 1VQ5Q 3CCJA 4RG8A 1P92A 4J6YA 2A7YA 3VUBA 2NWMA 4ORZA 4DOVA 1G8XA 3TVTA 3I35A 1VYVA 3SEMA 3MP6A 1K76A 1VQ5T 3SWNC 3CEYA 5LJ5d 2XMFA 1Q81C 2VGNA 4KT0E 2DTIA 1UB4A 3TREA 4MDWA 2R58A 5C6SA 4X9CA 2DBMA 1H3ZA 2M51A 4M77C 4E7LA 1ZBXA 2E1HA 1LVKA 1NE8A 1RAIB 4AG2C 3ZL7C 1RLQC 2XG8D 3VYHB 3E1SA 1M8MA 1AWOA 1HD3A 2K4YA 5GAMh 4O6JA 2QA4T 2OUTA 2MIOA 3EH1A 4M75B 4A4HA 1K9MC 3V7CA 2QTXA 1OU8A 4M7DG 1Q7YC 3QJ6A 5I2MA 1HSQA 1QCNA 4AFZC 1W70A 3EG9B 1E6HA 1N6AA 1UFFA 1WGSA 4JRKA 1GBQA 2KRSA 2RM4A 4E7ZA 4J9HA 2EQMA 3JCMg 5ECAA 3H8ZA 1CKAA 1MGQA 5FU6B 3SB2A 4JPBW 3GOXA 1RAHB 1W6XA 4M77E 5GANe 1KD1R 2CP2A 4M77F 2GCXA 2IZYA 4F17A 2QQBA 1TUCA 3CXCS 3P8BB 2DBKA 2NUTA 3VS7A 2XIDA 1QVGP 5HK0A 4RUGA 3U23A 4JDSA 4E6RA 4BE0A 2C06A 3LGLA 2D9TA 4FU6A 1AZEA 3CD6T 1W2BA 3OYBA 2H8HA 2EPDA 3G1JA 2L3RA 2OTJQ 2L3PA 2DK3A 4TVRA 1ZSZC 4VUBA 4M77D 1K73R 2XD0A 3QHSA 4NL2A 3X28B 4JS4A 4J9DA 2L0AA 1S72Q 5IHNA 1IREB 1G3WA 3CC2T 1YIJA 2EWNA 3TQ7P 1BK2A 3H0IA 2OTJT 1H641 1QVGS 3ZEHA 5GAMd 1QP2A 5GJWB 4HCCA 4HT8A 2P4RA 1HXDA 2LVMA 3O8VA 2DX1A 1NLPC 2R5AA 3UWNA 1S72T 3VS4A 3QXEB 4ZN1A 4M78A 2WSFE 3I56Q 1ACMB 3OSSC 1YI2A 5FROA 1VQNA 1PD0A 2ESWA 2M0OA 3LX7A 4WF2A 3OYFA 2GQIA 4BE2A 1K0SA 3UATA 2RI3A 3OYLA 2LNHB 5C0MA 1VIEA 4XQ3A 2A36A 5GAN5 1WHKA 3I56T 1NYFA 3G6ET 2KEAA 3QYGB 2EKOA 3RERA 3OS0A 1M90R 2BTTA 2FZKB 1BIBA 2E6ZA 5LJ5g 2YLBA 3FRNA 1IGUA 2ZPBB 2E4HA 2ZPHB 3LWIA 3IM4A 2EYYA 4A4EA 2FG0A 2COWA 3KFVA 5FU7C 3BDUA 4ZP3A 2MMPA 1Q82R 1JJ2A 3PMIA 3S4CA 1AOJA 3AHUA 2VWFA 5GANf 4A4KA 2QAZA 1LNXA 3NHNA 1V76A 5CKFA 2L3SA 4ESRA 4J6WA 3CMAA 1YCYA 2PNIA 3CCMT 2ZPGB 2KNBB 2LCSA 2VXFA 2R5MA 4PJOA 1Z9ZA 1RADB 1EZZB 2SEMA 1FMWA 3H41A 3NTKA 3A8MB 2K3XA 2DTOA 2IIMA 1JBMA 3CBOA 1VQ7A 2DL8A 3WXMB 2PTKA 3MHXA 2FB7A 3KBGA 3AFJA 4F7UE 3VU3C 4LNPA 4QVZA 3EHRA 4F7UF 2KRNA 2ZAEA 3CCVT 3MJXA 4B6MA 1YITA 3CPWA 1ZX6A 2MK5A 1XJWB 4JLGA 4FCYA 1M4ZA 1WA7A 2LP5A 2EAYA 2YLCA 3M0PA 4M77B 4HCKA 3PIPA 5IAYA 1R2AA 2VGMA 1U06A 1RACB 2DL4A 3URGA 4J83A 4IUVA 3LGFA 2RQYA 1BIAA 2XK0A 2YWWA 1YN8A 2KMTA 3EHQA 2HCKA 2KQWA 2RB6A 3UF4A 3RDVA 2FPEA 2Y90A 3REAB 2H9RA 1UTIA 1YJNA 5GAMg 5GAOl 1NJIR 1SG5A 1WI7A 3R6NA 1BYMA 2RJEA 2ENMA 4C0GA 3QWXX 4BI3A 5GAN7 2QGFB 5IN1A 2F5TX 2DXUA 1VQ5A 1F1BB 3DB3A 3ER0A 3RSYA 2J6FA 4NOYA 1AD5A 1QWEA 1X75C 2DILA 5I2SA 3RNJA 4CC3A 3CCQQ 2RQVA 2DETA 1UE9A 1Q95G 4E7HA 5LJ3j 2ZZDA 5KYUA 4OMFB 3V8LA 1ZA2B 1LJOA 1RL2A 1YWPA 2QK0A 3JB9G 3L2QA 3HSBA 1K8AU 5D6WA 3CCQT 3X24B 4RTYA 2LJ0A 4C0FA 3VUZA 2JN0A 2LJ3A 1GFCA 1UHCA 5KCOA 1AEYA 2C0OA 3EGDB 2DKGA 1DJ7B 2LX9A 2JM9A 2J6KA 4Z02A 1QCOA 4F9KA 2QQAA 2F2XA 4JLIA 1C0MA 4M7AE 1UGPB 1K4US 5GAN8 5GAOn 1GFDA 4M7AF 3WVDB 2LNVA 5GAOm 1PRLC 2K79A 2KT1A 4CC2A 4MZPA 3TSWA 3J80E 4IKFA 1M3AA 1IB8A 4CRIA 3L2UA 4M78E 3X26B 2V8IA 2P4TA 2JXBA 2KYBA 3CQTA 1GBRA 1MNEA 4BD3A 2JS0A 1BI0A 4A63B 1YJWQ 4KH1B 2XI9A 5GAN2 1AVZC 1VQKQ 2EGEA 5FU6C 1AWJA 3PTAA 3JB9I 1VQ4Q 1TWBA 3BE3A 4M7DB 1SEMA 4PFZA 5FWBA 3QG0A 2X3XD 4QT7A 1OQKA 1O9SA 2D1XA 1QCFA 3CBPA 4M4ZA 1BB9A 2RQTA 1T0HA 2ROTA 5FLXE 1VQKT 4AFQC 4RTUA 4F7UB 3H6ZA 3TCJA 1SHFA 1WPYA 1KC8U 5LJ5e 1BI3A 4J6XA 1VA7A 2FO0A 3VS6A 1O75A 4KGVB 2OTJA 2X4JA 3S4DA 2O01E 4R0KA 3BW1A 1SKUB 3JCMf 3RRSA 1S72A 3M54A 2F5KA 1D0ZA 4QQGA 2EYWA 1PWTA 1MMAA 4XU1A 2K5FA 3FIFA 2BE9B 4BI4A 3OBYA 1I07A 3VS2A 2CP0A 3AT1B 4LDYA 4PJOE 3QG1A 1IZ6A 3OYEA 4PKCC 3I56A 3I55T 2FHDA 3QIIA 5GAOq 3EG0A 2P0KA 1SRMA 5CAIA 2LQWA 5IH2A 1SHGA 1WJRA 4PJMA 2MWOA 2QDLA 4RMOA 4MMKA 2LDMA 4PJJA 4QVDA 4A4FA 1CSKA 3G36A 5GMKl 1Q81U 2FVUA 4X9DA 3A5ZB 1VQ8Q 3OYKA 1FXXA 3JCMc 4EMHA 5CKEA 3CC7Q 5IHKA 5KYXB 2CUBA 2G6FX 1UGVA 1PRMC 3HTRA 3M0TA 1I8FA 5HVZA 1OX8A 2MWPA 2DRMA 2LCCA 2YUQA 2PU9B 5FWCA 3CC7T 5CCAA 2RHZA 3ULRB 2HZYA 1D3BA 2QGGA 2E3HA 3MEUA 4FW1A 2EQUA 2NUTB 4XU0A 3PMTA 3GP8A 1K9MU 1W2BP 3CCEQ 2RF0A 3UA6A 1M1FA 1Q7YU 1Q86C 3I9QA 2PVOB 1LCKA 2JOYA 2M0YA 3CPFA 3GF5A 1WXBA 2DD4A 3D7SB 2K5IA 4C8QC 1Z9QA 3CCET 2DAQA 1PC0A 4FYWB 4M7AB 2HBPA 4PJLA 3JCMV 5LJ5f 1N5ZA 4PLLA 3CCVA 2K9QA 3CCRQ 3RR6A 3OYGA 2DJQA 4FL6A 3HFNA 3EGXA 2DXBA 4OGEA 3M9QA 3PGGA 1H3HA 1QWFA 3OYYA 4M78B 5GMKm 2DO3A 3CCRT 1OPLA 4HVVA 4C92A 1RAAB 9ATCB 4MMLA 2CSIA 4JJNK 2GBQA 3NGPA 4FM4B 2KVQG 3A8HB 1WNLA 1NYGA 1IRXA 3EAEA 2QA4Q 4C8QE 1K1ZA 2O4XA 4FYVB 1TU0B 1IO6A 2YT6A 2KGTA 2D8JA 4C8QF 2HD0A 3OA6A 4BDYA 1Y96A 2HQHA 3ME9A 2E5KA 4XTWA 1KFZA 1PM3A 5J39A 2ZPIB 5EC7A 1K8AR 2HQXA 2CUDA 1J3TA 2LQKA 2YSQA 1KHCA 1M5Q1 2K57A 5GANj 1B34A 1AHJB 1JJ2P 1M2VB 2P84A 2FPFA 3THKA 1XNIA 2ABLA 3OYHA 1VYTA 2ZCFB 4C8QD 3EG3A 1B07A 2CZ1B 3CMEQ 2DD5A 2KXDA 4JJDA 2RN8A 1UDLA 2E10A 3OSVA 3QZ9B 4KBMB 4PJOB 5CR2A 2ZGWA 2RPNA 4IUQA 3P8DA 5GMKh 4ATOA 3CCQA 2BIVA 3CMET 4C92G 3EG2A 4IUTA 1SRLA 4EMGA 2RHYA 4ZNXA 2P0PA 2O31A 3TEEA 3CD6Q 4J7IA 3HL8A 3JCMP 5GAMf 1EX4A 5GJVB 5LL6S 1WJQA 2LZ6B 4FYYB 2QTVA 5L23A 2B8AA 1PD1A 3FEOA 1HK9A 3CC2Q 1RAFB 1N27A 1OPKA 3C0CA 3MP8A 2NYSA 2EIFA 4XTXA 2YRDA 1YHQQ 3M56A 4F04B 1VYUA 3HPWA 2DXTA 5KYNA 4Y92A 3O5ZA 3M55A 2DA9A 1KC8R 2DF6A 3DKMA 2HDAA 1QMCA 1UGRB 2IVWA 1YHQT 2WSCE 3EFOB 3A8LB 2DNUA 2QYZA 3M53A 3G6EQ 1VQ9Q 5CQYA 4LD6A 2W0ZA 1GCQC 4DOWA 2MAMA 5KYYA 1PG5B 1YJWA 1GRIA 2G3RA 1FMVA 2QASA 3OS5A 3REBB 3VS0A 4EPCA 1VQKA 3ZFJA 3S3NA 1VQ9T 2C0TA 1VQ4A 4FW2A 4LDUA 4GY5A 1TS9A 2MOXA 5D6XA 3P8HA 1OYXA 3MP1A 4HCBA 3M5AA 4PNOA 3J7AF 4M7DC 1OV3A 3Q1JA 4B9WA 3M4GA 3PVQA 4OMQA 5I21A 2KRMA 5CK9A 1R77A 5A0LA 3KXTA 3JV3A 2VKNA 1Q81R 1VOMA 2IG0A 3I5RA 1T3LA 3CCMQ 1TH7A 2J05A 2MCNA 2OAWA 5KYUB 4II1A 3MEAA 3QDRB 1X01A 4DQ2A 2ATCB 1NEBA 2I2LA 4PFPA 4Y91A 1CKBA 5DLOA 3GNGA 2PUKB 1N9SA 4C8QB 4M75A 3MEVA 4JZ4A 1X27A 4OMNA 3MEWA 2QG9B 4E7JA 4GLKA 1QKWA 3SHWA 1K9MR 2KNGA 3UA7A 1RI9A 3CXCA 1QVFP 1X43A 3MKDA 4M7DE 1Q7YR 3CCVQ 4C5EA 2KY9A 4M7DF 2SRCA 2JNGA 2PQWA 1V1CA 4CI0C 1UJ0A 4ZGJB 4LD9K 4OB0B 3X20B 2CP6A 2RHXA 3OS2A 3JCMJ 1VQ8A 1YJ9T 2KE9A 3CC4Q 3CC7A 1MMDA 1G3YA 4ELYC 4HA8A 2CS7A 1M30A 1T0JA 2OTLQ 5FRNA 3OW2P 1N8RC 2Y4XA 1D0XA 1QQJA 1QVFS 4BDZA 3QUIA 4Z8AA 4M7DD 3CC4T 2EKHA 2ZPFB 2DLPA 1QVGA 1NM7A 4E47A 1X6OA 4IUUA 2OTLT 4LUDA 3S4AA 1ABOA 4LDVA 4J5YA 4HCZA 1ZLMA 1M1KC 1TTHB 3CCEA 1ZUKA 1HYOA 4M75G 1JRIA 2MF2A 2ROLA 5A2QE 5GAOr 3OW2S 2OI3A 2K9GA 4IIOA 1WXTA 2KSSA 2GTOA 3M57A 4D8KA 2C0IA 3LLRA 2AHJB 5M9OA 3VS5A 1OU9A 2PUOB 3NTHA 2XHCA 2O88A 3HRSA 3CCRA 1SPKA 1VQ6Q 2Y4YA 4M7AC 3BDLA 4IUPA 2EJGA 2BUDA 2NUPB 2DYIA 1TOVA 1BCOA 1T3SA 4A54A 4UC4A 3DB4A 2LCLA 2YHTA 3LW5E 1SSFA 1KQSP 4RCBA 4F14A 1VQ6T 4PJNA 4OB1B 4FT2A 4L59A 2KYMA 3HRUA 4N0AA 2X3WD 2PZ1A 1YNZA 1K0XA 2DM1A 4M78C 2EGAA 1A0NB 2VB6A 4EMKB 1H92A 3QYHB 2EW3A 4J9EA 4D8DA 2QQSA 4WTOB 1U3OA 2DEQA 3PNWC 3L42A 3G4SQ 2QA4A
chains in the Genus database with same CATH topology
2FL7A 4C5GA 3OMGA 2RK1A 4KUDK 2OAUA 3BFMA 4M7DG 1Q7YC 3QJ6A 5I2MA 5GMKl 1Q81U 2FVUA 3QPHA 4M7AG 4X9DA 3OY9A 3A5ZB 1Y7XA 3OYKA 1FXXA 3JCMc 3G7ZA 4FT4A 1N6AA 1WGSA 4JRKA 4EMHA 1KQSS 1I81A 5CKEA 2D0QB 2RM4A 2EQMA 2RH2A 2BKDN 4OB2B 3JCMg 3G4ST 3H8ZA 1I8FA 1MGQA 5FU6B 2E64A 3SB2A 2LT1A 2MWPA 2RI2A 3OMCA 1WQ7A 4BY6C 2DIGA 2LCCA 2CBGA 1NZ9A 3GOXA 3FJPA 2PU9B 2KAFA 3UT1A 3V7RA 4M77E 4M78G 2L8DA 5GANe 3CC7T 2DZCA 4ZGEB 5CCAA 2RHZA 2HAXA 4M77F 2V8JA 2GCXA 1D3BA 2L89A 3RMSA 2QQBA 3CXCS 3MEUA 3HKSA 3P8BB 1M8VA 4JUVA 2EQUA 4XU0A 2E41A 3PMTA 3GP8A 3FB9A 3CMEA 1K9MU 2XIDA 5HK0A 5LJ5j 4C92E 3C94A 5GANd 4JDSA 1MHNA 4M78F 2RI5A 3JAME 4BE0A 1M1FA 1Q7YU 2C06A 3LGLA 4C92F 4XU3A 2D9TA 4FU6A 5A0GA 1Q86C 4RCCA 5CKBA 2PVOB 4M7AD 3CD6T 3JB9J 4OGCA 1W2BA 3OYBA 2JOYA 1XOVA 3CPFA 3SWNB 3GF5A 2DD4A 2L3RA 2K5IA 4NS5A 3SWNA 4C8QC 3OS1A 2QEXA 2DK3A 4PJOC 4L6V5 4TVRA 3CCET 2DAQA 4VUBA 3JCMV 4M77D 2HBPA 4M7AB 5LJ5f 3CD6A 1VQOT 4IURA 1VQLT 2XD0A 3QHSA 3GLXA 3WVEB 4NL2A 4PLLA 3X28B 4JRPA 3CCVA 4JS4A 2QXFA 3NFCA 1BKBA 4BB7A 3CCJT 1IREB 4QVCA 1G3WA 3CC2T 2K9QA 3QKJA 1YIJA 2EWNA 3MO8A 1OZ2A 3JB9G 3OYGA 4M77A 4FL6A 4M78D 1H641 2OTJT 3HFNA 1QVGS 3ZEHA 5GAMd 2DXBA 1QP2A 4OGEA 5EG2A 4C92D 2CZ0B 4FSXA 3CCST 4HCCA 4HT8A 3M9QA 3PGGA 3VJPA 3ZBDA 1HXDA 2LVMA 3O8VA 3OYYA 5GMKi 2XKOC 5IT9E 3CC2A 3GWHA 2R5AA 4M78B 3UWNA 4ME7A 2V8KA 1S72T 3QXEB 4ZN1A 4M78A 5GMKm 2WSFE 2K2VA 1NPPA 1U1TA 2DO3A 1YHQA 4QVDA 1FX7A 3CCRT 1G5VA 2E70A 3OSSC 5FROA 2CZ7B 1YI2A 4C92A 1VQNA 4ZN3A 2M0OA 3LH0A 3LX7A 4RKUE 4MMLA 4WF2A 3OYFA 4BE2A 1Q86U 4JJNK 2RI3A 3OYLA 4FIBA 2EQJA 4FM4B 5C0MA 1NPRA 2DXCA 1VIEA 4PJOG 2VC8A 4XQ3A 2QQ9A 5KE2A 4ZTJA 2F69A 5GAN5 3I56T 4XTZA 1QW1A 2KVQG 3G6ET 3A8HB 1WNLA 3QYGB 3OYNA 5LJ3h 2EKOA 3RERA 3EAEA 3OS0A 2O4XB 4C8QE 3RUXA 3SFMA 2O4XA 3JCMW 3G6EA 1VQ9A 4C8QF 1BIBA 3E9FA 2HD0A 4KULA 4PJOF 3CCLA 3OA6A 2E6ZA 1Y96A 4BY6B 4BDYA 3ME9A 2YLBA 5LJ5g 4XTWA 3UDCA 5J39A 2ZPIB 3FRNA 2HQXA 2ZPBB 1ZHIA 3EFSA 2LQKA 2ZPHB 1VQMA 5CKDA 1KHCA 1M5Q1 2K57A 3LWIA 5GANj 3N5BB 1B34A 5L8RE 2DJZA 4QQ6A 4PL6A 4BE1A 4A4EA 1AHJB 3J81E 3JCMe 2H3JA 3VYGA 3QJYA 5FU7C 1KG1A 1XNIA 4XTYA 3BDUA 3CMAT 4MZMA 2MMPA 3OYHA 2XDBA 1JJ2A 3PMIA 3E19A 3AHUA 2ZCFB 3A8GB 3GIBA 3HRTA 4C8QD 5GANf 4A4KA 4PJOD 2JTMA 1LNXA 2CZ1B 4E7KA 5CKFA 2X35A 3L2WA 4J6WA 2DD5A 4M77G 2RJDA 3CMAA 1W4SA 1KD1C 3META 1YCYA 3CCMT 2RHUA 2ZPGB 3OYCA 1I4K1 3DLMA 2CZ6B 2E10A 4C0DB 3OSVA 3QZ9B 4YTLA 4KBMB 5J3BA 5GAN3 4J7FA 4PJOB 4N4IA 2M9UA 4C8QA 2ZGWA 5CR2A 2VXFA 4IUQA 2R5MA 5GAMj 4PJOA 3P8DA 5GMKh 1FWZA 3CCUA 4ATOA 5HK3A 3CCMA 3JCMQ 3OYDA 4P5NA 3CCQA 1QVPA 4C0ZA 2BIVA 3CMET 5J26A 4C92G 1D3BB 3JCMX 2RK2A 3V7SA 4QW2A 3NTKA 4IUTA 4Y28E 2LTOA 4EMGA 3A8MB 3JB9F 2RHYA 2XDPA 2E6NA 2P0PA 4HT9A 3TEEA 5KCHA 3PIOA 4V2SA 2K3XA 5CQXA 2DTOA 2DIQA 1U1SA 4J7IA 4XTUA 4BUGA 1JBMA 1UEBA 3CBOA 3HL8A 3JCMP 1XTDA 1OI1A 3RKYA 5GAMf 4B9XA 1VQ7A 1GXIE 5LJ3e 3RKXA 5LL6S 3WXMB 5GAN6 1QVFA 3RMQA 4NL3A 1WJQA 3MHXA 1XQHA 2QEXT 2FB7A 3KBGA 1M1GA 2DPPB 3VU3C 4F7UE 3BY7A 2B8AA 2GQVA 3FEOA 1HK9A 4QVZA 4M75C 1N27A 2X4YA 4XTVA 4F7UF 2EJFA 3CCVT 4E7HA 3MP8A 1KD1U 2EIFA 2GFAA 4XTXA 3JCMh 3OB9A 5LJ3d 5KH6A 1JB0E 2DZ9A 3S3OA 1YIJT 1YITA 3M56A 3SDZA 1KQ2A 3CPWA 3JB9D 1KHIA 3TU4K 4C5HA 3MCAB 3QO3A 3HPWA 2DXTA 2LQ8A 5GANg 4JLGA 2E12A 1M4ZA 2ZPEB 2EAYA 2YLCA 4ZTFA 3M55A 4M77B 3L2VA 2E5QA 3DKMA 3PIPA 1UGRB 3FC3A 5IAYA 2IVWA 1W2BS 3OW2A 2D6FA 1YHQT 2VGMA 3S6WA 1YI2T 3URGA 4J83A 4IUVA 2WSCE 1VQNT 3A8LB 3LGFA 3CC4A 2RQYA 1EIFA 2RD1A 3OYJA 4BI8B 2EFIA 3M4YA 3M53A 1BIAA 3PT9A 5HY6A 4C92B 5CQYA 2XK0A 1YJWT 3OYMA 2KK4A 2DTHA 3L2ZA 2KMTA 4LD6A 2OTLA 2LT4A 5CO7A 2KQWA 2RB6A 1K73U 3QSUA 3QZ5B 1R8OB 4DOWA 4KUIA 2MAMA 2Y90A 5GMKe 1WQWA 5FU7B 4C8QG 5D6YA 4F7UA 2PVDB 1VQ4T 1YJWA 2G3RA 1M90C 1YJNA 5GAMg 3OS5A 4QQDA 5GAOl 1KQ1A 4EPCA 3ZFJA 3S3NA 1VQKA 1VQ9T 2WACA 3T9NA 4M75E 3CCLT 1VQ4A 5CIUA 2EQKA 1K8AC 4LDUA 4OF1A 4XAXB 4GY5A 3PFSA 1BYMA 5D6XA 4M75F 3G71A 2RJEA 1VQMT 1Y96B 2X4XA 1OYXA 3MP1A 3P8HA 4C0GA 1YBYA 3M5AA 4PNOA 5KE3A 4HCBA 3J7AF 1RI0A 3KUFA 4BI3A 5GAN7 2A3LA 4OVAA 4M7DC 5IN1A 2F5TX 3Q1JA 4B9WA 3M4GA 3HFOA 1B34B 2DXUA 1VQ5A 1PSFA 2YRVA 5I21A 2XDDA 3C4SA 3DB3A 5CK9A 2CYZB 1VQPA 3ER0A 1Q82C 5A0LA 3KXTA 3JRZA 5CKHA 5DLQE 3M59A 1U8RA 5AYFA 1Y07A 4NOYA 1X75C 2IG0A 3LYIA 3S3MA 3L2RA 3V8KA 5I2SA 3INZA 1NJIU 4LDXA 2R57A 1TH7A 4J8OA 3LWHA 3GPLA 1V29B 2CGHA 3R6OA 3RESA 2JTFA 2LRQA 3M58A 3VV0A 4II1A 4M75D 3MEAA 2ZZDA 3QDRB 1X01A 4OMFB 4DQ2A 3V8LA 3JSCA 1M90U 1QP3A 1KQSA 1LJOA 1RL2A 3F70A 1VQ6A 2WSEE 4OB3B 2HQEA 2QQRA 3JCMd 3FLGA 2KDSA 2I2LA 4EMKA 4MZTA 3CCUT 2VUBA 3GNFB 2MI6A 4Y91A 3L2QA 2CKKA 4O5VA 5DLOA 3GNGA 2PUKB 5D6WA 3CCQT 4E7IA 1K8AU 1G3TA 1N9SA 3X24B 4A53A 4M75A 4C8QB 3MEVA 3UPUA 4C0FA 4MDXA 3VUZA 1UGQB 2JN0A 2RJCA 4Q5WA 3MEWA 3E9GA 3SD4A 5HKCA 2E65A 4GLKA 5KCOA 4E7JA 4LDWA 4D6WA 5LJ3f 1VUBA 5LJ5h 4HKEA 2DKGA 1DJ7B 1Y71A 2LX9A 1JJ2S 3QBYA 1PSEA 4Z02A 2KNGA 2EJ9A 1VQ7T 2GF7A 3CXCA 3CBMA 3L1AA 2VXEA 5CVIA 3C12A 2QQAA 5GAOp 3OYIA 4OP0A 4F7UG 4JLIA 4M7DE 4M7AE 2K5LA 1UGPB 3RKWA 4C5EA 4N0AC 2KY9A 5GAN8 2M16A 4M7DF 5GAOn 2JNGA 2PQWA 1VQ8T 1G3SA 4M7AF 4R55A 4N4GA 4CI0C 4ZGJB 5GAN4 4LD9K 4OB0B 3WVDB 2RO0A 2LNVA 3X20B 5GAOm 3G4SA 1N9RA 1K73C 4XK8E 2RHXA 4EMKC 3OS2A 1YITT 4C5IA 4MZPA 2EYQA 2JUFA 3JCMJ 3J80E 1Q82U 1VQ8A 1YJ9T 3UFEA 4IKFA 3OQ5A 2L5QA 2CB9A 3X25B 1KC8C 4CRIA 2NLUA 3HP9A 1LOJA 3L2UA 2RHIA 5GMKj 3CC7A 1G3YA 4M78E 4ELYC 3X26B 2V8IA 4HA8A 2CS7A 1BI1A 2P4TA 1YJ9A 2M1HA 5FRNA 3VKIA 2VV5A 1N8RC 2JVVA 4BD3A 2Y4XA 2VYTA 1BI0A 1QVFS 4BDZA 5DY9A 3QUIA 2JZ2A 5A0DA 4X34A 4M7DD 1VIFA 3CC4T 2XI9A 2ZPFB 5GAN2 1QVGA 4E47A 4ELZC 2XICA 2P0QA 4BACA 1X6OA 5FU6C 4PLIA 4C0DC 3PTAA 4IUUA 2OTLT 3DLLA 4ZGDB 3JB9I 4EDUA 5GAMe 5FRMA 4M7DB 4LDVA 5LJ3j 4J5YA 4HCZA 2K3YA 5LJ3g 1M1KC 4M7DA 3V8JA 3CPWS 4M7AA 1O9SA 2FYKA 3NTIA 3CBPA 4XU2A 1YJNT 5DM7R 1NJIC 3CCEA 5FLXE 2HNIA 1ZQ1A 1VQKT 1VQOA 4F7UB 4M75G 1VQLA 4JRIA 1JRIA 3H6ZA 1I5LA 1UGSB 2MF2A 2QDYB 2DVEA 3HHTB 3TCJA 5A2QE 4DA4A 3ASKA 5GAOr 1WPYA 4R56A 3OW2S 3CCJA 1WJSA 3OBWA 1P92A 1BI3A 4J6XA 4J6YA 2A7YA 4RG8A 5LJ5e 1KC8U 1BI2A 2KSSA 3G71T 1O75A 3M57A 3VUBA 2OTJA 4DOVA 2GFUA 2X4JA 2O01E 1OZ3A 1N8RU 3LLRA 3CCSA 2AHJB 5GANh 2LC4A 3BW1A 3MP6A 5M9OA 1VQ5T 3JCMf 3SWNC 1VQPT 2PUOB 3CEYA 3NTHA 3M54A 2F5KA 2XHCA 5LJ5d 1S72A 1Q81C 2VGNA 4KT0E 3HRSA 4QQGA 2DTIA 3CCRA 2PVGB 4XU1A 2Y4YA 3FDRA 2K5FA 1UB4A 3BDLA 4A4GA 4M7AC 3FIFA 3TREA 3EFRA 4MDWA 4IUPA 2EJGA 2R58A 2BUDA 4BI4A 2RA2A 3OBYA 5C6SA 4PJOE 3HSBA 1M1KU 3RIRA 4UC4A 3DB4A 4X9CA 4A54A 1H3ZA 2LCLA 4M77C 4LDYA 2YHTA 4E7LA 1ZBXA 2E1HA 1IZ6A 1SSFA 3LW5E 3QG1A 4RCBA 2RJFA 4PKCC 3OYEA 4JS5A 3I56A 4L5GA 1NE8A 3I55T 2FHDA 1VQ6T 4RG2A 3QIIA 5GAOq 3A8OB 2P0KA 4OB1B 4FT2A 4A4FA 2XU8A 4L59A 3HRUA 5CAIA 4N0AA 2XG8D 3JB9H 1M9SA 3VYHB 3E1SA 4M78C 2K4YA 5GAMh 4O6JA 3I55A 3C95A 4EMKB 2QA4T 4C92C 2QI2A 2OUTA 3QYHB 1WJRA 2X4WA 2QQSA 4JRQA 2DEQA 4M75B 3OYAA 4A4HA 3JCMb 2MWOA 1K9MC 3V7CA 4RMOA 4N4HA 4MMKA 2LDMA 3PNWC 3L42A 2QTXA 2QA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHX A;  2EKO A;  3OS2 A;  4C5G A;  3EAE A;  4IUV A;  4C5I A;  3OMG A;  2O4X B;  3S6W A;  3OS0 A;  3QJ6 A;  3LGF A;  4IKF A;  2O4X A;  3OQ5 A;  3OY9 A;  3OYJ A;  3OYK A;  4CRI A;  2NLU A;  2EFI A;  3L2U A;  2RHI A;  1WGS A;  3E9F A;  2XK0 A;  3OYM A;  3OA6 A;  4BDY A;  2EQM A;  4LD6 A;  3ME9 A;  2BKD N;  2M1H A;  5J39 A;  5FRN A;  2HQX A;  3H8Z A;  4BD3 A;  1KHC A;  2VYT A;  5D6Y A;  4BDZ A;  2MWP A;  2RI2 A;  2G3R A;  3OMC A;  2JZ2 A;  2DIG A;  2LCC A;  4PL6 A;  4QQ6 A;  4X34 A;  4QQD A;  4A4E A;  3GOX A;  4BE1 A;  3UT1 A;  3S3N A;  2WAC A;  2L8D A;  4BAC A;  4PLI A;  4IUU A;  2RHZ A;  5CIU A;  2EQK A;  1XNI A;  4EDU A;  5FRM A;  4GY5 A;  3PFS A;  4HCZ A;  2K3Y A;  3OYH A;  2L89 A;  5D6X A;  3MEU A;  3PMI A;  2RJE A;  2X4X A;  3NTI A;  1OYX A;  2EQU A;  3MP1 A;  3P8H A;  5KE3 A;  3PMT A;  1RI0 A;  3KUF A;  4E7K A;  2X35 A;  3L2W A;  4OVA A;  2RJD A;  5IN1 A;  3Q1J A;  4B9W A;  1MHN A;  3MET A;  2RHU A;  2RI5 A;  3H6Z A;  3OYC A;  3DLM A;  4BE0 A;  2YRV A;  3C4S A;  3ASK A;  3DB3 A;  3LGL A;  4N4I A;  2D9T A;  4FU6 A;  1WJS A;  4IUQ A;  2R5M A;  3P8D A;  2IG0 A;  3LYI A;  3OYB A;  3S3M A;  3OYD A;  3L2R A;  2GFU A;  2BIV A;  2L3R A;  2R57 A;  4NS5 A;  3OS1 A;  1OZ3 A;  5J26 A;  3LLR A;  4QW2 A;  2DAQ A;  3NTK A;  4IUT A;  2LTO A;  2JTF A;  2LRQ A;  2RHY A;  2XDP A;  3MP6 A;  2E6N A;  5M9O A;  4IUR A;  4II1 A;  5KCH A;  3MEA A;  4E7H A;  4PLL A;  3CEY A;  3NTH A;  2F5K A;  2K3X A;  3F70 A;  2DIQ A;  2HQE A;  2QQR A;  4QQG A;  3FLG A;  1OI1 A;  3QKJ A;  3FDR A;  4A4G A;  3BDL A;  3MO8 A;  4B9X A;  1OZ2 A;  3L2Q A;  3FC3 A;  2CKK A;  3OYG A;  4E7I A;  4FL6 A;  5D6W A;  4IUP A;  1WJQ A;  2R58 A;  3ZEH A;  2BUD A;  3MEV A;  5C6S A;  2B8A A;  2RJC A;  3M9Q A;  4Q5W A;  3DB4 A;  3FEO A;  3MEW A;  2LVM A;  3E9G A;  3O8V A;  4UC4 A;  3SD4 A;  5KCO A;  4E7J A;  4E7L A;  2R5A A;  1H3Z A;  1SSF A;  4QVZ A;  3OYE A;  2RJF A;  1N27 A;  2X4Y A;  3UWN A;  3MP8 A;  2FHD A;  4RG2 A;  3QII A;  2GFA A;  3QBY A;  1G5V A;  3OB9 A;  2P0K A;  4Z02 A;  5KH6 A;  4A4F A;  5FRO A;  4L59 A;  3S3O A;  2GF7 A;  2M0O A;  3LH0 A;  3LX7 A;  3OYI A;  4C5H A;  3OYF A;  4BE2 A;  2RI3 A;  3OYL A;  4C5E A;  2EQJ A;  5C0M A;  4ZTF A;  1WJR A;  2M16 A;  2X4W A;  3L2V A;  2QQS A;  2PQW A;  5KE2 A;  2E5Q A;  3OYA A;  4ZTJ A;  4A4H A;  4N4G A;  2MWO A;  5IAY A;  2RO0 A;  4N4H A;  2LDM A;  3PNW C;  3L42 A;  3OYN A; 
#chains in the Genus database with same CATH topology
 1X2Q A;  1RAB B;  4C5G A;  1OOT A;  3OMG A;  4KUD K;  1E6G A;  1TUG B;  1MND A;  1Y7X A;  4AG1 C;  1KQS S;  1I81 A;  2D0Q B;  2BKD N;  4OB2 B;  8AT1 B;  3G4S T;  2DEU A;  3E2U A;  2LJ1 A;  2LT1 A;  4FYX B;  1WLP B;  2KAF A;  3V7R A;  2L8D A;  1RAE B;  2HAX A;  2V8J A;  2L89 A;  3HKS A;  2E41 A;  3FB9 A;  3CME A;  1ARK A;  5LJ5 j;  2DL5 A;  4M78 F;  2HKN A;  2KBT A;  3JAM E;  4F16 A;  5A0G A;  2KXC A;  1M3C A;  3EH2 A;  4X1V A;  4M7A D;  4OGC A;  1XOV A;  1WFW A;  3SWN A;  3OS1 A;  4J9F A;  4PJO C;  2EBP A;  1X69 A;  3CCS Q;  3CD6 A;  2DE0 X;  3GLX A;  4JRP A;  1D1A A;  3NFC A;  4BB7 A;  2CP7 A;  2JT4 A;  4QVC A;  7AT1 B;  3NPF A;  1ZA1 B;  3MO8 A;  1OZ2 A;  1D1B A;  4M77 A;  4M78 D;  4IIM A;  2AZV A;  3TSZ A;  3CCS T;  2Z0W A;  3VJP A;  3ZBD A;  3CC2 A;  2RNA A;  3GWH A;  2L2P A;  4ME7 A;  2V8K A;  1WX6 A;  1YHQ A;  2K2V A;  1NPP A;  1FX7 A;  2E70 A;  1QKX A;  2CZ7 B;  1H8K A;  2HKQ B;  1KSW A;  2AKL A;  1Q86 U;  4KGX B;  3I55 Q;  1NPR A;  1I5O B;  2QQ9 A;  2CT4 A;  4XTZ A;  2EQI A;  3OYN A;  5LJ3 h;  2O4X B;  2DER A;  3RUX A;  1M3B A;  1WHM A;  3G6E A;  1VQ9 A;  1D1C A;  2OX7 A;  3E9F A;  4PJO F;  4BY6 B;  2CQS A;  1ZHI A;  1BCM A;  3N5B B;  4E7S A;  5L8R E;  2DJZ A;  4QQ6 A;  4PL6 A;  4BE1 A;  3RBB B;  2RQR A;  1YCS B;  2H3J A;  3VYG A;  3QJY A;  1KG1 A;  3S4B A;  4XTY A;  3CMA T;  1D0Y A;  2YXY A;  4GLM A;  2D8H A;  3A8G B;  5HCK A;  2HSP A;  4PJO D;  2JTM A;  1JXM A;  4E7K A;  2O9S A;  4M77 G;  2RJD A;  1KD1 C;  3MET A;  3A1P A;  3EGU A;  2FZC B;  2K2M A;  3OYC A;  1I4K 1;  3DLM A;  5J3B A;  4J7F A;  1ZUY A;  2M9U A;  2LQN A;  5GAM j;  1JQQ A;  1G83 A;  1ZSZ A;  5IXB A;  4AMC A;  3CCM A;  3JCM Q;  4P5N A;  1TXQ A;  3EGD A;  2QEX Q;  3JB9 F;  2E6N A;  3ACS A;  3QDE A;  2HEQ A;  3PIO A;  4V2S A;  1OEB A;  1XTD A;  1OI1 A;  3RKY A;  2HMA A;  2CSQ A;  3RKX A;  2JJ9 A;  2I15 A;  1XQH A;  2QEX T;  2AKK A;  1M1G A;  8ATC B;  2DPP B;  3FJ5 A;  2GQV A;  4EIK A;  2X4Y A;  4XTV A;  4HXJ A;  2MYS A;  2GFA A;  2DFU A;  5LJ3 d;  5KH6 A;  1JB0 E;  2DZ9 A;  3S3O A;  3SDZ A;  3JB9 D;  1KHI A;  2AT1 B;  4C5H A;  5IXF A;  3MCA B;  3QO3 A;  2J7I A;  2LQ8 A;  2E12 A;  2YDL A;  4K11 A;  4ZTF A;  1FMK A;  3L2V A;  2IPO B;  1K9A A;  2A28 A;  1W2B S;  4LE9 A;  3S6W A;  6AT1 B;  1IHV A;  2D0N A;  3CC4 A;  2RD1 A;  1ZUU A;  4DEY A;  2KR3 A;  2V1Q A;  4BI8 B;  2EFI A;  3PT9 A;  3OYM A;  2OTL A;  2DTH A;  2LT4 A;  3CCL Q;  1E7O A;  1FYN A;  4AFS C;  3QZ5 B;  1R8O B;  1UJY A;  4KUI A;  1D09 B;  5GMK e;  4F7U A;  5D6Y A;  2PVD B;  1VQM Q;  1M90 C;  1ZSG A;  3PE0 A;  3CCL T;  2VVK A;  5CIU A;  2EQK A;  1AWW A;  4OF1 A;  4XAX B;  2DMO A;  3M0R A;  2OJ2 A;  1VQM T;  5KE3 A;  1YBY A;  1PKS A;  2F2W A;  1RI0 A;  1EFN A;  4GBQ A;  2YRV A;  3C4S A;  2CYZ B;  4WCI A;  1Q82 C;  2VAS A;  3JRZ A;  1WYX A;  5CKH A;  3LYI A;  3V8K A;  1X6B A;  3CCU Q;  3INZ A;  1NJI U;  3M0Q A;  3LWH A;  2GGR A;  2FRW A;  3VV0 A;  2E3I A;  3JSC A;  1QP3 A;  3ACT A;  3NMZ C;  3F70 A;  1VQ6 A;  1S1N A;  2HQE A;  2QQR A;  4Z88 A;  4MZT A;  3CCU T;  1NEG A;  2VUB A;  2MI6 A;  3FC3 A;  4O5V A;  4E7I A;  1ZBJ A;  1G3T A;  4MDX A;  1UGQ B;  2RJC A;  4Q5W A;  3CXC P;  1VUB A;  3I5S A;  4HKE A;  1AZG B;  1Y71 A;  1JJ2 S;  3QBY A;  1PSE A;  1ABQ A;  2EJ9 A;  2GF7 A;  2COY A;  2AK5 A;  2VXE A;  3C12 A;  3VS1 A;  3OYI A;  5KYX A;  4OP0 A;  4F7U G;  1G2B A;  3RKW A;  3IQL A;  1W1F A;  2A08 A;  3QFZ A;  2KT8 A;  5KYW A;  2ECZ A;  4N4G A;  5GAN 4;  3G4S A;  1N9R A;  1RAG B;  1TG0 A;  4EMK C;  3CPW P;  1I0C A;  2EYQ A;  2JUF A;  2V1R A;  3UFE A;  3OQ5 A;  3X25 B;  3HP9 A;  1LOJ A;  2M1H A;  2JVV A;  2RQW A;  4J9I A;  5DY9 A;  2JZ2 A;  5D7U A;  1VIF A;  4FSS A;  3M0S A;  2CDT A;  2HL5 C;  4DBH A;  4BAC A;  2CT3 A;  4C0D C;  3DLL A;  4ZGD B;  4ANJ A;  2K6D A;  5FRM A;  2K3Y A;  5LJ3 g;  3V8J A;  3PVL A;  3CPW S;  4M7A A;  1Q86 R;  2J6O A;  3NTI A;  3G71 Q;  4XU2 A;  5DM7 R;  1NJI C;  3H9N A;  4JRI A;  1I5L A;  1UGS B;  2QDY B;  3HHT B;  1NG2 A;  1SF9 A;  2LX7 A;  3ASK A;  4RTX A;  2EYZ A;  2K3B A;  4R56 A;  1VQP Q;  1IGQ A;  1WJS A;  3OBW A;  1BI2 A;  4OMM A;  3G71 T;  1IHW A;  2H3E B;  2J06 A;  2V26 A;  1OUL A;  2GFU A;  4RTT A;  1I1J A;  1JU5 C;  1OZ3 A;  2EVR A;  2EYX A;  2FZG B;  1N8R U;  3CCS A;  1WHJ A;  5GAN h;  2LC4 A;  1VQP T;  4AFU C;  3VS3 A;  2PVG B;  1PHT A;  3FDR A;  4A4G A;  1L6E A;  3EFR A;  2RA2 A;  1M1K U;  1WZO A;  3RIR A;  4JS5 A;  2RJF A;  4DBQ A;  1JEG A;  4L5G A;  4RG2 A;  2HL3 A;  3A8O B;  4RTZ A;  2XU8 A;  1MV0 B;  2M02 A;  3JB9 H;  1M9S A;  3I55 A;  1WDX A;  3C95 A;  2KRO A;  4C92 C;  2QI2 A;  1NLO C;  2X4W A;  2CQT A;  4JRQ A;  3OYA A;  3JCM b;  2L3Q A;  4N4H A;  1M2V A;  2FL7 A;  1R0B G;  4CC7 A;  2RK1 A;  1WHG A;  2OAU A;  3BFM A;  5AT1 B;  4LXC A;  4M7A G;  3QPH A;  1QLY A;  3OY9 A;  3G7Z A;  4FT4 A;  1R0C B;  2ED0 A;  3EG9 A;  4JJC A;  2F1L A;  2RH2 A;  4JZ3 A;  4KGZ B;  1YJ9 Q;  2E64 A;  2YUP A;  5IHI A;  2JS2 A;  2RI2 A;  3OMC A;  1WQ7 A;  4BY6 C;  2DIG A;  2W10 A;  2CBG A;  1NZ9 A;  3FJP A;  3UT1 A;  4M78 G;  1IXD A;  2DZC A;  4ZGE B;  2DL3 A;  1Y57 A;  1MV3 A;  3RMS A;  2B86 A;  1M8V A;  2LMJ A;  4JUV A;  4C92 E;  3C94 A;  5GAN d;  1MHN A;  2RI5 A;  1VQO Q;  1VQL Q;  4KRT A;  4C92 F;  2CH4 A;  4XU3 A;  3VRY A;  2JMA A;  4RCC A;  5CKB A;  3CCJ Q;  3JB9 J;  1C1A A;  3SWN B;  2O9V A;  4KH0 B;  4NS5 A;  2QEX A;  3IM3 A;  4L6V 5;  1U5S A;  1JXO A;  1VQO T;  4IUR A;  1VQL T;  2YRC A;  3WVE B;  1UG1 A;  2QXF A;  1NBE B;  1BKB A;  3CCJ T;  3QKJ A;  2FEI A;  1M27 C;  5EG2 A;  4C92 D;  2CZ0 B;  4FSX A;  2RMO A;  5GMK i;  5IT9 E;  2MPX C;  2XKO C;  2JTE A;  3EFO A;  1AWX A;  2ED1 A;  1U1T A;  2K7A A;  1G5V A;  2HBW A;  4ZN3 A;  3LH0 A;  4RKU E;  2DRK A;  2X51 A;  4FIB A;  1MUZ A;  2EQJ A;  2DXC A;  2GTJ A;  4PJO G;  2VC8 A;  2I0N A;  5KE2 A;  4ZTJ A;  2F69 A;  1QW1 A;  1PCX A;  2BZX A;  4OMO A;  2CH4 W;  3SFM A;  1BBZ A;  3JCM W;  1TUD A;  2BZY A;  4KUL A;  3CCL A;  1KIK A;  3LH5 A;  3UDC A;  4DBF A;  2FRY A;  3EFS A;  1VQM A;  5CKD A;  1PNJ A;  4OML A;  1M2O A;  3J81 E;  4J9B A;  3JCM e;  3A98 A;  1WIE A;  4MZM A;  4J9C A;  2XDB A;  3E19 A;  3GIB A;  3HRT A;  2X35 A;  3L2W A;  1W4S A;  4QKU A;  2RHU A;  1YFN A;  2CZ6 B;  4C0D B;  4YTL A;  5GAN 3;  4N4I A;  4C8Q A;  1ZSZ B;  2YUN A;  1FWZ A;  3CCU A;  5HK3 A;  3OYD A;  3QDF A;  1QVP A;  3M0U A;  4C0Z A;  2AIR B;  5J26 A;  1D3B B;  3JCM X;  2RK2 A;  1YWO A;  3V7S A;  4QW2 A;  4Y28 E;  1AT1 B;  2LTO A;  2XDP A;  4RTA A;  4J9G A;  4HT9 A;  5KCH A;  3H0F A;  5CQX A;  2DIQ A;  1U1S A;  4XTU A;  4BUG A;  1UEB A;  1TSF A;  4B9X A;  1GXI E;  5LJ3 e;  1KK7 A;  1YIJ Q;  5GAN 6;  1QVF A;  3RMQ A;  4NL3 A;  4RT4 A;  3BY7 A;  1X2K A;  2A37 A;  4M75 C;  2EJF A;  1KD1 U;  4RIQ A;  2JM8 A;  3JCM h;  3OB9 A;  1YIJ T;  2KI7 A;  1KQ2 A;  1YI2 Q;  4RTW A;  1VQN Q;  3TU4 K;  2COZ A;  5GAN g;  2DVJ A;  2ZPE B;  3EGX B;  2E5Q A;  4Z89 A;  1YP5 A;  1UUE A;  3OW2 A;  2D6F A;  4CC4 B;  1YI2 T;  1N8R R;  1VQN T;  2BZ8 A;  1EIF A;  3OYJ A;  1WHH A;  2JMC A;  3GBQ A;  3M4Y A;  2A0F B;  1KJW A;  5HY6 A;  4C92 B;  1YJW T;  2KK4 A;  1MMG A;  3L2Z A;  2CP5 A;  5CO7 A;  1K73 U;  3QSU A;  2KYG A;  1WQW A;  5FU7 B;  4C8Q G;  1M1K R;  1VQ4 T;  5I22 A;  4QQD A;  1KQ1 A;  2WAC A;  3T9N A;  2EGC A;  4M75 E;  1K8A C;  2HSE B;  3PFS A;  1C6V X;  1UEC A;  4M75 F;  1WHL A;  3G71 A;  1Y96 B;  2X4X A;  4LN2 A;  1PKT A;  3KUF A;  2A3L A;  1HJD A;  4OVA A;  4AT1 B;  3CMA Q;  1Y0M A;  3HFO A;  2BE7 D;  1B34 B;  2RQU A;  1PSF A;  2AZS A;  2XDD A;  1VQP A;  2EZW A;  5DLQ E;  3M59 A;  2NUP A;  1U8R A;  5AYF A;  1Y07 A;  3QFY A;  2O2O A;  3S3M A;  3L2R A;  4E2F B;  4LDX A;  2R57 A;  4J8O A;  4OMP A;  3GPL A;  1V29 B;  2CGH A;  3R6O A;  1X6G A;  3RES A;  1MMN A;  2JTF A;  1JO8 A;  2LRQ A;  1B3Q A;  3M58 A;  3VRZ A;  4M75 D;  1M90 U;  2FPD A;  3H0H A;  1KQS A;  2WSE E;  1OX9 A;  4OB3 B;  2X9H A;  3JCM d;  3FLG A;  2KDS A;  4EMK A;  3GNF B;  2CKK A;  1VQ7 Q;  4A53 A;  4LUE A;  3UPU A;  2NUZ A;  3E9G A;  3SD4 A;  5HKC A;  2E65 A;  4LDW A;  4D6W A;  4JJB A;  4DBR A;  5LJ3 f;  1RUW A;  5FW9 A;  4PK4 A;  5LJ5 h;  2DRN A;  2F2V A;  1GCP A;  1WXU A;  1VQ7 T;  3CBM A;  1YIT Q;  3L1A A;  5CVI A;  5GAO p;  1Q82 U;  1GL5 A;  2K5L A;  4N0A C;  2M16 A;  5KYW B;  2DL7 A;  1VQ8 T;  1G3S A;  4R55 A;  2RO0 A;  4HVU A;  1BU1 A;  1K73 C;  4XK8 E;  1YIT T;  4C5I A;  1RLP C;  3QWY A;  2L5Q A;  2CB9 A;  1KC8 C;  2NLU A;  1GCQ A;  2RHI A;  5GMK j;  1BI1 A;  1YJ9 A;  3EG1 A;  3VKI A;  2VV5 A;  2VYT A;  4RTV A;  1B7T A;  5A0D A;  1LPL A;  4X34 A;  3MPU B;  1YJN Q;  4ELZ C;  2XIC A;  4PFO A;  2P0Q A;  4PLI A;  2CP3 A;  1UHF A;  4EDU A;  5GAM e;  2CRE A;  1SSH A;  2JW4 A;  4M7D A;  5I11 A;  2FYK A;  2YUO A;  1YJN T;  2GNC A;  2DYB A;  2HNI A;  1ZQ1 A;  4DEX A;  5KYY B;  1VQO A;  1VQL A;  4HVW A;  4DA4 A;  2DVE A;  1VQ5 Q;  3CCJ A;  4RG8 A;  1P92 A;  4J6Y A;  2A7Y A;  3VUB A;  2NWM A;  4ORZ A;  4DOV A;  1G8X A;  3TVT A;  3I35 A;  1VYV A;  3SEM A;  3MP6 A;  1K76 A;  1VQ5 T;  3SWN C;  3CEY A;  5LJ5 d;  2XMF A;  1Q81 C;  2VGN A;  4KT0 E;  2DTI A;  1UB4 A;  3TRE A;  4MDW A;  2R58 A;  5C6S A;  4X9C A;  2DBM A;  1H3Z A;  2M51 A;  4M77 C;  4E7L A;  1ZBX A;  2E1H A;  1LVK A;  1NE8 A;  1RAI B;  4AG2 C;  3ZL7 C;  1RLQ C;  2XG8 D;  3VYH B;  3E1S A;  1M8M A;  1AWO A;  1HD3 A;  2K4Y A;  5GAM h;  4O6J A;  2QA4 T;  2OUT A;  2MIO A;  3EH1 A;  4M75 B;  4A4H A;  1K9M C;  3V7C A;  2QTX A;  1OU8 A;  4M7D G;  1Q7Y C;  3QJ6 A;  5I2M A;  1HSQ A;  1QCN A;  4AFZ C;  1W70 A;  3EG9 B;  1E6H A;  1N6A A;  1UFF A;  1WGS A;  4JRK A;  1GBQ A;  2KRS A;  2RM4 A;  4E7Z A;  4J9H A;  2EQM A;  3JCM g;  5ECA A;  3H8Z A;  1CKA A;  1MGQ A;  5FU6 B;  3SB2 A;  4JPB W;  3GOX A;  1RAH B;  1W6X A;  4M77 E;  5GAN e;  1KD1 R;  2CP2 A;  4M77 F;  2GCX A;  2IZY A;  4F17 A;  2QQB A;  1TUC A;  3CXC S;  3P8B B;  2DBK A;  2NUT A;  3VS7 A;  2XID A;  1QVG P;  5HK0 A;  4RUG A;  3U23 A;  4JDS A;  4E6R A;  4BE0 A;  2C06 A;  3LGL A;  2D9T A;  4FU6 A;  1AZE A;  3CD6 T;  1W2B A;  3OYB A;  2H8H A;  2EPD A;  3G1J A;  2L3R A;  2OTJ Q;  2L3P A;  2DK3 A;  4TVR A;  1ZSZ C;  4VUB A;  4M77 D;  1K73 R;  2XD0 A;  3QHS A;  4NL2 A;  3X28 B;  4JS4 A;  4J9D A;  2L0A A;  1S72 Q;  5IHN A;  1IRE B;  1G3W A;  3CC2 T;  1YIJ A;  2EWN A;  3TQ7 P;  1BK2 A;  3H0I A;  2OTJ T;  1H64 1;  1QVG S;  3ZEH A;  5GAM d;  1QP2 A;  5GJW B;  4HCC A;  4HT8 A;  2P4R A;  1HXD A;  2LVM A;  3O8V A;  2DX1 A;  1NLP C;  2R5A A;  3UWN A;  1S72 T;  3VS4 A;  3QXE B;  4ZN1 A;  4M78 A;  2WSF E;  3I56 Q;  1ACM B;  3OSS C;  1YI2 A;  5FRO A;  1VQN A;  1PD0 A;  2ESW A;  2M0O A;  3LX7 A;  4WF2 A;  3OYF A;  2GQI A;  4BE2 A;  1K0S A;  3UAT A;  2RI3 A;  3OYL A;  2LNH B;  5C0M A;  1VIE A;  4XQ3 A;  2A36 A;  5GAN 5;  1WHK A;  3I56 T;  1NYF A;  3G6E T;  2KEA A;  3QYG B;  2EKO A;  3RER A;  3OS0 A;  1M90 R;  2BTT A;  2FZK B;  1BIB A;  2E6Z A;  5LJ5 g;  2YLB A;  3FRN A;  1IGU A;  2ZPB B;  2E4H A;  2ZPH B;  3LWI A;  3IM4 A;  2EYY A;  4A4E A;  2FG0 A;  2COW A;  3KFV A;  5FU7 C;  3BDU A;  4ZP3 A;  2MMP A;  1Q82 R;  1JJ2 A;  3PMI A;  3S4C A;  1AOJ A;  3AHU A;  2VWF A;  5GAN f;  4A4K A;  2QAZ A;  1LNX A;  3NHN A;  1V76 A;  5CKF A;  2L3S A;  4ESR A;  4J6W A;  3CMA A;  1YCY A;  2PNI A;  3CCM T;  2ZPG B;  2KNB B;  2LCS A;  2VXF A;  2R5M A;  4PJO A;  1Z9Z A;  1RAD B;  1EZZ B;  2SEM A;  1FMW A;  3H41 A;  3NTK A;  3A8M B;  2K3X A;  2DTO A;  2IIM A;  1JBM A;  3CBO A;  1VQ7 A;  2DL8 A;  3WXM B;  2PTK A;  3MHX A;  2FB7 A;  3KBG A;  3AFJ A;  4F7U E;  3VU3 C;  4LNP A;  4QVZ A;  3EHR A;  4F7U F;  2KRN A;  2ZAE A;  3CCV T;  3MJX A;  4B6M A;  1YIT A;  3CPW A;  1ZX6 A;  2MK5 A;  1XJW B;  4JLG A;  4FCY A;  1M4Z A;  1WA7 A;  2LP5 A;  2EAY A;  2YLC A;  3M0P A;  4M77 B;  4HCK A;  3PIP A;  5IAY A;  1R2A A;  2VGM A;  1U06 A;  1RAC B;  2DL4 A;  3URG A;  4J83 A;  4IUV A;  3LGF A;  2RQY A;  1BIA A;  2XK0 A;  2YWW A;  1YN8 A;  2KMT A;  3EHQ A;  2HCK A;  2KQW A;  2RB6 A;  3UF4 A;  3RDV A;  2FPE A;  2Y90 A;  3REA B;  2H9R A;  1UTI A;  1YJN A;  5GAM g;  5GAO l;  1NJI R;  1SG5 A;  1WI7 A;  3R6N A;  1BYM A;  2RJE A;  2ENM A;  4C0G A;  3QWX X;  4BI3 A;  5GAN 7;  2QGF B;  5IN1 A;  2F5T X;  2DXU A;  1VQ5 A;  1F1B B;  3DB3 A;  3ER0 A;  3RSY A;  2J6F A;  4NOY A;  1AD5 A;  1QWE A;  1X75 C;  2DIL A;  5I2S A;  3RNJ A;  4CC3 A;  3CCQ Q;  2RQV A;  2DET A;  1UE9 A;  1Q95 G;  4E7H A;  5LJ3 j;  2ZZD A;  5KYU A;  4OMF B;  3V8L A;  1ZA2 B;  1LJO A;  1RL2 A;  1YWP A;  2QK0 A;  3JB9 G;  3L2Q A;  3HSB A;  1K8A U;  5D6W A;  3CCQ T;  3X24 B;  4RTY A;  2LJ0 A;  4C0F A;  3VUZ A;  2JN0 A;  2LJ3 A;  1GFC A;  1UHC A;  5KCO A;  1AEY A;  2C0O A;  3EGD B;  2DKG A;  1DJ7 B;  2LX9 A;  2JM9 A;  2J6K A;  4Z02 A;  1QCO A;  4F9K A;  2QQA A;  2F2X A;  4JLI A;  1C0M A;  4M7A E;  1UGP B;  1K4U S;  5GAN 8;  5GAO n;  1GFD A;  4M7A F;  3WVD B;  2LNV A;  5GAO m;  1PRL C;  2K79 A;  2KT1 A;  4CC2 A;  4MZP A;  3TSW A;  3J80 E;  4IKF A;  1M3A A;  1IB8 A;  4CRI A;  3L2U A;  4M78 E;  3X26 B;  2V8I A;  2P4T A;  2JXB A;  2KYB A;  3CQT A;  1GBR A;  1MNE A;  4BD3 A;  2JS0 A;  1BI0 A;  4A63 B;  1YJW Q;  4KH1 B;  2XI9 A;  5GAN 2;  1AVZ C;  1VQK Q;  2EGE A;  5FU6 C;  1AWJ A;  3PTA A;  3JB9 I;  1VQ4 Q;  1TWB A;  3BE3 A;  4M7D B;  1SEM A;  4PFZ A;  5FWB A;  3QG0 A;  2X3X D;  4QT7 A;  1OQK A;  1O9S A;  2D1X A;  1QCF A;  3CBP A;  4M4Z A;  1BB9 A;  2RQT A;  1T0H A;  2ROT A;  5FLX E;  1VQK T;  4AFQ C;  4RTU A;  4F7U B;  3H6Z A;  3TCJ A;  1SHF A;  1WPY A;  1KC8 U;  5LJ5 e;  1BI3 A;  4J6X A;  1VA7 A;  2FO0 A;  3VS6 A;  1O75 A;  4KGV B;  2OTJ A;  2X4J A;  3S4D A;  2O01 E;  4R0K A;  3BW1 A;  1SKU B;  3JCM f;  3RRS A;  1S72 A;  3M54 A;  2F5K A;  1D0Z A;  4QQG A;  2EYW A;  1PWT A;  1MMA A;  4XU1 A;  2K5F A;  3FIF A;  2BE9 B;  4BI4 A;  3OBY A;  1I07 A;  3VS2 A;  2CP0 A;  3AT1 B;  4LDY A;  4PJO E;  3QG1 A;  1IZ6 A;  3OYE A;  4PKC C;  3I56 A;  3I55 T;  2FHD A;  3QII A;  5GAO q;  3EG0 A;  2P0K A;  1SRM A;  5CAI A;  2LQW A;  5IH2 A;  1SHG A;  1WJR A;  4PJM A;  2MWO A;  2QDL A;  4RMO A;  4MMK A;  2LDM A;  4PJJ A;  4QVD A;  4A4F A;  1CSK A;  3G36 A;  5GMK l;  1Q81 U;  2FVU A;  4X9D A;  3A5Z B;  1VQ8 Q;  3OYK A;  1FXX A;  3JCM c;  4EMH A;  5CKE A;  3CC7 Q;  5IHK A;  5KYX B;  2CUB A;  2G6F X;  1UGV A;  1PRM C;  3HTR A;  3M0T A;  1I8F A;  5HVZ A;  1OX8 A;  2MWP A;  2DRM A;  2LCC A;  2YUQ A;  2PU9 B;  5FWC A;  3CC7 T;  5CCA A;  2RHZ A;  3ULR B;  2HZY A;  1D3B A;  2QGG A;  2E3H A;  3MEU A;  4FW1 A;  2EQU A;  2NUT B;  4XU0 A;  3PMT A;  3GP8 A;  1K9M U;  1W2B P;  3CCE Q;  2RF0 A;  3UA6 A;  1M1F A;  1Q7Y U;  1Q86 C;  3I9Q A;  2PVO B;  1LCK A;  2JOY A;  2M0Y A;  3CPF A;  3GF5 A;  1WXB A;  2DD4 A;  3D7S B;  2K5I A;  4C8Q C;  1Z9Q A;  3CCE T;  2DAQ A;  1PC0 A;  4FYW B;  4M7A B;  2HBP A;  4PJL A;  3JCM V;  5LJ5 f;  1N5Z A;  4PLL A;  3CCV A;  2K9Q A;  3CCR Q;  3RR6 A;  3OYG A;  2DJQ A;  4FL6 A;  3HFN A;  3EGX A;  2DXB A;  4OGE A;  3M9Q A;  3PGG A;  1H3H A;  1QWF A;  3OYY A;  4M78 B;  5GMK m;  2DO3 A;  3CCR T;  1OPL A;  4HVV A;  4C92 A;  1RAA B;  9ATC B;  4MML A;  2CSI A;  4JJN K;  2GBQ A;  3NGP A;  4FM4 B;  2KVQ G;  3A8H B;  1WNL A;  1NYG A;  1IRX A;  3EAE A;  2QA4 Q;  4C8Q E;  1K1Z A;  2O4X A;  4FYV B;  1TU0 B;  1IO6 A;  2YT6 A;  2KGT A;  2D8J A;  4C8Q F;  2HD0 A;  3OA6 A;  4BDY A;  1Y96 A;  2HQH A;  3ME9 A;  2E5K A;  4XTW A;  1KFZ A;  1PM3 A;  5J39 A;  2ZPI B;  5EC7 A;  1K8A R;  2HQX A;  2CUD A;  1J3T A;  2LQK A;  2YSQ A;  1KHC A;  1M5Q 1;  2K57 A;  5GAN j;  1B34 A;  1AHJ B;  1JJ2 P;  1M2V B;  2P84 A;  2FPF A;  3THK A;  1XNI A;  2ABL A;  3OYH A;  1VYT A;  2ZCF B;  4C8Q D;  3EG3 A;  1B07 A;  2CZ1 B;  3CME Q;  2DD5 A;  2KXD A;  4JJD A;  2RN8 A;  1UDL A;  2E10 A;  3OSV A;  3QZ9 B;  4KBM B;  4PJO B;  5CR2 A;  2ZGW A;  2RPN A;  4IUQ A;  3P8D A;  5GMK h;  4ATO A;  3CCQ A;  2BIV A;  3CME T;  4C92 G;  3EG2 A;  4IUT A;  1SRL A;  4EMG A;  2RHY A;  4ZNX A;  2P0P A;  2O31 A;  3TEE A;  3CD6 Q;  4J7I A;  3HL8 A;  3JCM P;  5GAM f;  1EX4 A;  5GJV B;  5LL6 S;  1WJQ A;  2LZ6 B;  4FYY B;  2QTV A;  5L23 A;  2B8A A;  1PD1 A;  3FEO A;  1HK9 A;  3CC2 Q;  1RAF B;  1N27 A;  1OPK A;  3C0C A;  3MP8 A;  2NYS A;  2EIF A;  4XTX A;  2YRD A;  1YHQ Q;  3M56 A;  4F04 B;  1VYU A;  3HPW A;  2DXT A;  5KYN A;  4Y92 A;  3O5Z A;  3M55 A;  2DA9 A;  1KC8 R;  2DF6 A;  3DKM A;  2HDA A;  1QMC A;  1UGR B;  2IVW A;  1YHQ T;  2WSC E;  3EFO B;  3A8L B;  2DNU A;  2QYZ A;  3M53 A;  3G6E Q;  1VQ9 Q;  5CQY A;  4LD6 A;  2W0Z A;  1GCQ C;  4DOW A;  2MAM A;  5KYY A;  1PG5 B;  1YJW A;  1GRI A;  2G3R A;  1FMV A;  2QAS A;  3OS5 A;  3REB B;  3VS0 A;  4EPC A;  1VQK A;  3ZFJ A;  3S3N A;  1VQ9 T;  2C0T A;  1VQ4 A;  4FW2 A;  4LDU A;  4GY5 A;  1TS9 A;  2MOX A;  5D6X A;  3P8H A;  1OYX A;  3MP1 A;  4HCB A;  3M5A A;  4PNO A;  3J7A F;  4M7D C;  1OV3 A;  3Q1J A;  4B9W A;  3M4G A;  3PVQ A;  4OMQ A;  5I21 A;  2KRM A;  5CK9 A;  1R77 A;  5A0L A;  3KXT A;  3JV3 A;  2VKN A;  1Q81 R;  1VOM A;  2IG0 A;  3I5R A;  1T3L A;  3CCM Q;  1TH7 A;  2J05 A;  2MCN A;  2OAW A;  5KYU B;  4II1 A;  3MEA A;  3QDR B;  1X01 A;  4DQ2 A;  2ATC B;  1NEB A;  2I2L A;  4PFP A;  4Y91 A;  1CKB A;  5DLO A;  3GNG A;  2PUK B;  1N9S A;  4C8Q B;  4M75 A;  3MEV A;  4JZ4 A;  1X27 A;  4OMN A;  3MEW A;  2QG9 B;  4E7J A;  4GLK A;  1QKW A;  3SHW A;  1K9M R;  2KNG A;  3UA7 A;  1RI9 A;  3CXC A;  1QVF P;  1X43 A;  3MKD A;  4M7D E;  1Q7Y R;  3CCV Q;  4C5E A;  2KY9 A;  4M7D F;  2SRC A;  2JNG A;  2PQW A;  1V1C A;  4CI0 C;  1UJ0 A;  4ZGJ B;  4LD9 K;  4OB0 B;  3X20 B;  2CP6 A;  2RHX A;  3OS2 A;  3JCM J;  1VQ8 A;  1YJ9 T;  2KE9 A;  3CC4 Q;  3CC7 A;  1MMD A;  1G3Y A;  4ELY C;  4HA8 A;  2CS7 A;  1M30 A;  1T0J A;  2OTL Q;  5FRN A;  3OW2 P;  1N8R C;  2Y4X A;  1D0X A;  1QQJ A;  1QVF S;  4BDZ A;  3QUI A;  4Z8A A;  4M7D D;  3CC4 T;  2EKH A;  2ZPF B;  2DLP A;  1QVG A;  1NM7 A;  4E47 A;  1X6O A;  4IUU A;  2OTL T;  4LUD A;  3S4A A;  1ABO A;  4LDV A;  4J5Y A;  4HCZ A;  1ZLM A;  1M1K C;  1TTH B;  3CCE A;  1ZUK A;  1HYO A;  4M75 G;  1JRI A;  2MF2 A;  2ROL A;  5A2Q E;  5GAO r;  3OW2 S;  2OI3 A;  2K9G A;  4IIO A;  1WXT A;  2KSS A;  2GTO A;  3M57 A;  4D8K A;  2C0I A;  3LLR A;  2AHJ B;  5M9O A;  3VS5 A;  1OU9 A;  2PUO B;  3NTH A;  2XHC A;  2O88 A;  3HRS A;  3CCR A;  1SPK A;  1VQ6 Q;  2Y4Y A;  4M7A C;  3BDL A;  4IUP A;  2EJG A;  2BUD A;  2NUP B;  2DYI A;  1TOV A;  1BCO A;  1T3S A;  4A54 A;  4UC4 A;  3DB4 A;  2LCL A;  2YHT A;  3LW5 E;  1SSF A;  1KQS P;  4RCB A;  4F14 A;  1VQ6 T;  4PJN A;  4OB1 B;  4FT2 A;  4L59 A;  2KYM A;  3HRU A;  4N0A A;  2X3W D;  2PZ1 A;  1YNZ A;  1K0X A;  2DM1 A;  4M78 C;  2EGA A;  1A0N B;  2VB6 A;  4EMK B;  1H92 A;  3QYH B;  2EW3 A;  4J9E A;  4D8D A;  2QQS A;  4WTO B;  1U3O A;  2DEQ A;  3PNW C;  3L42 A;  3G4S Q;  2QA4 A; 
#chains in the Genus database with same CATH homology
 2FL7 A;  4C5G A;  3OMG A;  2RK1 A;  4KUD K;  2OAU A;  3BFM A;  4M7D G;  1Q7Y C;  3QJ6 A;  5I2M A;  5GMK l;  1Q81 U;  2FVU A;  3QPH A;  4M7A G;  4X9D A;  3OY9 A;  3A5Z B;  1Y7X A;  3OYK A;  1FXX A;  3JCM c;  3G7Z A;  4FT4 A;  1N6A A;  1WGS A;  4JRK A;  4EMH A;  1KQS S;  1I81 A;  5CKE A;  2D0Q B;  2RM4 A;  2EQM A;  2RH2 A;  2BKD N;  4OB2 B;  3JCM g;  3G4S T;  3H8Z A;  1I8F A;  1MGQ A;  5FU6 B;  2E64 A;  3SB2 A;  2LT1 A;  2MWP A;  2RI2 A;  3OMC A;  1WQ7 A;  4BY6 C;  2DIG A;  2LCC A;  2CBG A;  1NZ9 A;  3GOX A;  3FJP A;  2PU9 B;  2KAF A;  3UT1 A;  3V7R A;  4M77 E;  4M78 G;  2L8D A;  5GAN e;  3CC7 T;  2DZC A;  4ZGE B;  5CCA A;  2RHZ A;  2HAX A;  4M77 F;  2V8J A;  2GCX A;  1D3B A;  2L89 A;  3RMS A;  2QQB A;  3CXC S;  3MEU A;  3HKS A;  3P8B B;  1M8V A;  4JUV A;  2EQU A;  4XU0 A;  2E41 A;  3PMT A;  3GP8 A;  3FB9 A;  3CME A;  1K9M U;  2XID A;  5HK0 A;  5LJ5 j;  4C92 E;  3C94 A;  5GAN d;  4JDS A;  1MHN A;  4M78 F;  2RI5 A;  3JAM E;  4BE0 A;  1M1F A;  1Q7Y U;  2C06 A;  3LGL A;  4C92 F;  4XU3 A;  2D9T A;  4FU6 A;  5A0G A;  1Q86 C;  4RCC A;  5CKB A;  2PVO B;  4M7A D;  3CD6 T;  3JB9 J;  4OGC A;  1W2B A;  3OYB A;  2JOY A;  1XOV A;  3CPF A;  3SWN B;  3GF5 A;  2DD4 A;  2L3R A;  2K5I A;  4NS5 A;  3SWN A;  4C8Q C;  3OS1 A;  2QEX A;  2DK3 A;  4PJO C;  4L6V 5;  4TVR A;  3CCE T;  2DAQ A;  4VUB A;  3JCM V;  4M77 D;  2HBP A;  4M7A B;  5LJ5 f;  3CD6 A;  1VQO T;  4IUR A;  1VQL T;  2XD0 A;  3QHS A;  3GLX A;  3WVE B;  4NL2 A;  4PLL A;  3X28 B;  4JRP A;  3CCV A;  4JS4 A;  2QXF A;  3NFC A;  1BKB A;  4BB7 A;  3CCJ T;  1IRE B;  4QVC A;  1G3W A;  3CC2 T;  2K9Q A;  3QKJ A;  1YIJ A;  2EWN A;  3MO8 A;  1OZ2 A;  3JB9 G;  3OYG A;  4M77 A;  4FL6 A;  4M78 D;  1H64 1;  2OTJ T;  3HFN A;  1QVG S;  3ZEH A;  5GAM d;  2DXB A;  1QP2 A;  4OGE A;  5EG2 A;  4C92 D;  2CZ0 B;  4FSX A;  3CCS T;  4HCC A;  4HT8 A;  3M9Q A;  3PGG A;  3VJP A;  3ZBD A;  1HXD A;  2LVM A;  3O8V A;  3OYY A;  5GMK i;  2XKO C;  5IT9 E;  3CC2 A;  3GWH A;  2R5A A;  4M78 B;  3UWN A;  4ME7 A;  2V8K A;  1S72 T;  3QXE B;  4ZN1 A;  4M78 A;  5GMK m;  2WSF E;  2K2V A;  1NPP A;  1U1T A;  2DO3 A;  1YHQ A;  4QVD A;  1FX7 A;  3CCR T;  1G5V A;  2E70 A;  3OSS C;  5FRO A;  2CZ7 B;  1YI2 A;  4C92 A;  1VQN A;  4ZN3 A;  2M0O A;  3LH0 A;  3LX7 A;  4RKU E;  4MML A;  4WF2 A;  3OYF A;  4BE2 A;  1Q86 U;  4JJN K;  2RI3 A;  3OYL A;  4FIB A;  2EQJ A;  4FM4 B;  5C0M A;  1NPR A;  2DXC A;  1VIE A;  4PJO G;  2VC8 A;  4XQ3 A;  2QQ9 A;  5KE2 A;  4ZTJ A;  2F69 A;  5GAN 5;  3I56 T;  4XTZ A;  1QW1 A;  2KVQ G;  3G6E T;  3A8H B;  1WNL A;  3QYG B;  3OYN A;  5LJ3 h;  2EKO A;  3RER A;  3EAE A;  3OS0 A;  2O4X B;  4C8Q E;  3RUX A;  3SFM A;  2O4X A;  3JCM W;  3G6E A;  1VQ9 A;  4C8Q F;  1BIB A;  3E9F A;  2HD0 A;  4KUL A;  4PJO F;  3CCL A;  3OA6 A;  2E6Z A;  1Y96 A;  4BY6 B;  4BDY A;  3ME9 A;  2YLB A;  5LJ5 g;  4XTW A;  3UDC A;  5J39 A;  2ZPI B;  3FRN A;  2HQX A;  2ZPB B;  1ZHI A;  3EFS A;  2LQK A;  2ZPH B;  1VQM A;  5CKD A;  1KHC A;  1M5Q 1;  2K57 A;  3LWI A;  5GAN j;  3N5B B;  1B34 A;  5L8R E;  2DJZ A;  4QQ6 A;  4PL6 A;  4BE1 A;  4A4E A;  1AHJ B;  3J81 E;  3JCM e;  2H3J A;  3VYG A;  3QJY A;  5FU7 C;  1KG1 A;  1XNI A;  4XTY A;  3BDU A;  3CMA T;  4MZM A;  2MMP A;  3OYH A;  2XDB A;  1JJ2 A;  3PMI A;  3E19 A;  3AHU A;  2ZCF B;  3A8G B;  3GIB A;  3HRT A;  4C8Q D;  5GAN f;  4A4K A;  4PJO D;  2JTM A;  1LNX A;  2CZ1 B;  4E7K A;  5CKF A;  2X35 A;  3L2W A;  4J6W A;  2DD5 A;  4M77 G;  2RJD A;  3CMA A;  1W4S A;  1KD1 C;  3MET A;  1YCY A;  3CCM T;  2RHU A;  2ZPG B;  3OYC A;  1I4K 1;  3DLM A;  2CZ6 B;  2E10 A;  4C0D B;  3OSV A;  3QZ9 B;  4YTL A;  4KBM B;  5J3B A;  5GAN 3;  4J7F A;  4PJO B;  4N4I A;  2M9U A;  4C8Q A;  2ZGW A;  5CR2 A;  2VXF A;  4IUQ A;  2R5M A;  5GAM j;  4PJO A;  3P8D A;  5GMK h;  1FWZ A;  3CCU A;  4ATO A;  5HK3 A;  3CCM A;  3JCM Q;  3OYD A;  4P5N A;  3CCQ A;  1QVP A;  4C0Z A;  2BIV A;  3CME T;  5J26 A;  4C92 G;  1D3B B;  3JCM X;  2RK2 A;  3V7S A;  4QW2 A;  3NTK A;  4IUT A;  4Y28 E;  2LTO A;  4EMG A;  3A8M B;  3JB9 F;  2RHY A;  2XDP A;  2E6N A;  2P0P A;  4HT9 A;  3TEE A;  5KCH A;  3PIO A;  4V2S A;  2K3X A;  5CQX A;  2DTO A;  2DIQ A;  1U1S A;  4J7I A;  4XTU A;  4BUG A;  1JBM A;  1UEB A;  3CBO A;  3HL8 A;  3JCM P;  1XTD A;  1OI1 A;  3RKY A;  5GAM f;  4B9X A;  1VQ7 A;  1GXI E;  5LJ3 e;  3RKX A;  5LL6 S;  3WXM B;  5GAN 6;  1QVF A;  3RMQ A;  4NL3 A;  1WJQ A;  3MHX A;  1XQH A;  2QEX T;  2FB7 A;  3KBG A;  1M1G A;  2DPP B;  3VU3 C;  4F7U E;  3BY7 A;  2B8A A;  2GQV A;  3FEO A;  1HK9 A;  4QVZ A;  4M75 C;  1N27 A;  2X4Y A;  4XTV A;  4F7U F;  2EJF A;  3CCV T;  4E7H A;  3MP8 A;  1KD1 U;  2EIF A;  2GFA A;  4XTX A;  3JCM h;  3OB9 A;  5LJ3 d;  5KH6 A;  1JB0 E;  2DZ9 A;  3S3O A;  1YIJ T;  1YIT A;  3M56 A;  3SDZ A;  1KQ2 A;  3CPW A;  3JB9 D;  1KHI A;  3TU4 K;  4C5H A;  3MCA B;  3QO3 A;  3HPW A;  2DXT A;  2LQ8 A;  5GAN g;  4JLG A;  2E12 A;  1M4Z A;  2ZPE B;  2EAY A;  2YLC A;  4ZTF A;  3M55 A;  4M77 B;  3L2V A;  2E5Q A;  3DKM A;  3PIP A;  1UGR B;  3FC3 A;  5IAY A;  2IVW A;  1W2B S;  3OW2 A;  2D6F A;  1YHQ T;  2VGM A;  3S6W A;  1YI2 T;  3URG A;  4J83 A;  4IUV A;  2WSC E;  1VQN T;  3A8L B;  3LGF A;  3CC4 A;  2RQY A;  1EIF A;  2RD1 A;  3OYJ A;  4BI8 B;  2EFI A;  3M4Y A;  3M53 A;  1BIA A;  3PT9 A;  5HY6 A;  4C92 B;  5CQY A;  2XK0 A;  1YJW T;  3OYM A;  2KK4 A;  2DTH A;  3L2Z A;  2KMT A;  4LD6 A;  2OTL A;  2LT4 A;  5CO7 A;  2KQW A;  2RB6 A;  1K73 U;  3QSU A;  3QZ5 B;  1R8O B;  4DOW A;  4KUI A;  2MAM A;  2Y90 A;  5GMK e;  1WQW A;  5FU7 B;  4C8Q G;  5D6Y A;  4F7U A;  2PVD B;  1VQ4 T;  1YJW A;  2G3R A;  1M90 C;  1YJN A;  5GAM g;  3OS5 A;  4QQD A;  5GAO l;  1KQ1 A;  4EPC A;  3ZFJ A;  3S3N A;  1VQK A;  1VQ9 T;  2WAC A;  3T9N A;  4M75 E;  3CCL T;  1VQ4 A;  5CIU A;  2EQK A;  1K8A C;  4LDU A;  4OF1 A;  4XAX B;  4GY5 A;  3PFS A;  1BYM A;  5D6X A;  4M75 F;  3G71 A;  2RJE A;  1VQM T;  1Y96 B;  2X4X A;  1OYX A;  3MP1 A;  3P8H A;  4C0G A;  1YBY A;  3M5A A;  4PNO A;  5KE3 A;  4HCB A;  3J7A F;  1RI0 A;  3KUF A;  4BI3 A;  5GAN 7;  2A3L A;  4OVA A;  4M7D C;  5IN1 A;  2F5T X;  3Q1J A;  4B9W A;  3M4G A;  3HFO A;  1B34 B;  2DXU A;  1VQ5 A;  1PSF A;  2YRV A;  5I21 A;  2XDD A;  3C4S A;  3DB3 A;  5CK9 A;  2CYZ B;  1VQP A;  3ER0 A;  1Q82 C;  5A0L A;  3KXT A;  3JRZ A;  5CKH A;  5DLQ E;  3M59 A;  1U8R A;  5AYF A;  1Y07 A;  4NOY A;  1X75 C;  2IG0 A;  3LYI A;  3S3M A;  3L2R A;  3V8K A;  5I2S A;  3INZ A;  1NJI U;  4LDX A;  2R57 A;  1TH7 A;  4J8O A;  3LWH A;  3GPL A;  1V29 B;  2CGH A;  3R6O A;  3RES A;  2JTF A;  2LRQ A;  3M58 A;  3VV0 A;  4II1 A;  4M75 D;  3MEA A;  2ZZD A;  3QDR B;  1X01 A;  4OMF B;  4DQ2 A;  3V8L A;  3JSC A;  1M90 U;  1QP3 A;  1KQS A;  1LJO A;  1RL2 A;  3F70 A;  1VQ6 A;  2WSE E;  4OB3 B;  2HQE A;  2QQR A;  3JCM d;  3FLG A;  2KDS A;  2I2L A;  4EMK A;  4MZT A;  3CCU T;  2VUB A;  3GNF B;  2MI6 A;  4Y91 A;  3L2Q A;  2CKK A;  4O5V A;  5DLO A;  3GNG A;  2PUK B;  5D6W A;  3CCQ T;  4E7I A;  1K8A U;  1G3T A;  1N9S A;  3X24 B;  4A53 A;  4M75 A;  4C8Q B;  3MEV A;  3UPU A;  4C0F A;  4MDX A;  3VUZ A;  1UGQ B;  2JN0 A;  2RJC A;  4Q5W A;  3MEW A;  3E9G A;  3SD4 A;  5HKC A;  2E65 A;  4GLK A;  5KCO A;  4E7J A;  4LDW A;  4D6W A;  5LJ3 f;  1VUB A;  5LJ5 h;  4HKE A;  2DKG A;  1DJ7 B;  1Y71 A;  2LX9 A;  1JJ2 S;  3QBY A;  1PSE A;  4Z02 A;  2KNG A;  2EJ9 A;  1VQ7 T;  2GF7 A;  3CXC A;  3CBM A;  3L1A A;  2VXE A;  5CVI A;  3C12 A;  2QQA A;  5GAO p;  3OYI A;  4OP0 A;  4F7U G;  4JLI A;  4M7D E;  4M7A E;  2K5L A;  1UGP B;  3RKW A;  4C5E A;  4N0A C;  2KY9 A;  5GAN 8;  2M16 A;  4M7D F;  5GAO n;  2JNG A;  2PQW A;  1VQ8 T;  1G3S A;  4M7A F;  4R55 A;  4N4G A;  4CI0 C;  4ZGJ B;  5GAN 4;  4LD9 K;  4OB0 B;  3WVD B;  2RO0 A;  2LNV A;  3X20 B;  5GAO m;  3G4S A;  1N9R A;  1K73 C;  4XK8 E;  2RHX A;  4EMK C;  3OS2 A;  1YIT T;  4C5I A;  4MZP A;  2EYQ A;  2JUF A;  3JCM J;  3J80 E;  1Q82 U;  1VQ8 A;  1YJ9 T;  3UFE A;  4IKF A;  3OQ5 A;  2L5Q A;  2CB9 A;  3X25 B;  1KC8 C;  4CRI A;  2NLU A;  3HP9 A;  1LOJ A;  3L2U A;  2RHI A;  5GMK j;  3CC7 A;  1G3Y A;  4M78 E;  4ELY C;  3X26 B;  2V8I A;  4HA8 A;  2CS7 A;  1BI1 A;  2P4T A;  1YJ9 A;  2M1H A;  5FRN A;  3VKI A;  2VV5 A;  1N8R C;  2JVV A;  4BD3 A;  2Y4X A;  2VYT A;  1BI0 A;  1QVF S;  4BDZ A;  5DY9 A;  3QUI A;  2JZ2 A;  5A0D A;  4X34 A;  4M7D D;  1VIF A;  3CC4 T;  2XI9 A;  2ZPF B;  5GAN 2;  1QVG A;  4E47 A;  4ELZ C;  2XIC A;  2P0Q A;  4BAC A;  1X6O A;  5FU6 C;  4PLI A;  4C0D C;  3PTA A;  4IUU A;  2OTL T;  3DLL A;  4ZGD B;  3JB9 I;  4EDU A;  5GAM e;  5FRM A;  4M7D B;  4LDV A;  5LJ3 j;  4J5Y A;  4HCZ A;  2K3Y A;  5LJ3 g;  1M1K C;  4M7D A;  3V8J A;  3CPW S;  4M7A A;  1O9S A;  2FYK A;  3NTI A;  3CBP A;  4XU2 A;  1YJN T;  5DM7 R;  1NJI C;  3CCE A;  5FLX E;  2HNI A;  1ZQ1 A;  1VQK T;  1VQO A;  4F7U B;  4M75 G;  1VQL A;  4JRI A;  1JRI A;  3H6Z A;  1I5L A;  1UGS B;  2MF2 A;  2QDY B;  2DVE A;  3HHT B;  3TCJ A;  5A2Q E;  4DA4 A;  3ASK A;  5GAO r;  1WPY A;  4R56 A;  3OW2 S;  3CCJ A;  1WJS A;  3OBW A;  1P92 A;  1BI3 A;  4J6X A;  4J6Y A;  2A7Y A;  4RG8 A;  5LJ5 e;  1KC8 U;  1BI2 A;  2KSS A;  3G71 T;  1O75 A;  3M57 A;  3VUB A;  2OTJ A;  4DOV A;  2GFU A;  2X4J A;  2O01 E;  1OZ3 A;  1N8R U;  3LLR A;  3CCS A;  2AHJ B;  5GAN h;  2LC4 A;  3BW1 A;  3MP6 A;  5M9O A;  1VQ5 T;  3JCM f;  3SWN C;  1VQP T;  2PUO B;  3CEY A;  3NTH A;  3M54 A;  2F5K A;  2XHC A;  5LJ5 d;  1S72 A;  1Q81 C;  2VGN A;  4KT0 E;  3HRS A;  4QQG A;  2DTI A;  3CCR A;  2PVG B;  4XU1 A;  2Y4Y A;  3FDR A;  2K5F A;  1UB4 A;  3BDL A;  4A4G A;  4M7A C;  3FIF A;  3TRE A;  3EFR A;  4MDW A;  4IUP A;  2EJG A;  2R58 A;  2BUD A;  4BI4 A;  2RA2 A;  3OBY A;  5C6S A;  4PJO E;  3HSB A;  1M1K U;  3RIR A;  4UC4 A;  3DB4 A;  4X9C A;  4A54 A;  1H3Z A;  2LCL A;  4M77 C;  4LDY A;  2YHT A;  4E7L A;  1ZBX A;  2E1H A;  1IZ6 A;  1SSF A;  3LW5 E;  3QG1 A;  4RCB A;  2RJF A;  4PKC C;  3OYE A;  4JS5 A;  3I56 A;  4L5G A;  1NE8 A;  3I55 T;  2FHD A;  1VQ6 T;  4RG2 A;  3QII A;  5GAO q;  3A8O B;  2P0K A;  4OB1 B;  4FT2 A;  4A4F A;  2XU8 A;  4L59 A;  3HRU A;  5CAI A;  4N0A A;  2XG8 D;  3JB9 H;  1M9S A;  3VYH B;  3E1S A;  4M78 C;  2K4Y A;  5GAM h;  4O6J A;  3I55 A;  3C95 A;  4EMK B;  2QA4 T;  4C92 C;  2QI2 A;  2OUT A;  3QYH B;  1WJR A;  2X4W A;  2QQS A;  4JRQ A;  2DEQ A;  4M75 B;  3OYA A;  4A4H A;  3JCM b;  2MWO A;  1K9M C;  3V7C A;  4RMO A;  4N4H A;  4MMK A;  2LDM A;  3PNW C;  3L42 A;  2QTX A;  2QA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...