3GWHA

Crystallographic ab initio protein solution far below atomic resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'HSQLMAQLVEVIEDSFQMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLMLLLKNEYPLCYNTAWKLIKILQQTLKKPVHEAEAVYLTLHLIPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional antiterminator (BglG family)
publication title Crystallographic ab initio protein structure solution below atomic resolution
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gwhA02
1.20.890.100 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3gwhA01
3UFEA 3GWHA
chains in the Genus database with same CATH superfamily
2NTYA 2OUTA 2V8SV 1MMAA 4ZI2C 2KNGA 3RIAA 4HFVA 4JI5T 3JC6D 4YSXA 2A2FX 3KFWX 4CQIA 2XM2A 2DRNA 2QGSA 4O4JE 3AA1B 1E7PA 3LDQB 3I9YA 4EAHA 4DIDB 4ZI3D 2UUCT 3RQWA 4YHHT 4IL9A 5F8PA 4DR6T 3UUXB 1D0XA 1VRBA 1QLBA 1D1BA 2I15A 5JDMA 3A7MA 2KMFA 2SPCA 5FY1A 1YKEB 4B3MT 4ZZBA 5HXRA 2RPAA 4TX5A 3ONXA 1WYBA 5FNVE 4BJNA 3RPUA 4PFOA 2ODVA 3AA6B 3P4PA 3VU7H 1N36T 2ACZA 1KF6A 3PV0F 5HCMA 4U31A 1Y64B 1IBLT 5L4HA 1N34T 2E9XB 1O3XA 4TWDA 3X1DA 1MMDA 1IZNB 3QFZA 4UF0B 2LSKA 2X0HA 5TAOA 3GA8A 4RIQA 2K3WA 1HX1B 3HL6A 1LKXA 5HCJA 3ZT6A 4CXXA 2LRLA 2BS2A 4B3TT 3CWZB 1JNZA 3A5XA 2VKDA 3NZQA 4J2CA 1CUNA 1X9BA 2LSYA 4I43B 1IAPA 4YTPA 3AEEA 3ABVA 2WS3A 4IT4A 4UEMA 5LP6E 3O4XE 4LFAT 3HKBE 4TNWA 2LOPA 3RYFE 2BBHA 3ZYKA 4U2ZA 3C98B 5LBQB 3R6NA 4OYKA 5E0OA 2W2UA 2BZBA 2C0SA 2VL8A 4NXNT 1OWAA 5AQFB 2X9XA 3ZSSA 3WAKA 4YJ3E 4H9PC 2UXCT 2AXDS 1JNRA 3PTRB 5EK2A 1KNZA 4DV5T 5AFUL 2YINA 3LJCA 3K1SA 4LF9T 4YFSA 4XZCA 4RT4A 2CB9A 3BQLA 3EDUA 1UCUA 3G06A 2BKOA 3N9NA 3I0OA 2L8KA 1T8BA 3VR9A 3AEDA 2ODUA 5JDNA 4DUYT 3VRAA 3T8OA 2UXDT 3N5LA 3JC6C 2WP9A 5HXEA 1MIVA 1W0AA 3ZC1A 3MK7C 2KT9A 2LT3A 4E7ZA 3AE9A 1SE7A 2XQ9A 5AQQB 2X68A 3AE5A 4NUUA 2MTQA 3EHZA 3E08A 4ZI3C 3FZFB 2YU2A 3CIRA 5EK4A 2IDOB 2LM9A 1IBMT 3NBXX 2DWGA 2BS4A 3OBVE 5FXZA 3BQIA 2V6YB 2HN1A 5DQVA 1H7CA 2C5IT 5A1LA 5FKYA 2ZLYA 1Z0PA 2E9XD 5ETWA 4NPPA 3L3PA 2NR4A 4DV3T 3CPZA 5J0ZA 3QC9A 4MBQA 4F9KA 5HAXA 2BG9C 4HWFA 4HGAA 3MACA 3AA0B 1OXZA 4WBNE 4JI3T 2XQYA 4HFDA 2WDVA 3ESLA 4C90A 2M67A 4DR3T 3IM3A 4QX8B 2MPKA 5CA1E 3PUYF 2JMHA 4OX9T 3QDEA 2A72A 2CBJA 3AE1A 5HXCA 2CXFA 3RQUA 4JI4T 2VVSA 3OYXA 2DI4A 1WR6A 5M4YA 4EYYR 3KV5A 5JH7E 2H88A 4U7YA 5C2TA 2XASB 2X51A 3VHLA 3ZMUB 3OTOT 4JBWF 2WMOA 4AKHA 5LGTB 2XY8B 2CBGA 1SUMB 5C8YE 2WAUA 1HG5A 1LVFA 3PUSA 2BDEA 4QWNB 5LGNB 2AE9A 1MNEA 3CK6A 3RRSA 4JUYA 2YDRA 4X5TA 2NW7A 4I4TE 4TUYE 3L09A 5ABEA 3ANWB 3ZMTB 4LMLA 4IDNA 3KV9A 4HE8A 3P4QA 4EZHA 1U4QA 3AE8A 3ETUA 2WMNA 3CX8B 3NKZA 1V9DA 1R8IA 2FJBA 4QXBB 3ZC0A 1XDOA 4ERRA 3RRWA 4UV8B 5LGUB 1HX8A 2XQ8A 2MYSA 5L3BB 1WR0A 4IREA 4FJOA 5FY0A 4GYRA 2G0UA 2D0TA 1YQ4A 2BG9A 5HEHA 2IZYA 2BVMA 3U78A 3DJBA 1I6ZA 3O1JA 4DMVA 4H63V 4GOUA 5HEOA 2H3RA 3Q9DA 2X9WA 3OYZA 2CLYB 5KDMC 1NENA 3RC8A 3CMLA 2YOEA 3FXEB 4LF5T 4XBFB 2FBWA 5LG3A 4HWHA 4DO0A 3LSVA 3OVUA 2KSRA 2XAGB 4TNVA 2VKOA 1HNZT 5LOVE 2CBIA 5DQWA 5AQTB 4ANJA 3QFYA 2ZMAA 3ETVA 3IHRA 5FXVA 2XAFB 2WWUA 3EI0A 2A3DA 1FMVA 2E9XC 4LF8T 4K0UA 3PURA 2VL0A 4KBMB 3RRCA 4EB6E 3AE6A 2CXLA 4AKGA 1XMOT 5LB7B 3HKCE 2LKGA 2J62A 3J9X1 1E1HB 1BR1A 2KYGA 3UTKA 4HWCA 5AQSB 5LG4A 2DL1A 4X1KE 3PMIA 3C64A 1XMQT 2YU1A 4ASKA 1AJ3A 3CQCB 5FP3A 1W0BA 2V1DB 4CI1B 2X9YA 2UXNB 4ILUA 4GIWA 1IJ6A 3ONJA 1LRZA 2J47A 3I0QA 5FL1A 5FY7A 1BR2A 3JAEA 5L3FB 1HFAA 4I0UA 2LKHA 2WU2A 2W0GA 4PK4A 4EXTA 4GK5E 5JDFA 1WYCA 2WCAA 2XJ7A 5FMNA 3N9QA 2JPFA 2PFVA 2VB6A 1W09A 1D0ZA 2XAJB 2QVAA 4Z91A 2FJDA 3CQXC 4H9RC 3UU4A 2KLQA 3JAFA 5GONE 2VK9A 1DU2A 2D9DA 3RI5A 4UXNB 2XM1A 3ZYLA 4EOZB 4TN7B 1IBKT 2V5DA 2IW5B 3UU6A 2WDRA 2V7JA 4I50E 4U2YA 2CWYA 1UUSA 3SFEA 2NW8A 4K0KT 3UU8A 3Q5XA 2WB5A 5LJMA 4QH5A 2E9XA 4UVCB 3NVOA 2JQHA 2IIUA 4UIGA 3KBUA 2BVLA 4UF0A 3A8YC 1WLXA 2L3LA 1D1AA 2W67A 3U3IA 5JDLA 2ZM6T 2FUPA 3ZT7A 2BS3A 2KNDA 4L0RA 4HN9A 3K3QC 3P4WA 4DV6T 2BKNA 4LF6T 5IHYA 2JQQA 5HEJA 4O2AE 4X20E 2HHHT 3ZCJA 3JADA 4IDQA 5HWYA 2XTLA 1LVKA 4DR7T 2LRKA 2IC6A 3UFEA 5JVDE 4LF7T 2JJ9A 3HKDE 2BG9E 3Q2MA 4KX6A 4HFHA 3LBXB 1MIYA 4UV9B 4DV2T 4WYVA 2WY2A 4ZI7E 3CKDA 3AE2A 5LHHB 4KHPT 3ZLIA 1I94T 3FZHB 2LSIA 4QX7B 4QH1A 2FJAA 2ZM2A 4IL4A 3IBPA 3ZYMA 2IUBA 4X64T 4IDPA 3RYIE 2WM9A 4Z90A 3N9PA 2CHOA 2NTXA 1YKHB 2E2AA 5FL0A 2K9AA 3TLSA 3TKLB 4TWHA 2V7MA 2J1DG 1D0YA 2J4GA 2NP9A 3Q5DA 5LJNA 4E7SA 4HTEA 4BAYB 3QOFA 3HA4A 1UGOA 2LHRA 1U5PA 4ISSA 1J1JA 2PTFA 4AQFC 2MOZA 4IE7A 4NUVA 3PU3A 4JI8T 5AQMB 4TWFA 2YN6A 4DV4T 2LHNA 3P4RA 2NOXA 4U33A 2WDQA 2XUEA 3S4DA 3PUGA 1KK7A 4JV5T 2V6YA 2QYWA 4ADZA 5JREA 4X1YE 3F31A 5J2TE 4YHJA 5HYAA 2Z6EA 5HXHA 5KXJA 5IWAT 4UVBB 2EHOD 4CN6A 1ZEEA 4PW8A 4PNIA 4JLEA 4N78D 3MKDA 3RSYA 4BJMA 2CLYC 4PAGA 5L47A 3VR8A 3JCFA 3IF8B 5DJQC 3MZKB 3O1HA 3EVYA 4YSYA 3MXZA 2HH7A 2H7VC 2XPKA 5AQHB 2D5UA 1YQ3A 1UK5A 4PJMA 3BQKA 1QUUA 4EZ4A 2XQ3A 3H37A 2CMRA 3DP7A 5LYJE 2K5BB 3ZSTA 1S35A 3N9MA 3UULA 3AAIA 2VURA 4OFZA 5LA6E 1VCTA 1WFDA 5ABFB 3RC3A 5FVKA 4EIWA 4ZZCA 5L3DB 2B1EA 2XSAA 4KUMB 3NWIA 2PG8A 3B57A 4B6XA 3ZEFB 1ZHCA 1UX4A 4ZS2A 2WSSV 3H3AA 4IDOA 4PK5A 4AISA 5KX5E 3CX6B 4AQFA 4MHCA 4BA9A 2CQSA 4JI2T 2C5KT 3ANWA 3O9XA 2X9HA 4B3ST 3SWHA 3UU5A 5ABHA 4X66T 1VCSA 4KMCA 2MBGA 1ZV4X 4GKKT 3RH3A 3J7Yq 1XNRT 5HVZA 5L2LA 2X0LB 1IJ5A 3L8RA 4DV1T 2HPLA 5FXXA 2XHEB 1HG2A 4YY3T 5BMVE 3RKOA 3HR0A 5FVLA 4HFCA 4TZ4C 2CE7A 1HNWT 2XSBA 4ZEYA 2GK9A 1UURA 3C51A 3EAMA 4TV9E 3AEFA 4IE6A 5AQUB 3RYCE 2KWIB 3EUHA 4ZHQE 5L4EA 4X1IE 1KNRA 3AA7B 3E0ZA 2KZ7B 2Q9QD 2Y8DA 4JI7T 3SRZA 2V6XA 5H6RB 3ZPOA 3GWHA 3IA3A 3PUVF 3M65A 2K9QA 2CHNA 2MAWA 2LM2A 3FB2A 5EK3A 1X79A 2YDSA 2M6BA 2V7IA 1ZKEA 5JDHA 3VKHA 3FBLA 4QHOA 3NRYA 3AAEB 5H6QB 5AQJB 3K8PC 4OK0A 3EDVA 2F4VT 5FYMA 1MIWA 4AIUA 1OEDC 2CQTA 4JYAT 1Y01A 3KV4A 1M7KA 4WBOA 5AQOB 3FZLB 2BKPA 1GQEA 1YW0A 1XNQT 5J2UE 5JQGE 2ZM8A 3K3OA 2VKHA 5ADXL 3WI3A 3N9LA 3P4SA 4H9OC 3RGLA 2EHOC 1G73A 4IE4A 1MMGA 2LE8A 3IEEA 2OLTA 1MMNA 4QKNA 2K48A 2VQFT 3UFGA 3MA9A 5AQVB 3OJAA 3RHWA 3CVRA 5HWXA 3AXJB 1FMWA 1T72A 4KHZF 5JR9B 4ILBA 4JI1T 1ZOYA 4MALA 4M1PA 5L3CB 1XWMA 3DTOA 5JRCB 3FBZA 4KP3C 4XAXB 2DHRA 1HCIA 1MNDA 1Z8UA 5LMNT 4V1Av 4JEHB 5LXTE 4WNKA 3H3MA 2DCFA 4WZXA 4P0AA 5LNKA 3ONLC 4L9IA 2LEHA 2ZM0A 3FZKB 5L3GB 5ABGA 3L39A 4AI6A 2CM0A 4PFPA 3GN5B 4EEBA 3ZT5A 2UXBT 3D0TA 5EZYE 4PK6A 4CI3B 4TV8E 2YEVC 3QUJA 2X67A 2CEAA 3QG0A 4H9NC 4OHFA 1XDPA 1OEDA 2YDQA 3AECA 2E5VA 1HTJF 1KEYA 4GKJT 4H63H 2RP4A 1T98A 4NXMT 3SS1A 1SHZC 2RA1A 3T1HT 1OEDB 4AXPA 4P09A 2N9DA 4U3CA 3UU3A 5AQKB 2EHOA 3QB5A 4UR9A 3P50A 4P1NA 1N32T 4AQYT 4CXYA 3LK2B 2JQKA 3AVRA 2Q9QC 5IYZE 3AB3B 4DR4T 1VOMA 4WW0A 2W4XA 4LFCT 4YXDA 2V5CA 3F2EA 2EHOB 4O4LE 2HN2A 2V7LA 5CFBA 2LJLA 3VRBA 3M3ZB 3LFMA 1ZP0A 1SA0E 3HKEE 4YJ2E 4IHJE 5CJ5A 3AEAA 3VKGA 4COFA 4HFEA 2N2NA 1YXRA 2W61A 4A5XA 2LSJA 4HFIA 3LBXA 3N2GE 2PBIA 2XAHB 3QK6A 3ZJ1A 4A98A 3S4BA 4IDZA 3ZJ2A 4NIQA 4GYSA 4ZS3A 5JTGA 4UVAB 5DABA 2UU9T 2LSGA 3PUQA 1D1CA 4CN4A 1QSDA 3GMIA 2DWKA 3CQGB 4CZZB 5AQLB 3ACTA 3C4WA 3RF1A 4QH4A 5LHIB 3N9OA 3QB5K 2VASA 2HPJA 2CA5A 2W00A 2XQ4A 5HEGA 3TLVA 1L0VA 2N1GA 1US7B 1R2AA 1N33T 3SFDA 1YD8G 2WQYA 3ZMSB 2NWBA 1BR0A 4U74A 2Y6XA 5CB4E 4JI6T 4MFRA 4H9QC 2JMKA 4X62T 2VWAA 5LHGB 2CRBA 3B5MA 4ILAA 2X0YA 5LMUT 3TLTA 2H7OA 3O1IA 3PUXF 3OKQA 5KMGP 1M62A 3R84B 2Q9QA 4PJNA 2X66A 1UX5A 1KFYA 5AQGB 4P0BA 3RIFA 2XQ6A 1NEKA 5F5WA 1CHUA 4O4HE 3T1YT 4HWIB 3ZN0B 2E5LT 3UQ4A 3MJXA 2Q9QB 2XQAA 4YTNA 5HXSA 2I59A 4LMJA 3AE3A 2W62A 5L3EB 4QXHB 2JQ9A 5JDGA 4U72A 3KVBA 2ES0A 2E8IA 3EABA 2WWVA 2JRKA 3I1AA 3KBTA 2UXXB 4KI0F 4DBRA 4HWDA 4IIJE 2R6GF 4F8HA 2KWHA 3PUZF 5AQNB 3ZCIA 4HKAA 4B3RT 4DMWA 3ZMZB 2KXPB 5CGMA 3V5UA 2ACXA 4DBQA 2P9BA 4YT0A 1B7TA 3C50A 3CX7B 2BBJA 2WZHA 5JDQA 4DR5T 3RKGA 2V26A 4EGWA 2XAQB 3WAJA 4ZP3A 4EV6A 3SOLA 2VQET 2CCQA 3P8CD 5LBMA 3AFJA 5ABFA 1OEDE 4PJJA 2WBLA 3NZPA 3KDSE 3AAAB 2D0UA 2QRXA 3V5SA 2JIWA 2W63A 2W66A 2CXDA 3S4UA 1S94A 3UQ7A 1J5WA 1HS7A 2UUBT 3LK42 2WZIA 4JEUB 5AQPB 3UT5E 4IE5A 2XZEA 4FI5A 3PDYA 5JR9C 5LCYA 2XQ7A 1W9RA 4ZOLE 2OV9A 2LLYA 2CPTA 4ZI2D 4DV0T 4CN1A 3FHNA 5CA0E 3FXDB 3C4XA 2PJQA 3PJAJ 5IUXA 3RLFF 1FIOA 4LFBT 2I6HA 4YLHA 3G36A 4CI2B 3RIUC 3W15B 3ZKRA 2A9UA 2I0MA 2WU5A 4DUZT 4AKIA 3NRXA 2H89A 1NWMX 2LOSA 1FJGT 4LF4T 2D2SA 5AQIB 3HI2A 3QNUA 3TLWA 1L6EA 1E2AA 1WRDA 4LMKA 4H9SE 3ZN1B 4YTMA 4O2BE 2QA7A 4CXWA 2OA5A 3K3NA 4IGUA 3I9WA 1BR4A 1XZYA 3BK9A 5FXWA 3UUMA 3KVAA 5F3JA 3Q5EA 4A56A 2EZWA 1J5ET 2VVNA 4DNDA 3S4AA 2KINB 3KV6A 5J1GA 2C5JA 4IE0A 3TLUA 4ILCA 3AE7A 4ZXLA 4O8SA 2B76A 2RQYA 3FZMB 2IHR1 1FEWA 3ZMVB 2BG9B 4PJLA 5C3JA 4L5GA 1EZ3A 2V7KA 3S4CA 2Y48B 4O4IE 2IMLA 4EYUA 4HFBA 3KINB 4Q25A 4ISTA 3RX6A 2DLRA 4HEAA 4AKLA 2YK0A 3AXJA 4G2AA 3C4ZA 4G63A 5JR9A 3UUNA 4UELA 4DR2T 4MLKA 3AVSA 2DNXA 1HR0T 3Q5WA 2IC9A 3PE0A 3OPCA 5JRCA 3AEGA 2UUAT 3LK3B 4QXCB 4U7IA 2YKSA 3ACSA 3AE4A 3RYHE 2M6IA 4C91A 4RTAA 4X65T 4OYJA 5HEUA 3PJAA 3RIUA 1WCRA 3PUAA 3P7IA 1HNXT 2H9RA 4Z8XA 4YSZA 4A97A 2IAKA 2XQ5A 4F6RC 3E22E 1HF8A 1G8XA 2K24A 3LG7A 2NW9A 5BR8T 3AEBA 4GK0E 1T7SA 3GN5A 4DVDA 4I55E 1KNPA 2VKJA 5AQRB 4JI0T 4DV7T 3IM4A 3B13A 3N2OA 3F57A 3N2KE 4EEDA 4AKRB 4AQGA 3PU8A 2CWOA 3PUWF 2FJEA 2L9QA 4DR1T 3UUBA 1NAFA
chains in the Genus database with same CATH topology
3IF8B 3DJBA 2NTYA 5DJQC 2OUTA 5LHIB 3N9OA 3MZKB 2VASA 1MMAA 4ZI2C 3O1JA 2KNGA 4HFVA 2HPJA 3JC6D 3O1HA 4DMVA 2CA5A 2W00A 2A2FX 4H63V 4GOUA 3EVYA 2H3RA 3KFWX 3Q9DA 2X9WA 3OYZA 2N1GA 4CQIA 2CLYB 5KDMC 2QGSA 3MXZA 4O4JE 2HH7A 2H7VC 1US7B 3RC8A 3CMLA 3AA1B 3I9YA 2D5UA 1YD8G 3FXEB 3ZMSB 4EAHA 2NWBA 4PJMA 4ZI3D 3BQKA 1QUUA 4EZ4A 4XBFB 1BR0A 3H37A 2Y6XA 2CMRA 4U74A 3DP7A 5CB4E 5LYJE 2K5BB 4MFRA 4H9QC 2JMKA 1S35A 2VWAA 3N9MA 3UULA 3AAIA 4DO0A 5F8PA 5LHGB 3UUXB 1D0XA 4OFZA 5LA6E 1VRBA 3RC3A 2XAGB 1D1BA 2VKOA 4EIWA 5JDMA 5LOVE 2KMFA 2H7OA 3O1IA 5L3DB 2B1EA 5DQWA 3OKQA 4ANJA 5KMGP 3R84B 2ZMAA 2Q9QA 3ETVA 3IHRA 4PJNA 2SPCA 4KUMB 5FXVA 2X66A 1UX5A 2PG8A 5FY1A 1YKEB 2XAFB 3B57A 4P0BA 4B6XA 2WWUA 1ZHCA 3ZEFB 1UX4A 4ZS2A 2WSSV 2A3DA 3H3AA 4PK5A 1FMVA 2E9XC 5KX5E 3CX6B 4K0UA 4O4HE 4AQFA 4MHCA 4BA9A 5HXRA 3PURA 3ZN0B 4TX5A 3ONXA 4KBMB 1WYBA 3RRCA 2C5KT 3ANWA 5FNVE 4BJNA 2X9HA 4EB6E 3O9XA 2CXLA 3RPUA 3SWHA 4PFOA 3MJXA 2Q9QB 2ODVA 3AA6B 5HXSA 2I59A 3VU7H 4AKGA 4KMCA 2W62A 3HKCE 5L3EB 4QXHB 2MBGA 1ZV4X 1Y64B 3J9X1 3RH3A 4U72A 5JDGA 3J7Yq 1E1HB 1BR1A 5L2LA 2E9XB 2X0LB 3KVBA 1O3XA 1IJ5A 3UTKA 2ES0A 2E8IA 2HPLA 5FXXA 2XHEB 5LG4A 1HG2A 4X1KE 5BMVE 3RKOA 1MMDA 3PMIA 1IZNB 3C64A 2YU1A 3HR0A 2JRKA 4UF0B 2LSKA 3I1AA 3KBTA 2UXXB 4ASKA 1AJ3A 4DBRA 4TZ4C 5TAOA 2CE7A 3GA8A 4IIJE 2KWHA 3HL6A 3CQCB 2GK9A 1LKXA 3C51A 4TV9E 3ZCIA 4IE6A 5FP3A 2V1DB 4CXXA 4HKAA 4CI1B 2X9YA 3RYCE 2KWIB 3EUHA 4ZHQE 4DMWA 2UXNB 4ILUA 4GIWA 3ZMZB 1IJ6A 3CWZB 2KXPB 4X1IE 3V5UA 2ACXA 3U78A 1LRZA 3A5XA 2VKDA 3NZQA 4DBQA 2P9BA 4J2CA 3AA7B 3E0ZA 1CUNA 2KZ7B 2Q9QD 2Y8DA 3I0QA 1B7TA 3C50A 2LSYA 4I43B 1IAPA 5FY7A 1BR2A 3CX7B 3SRZA 5L3FB 1HFAA 5H6RB 5JDQA 4UEMA 5LP6E 2W0GA 4PK4A 4EXTA 4GK5E 5JDFA 3O4XE 3ZPOA 1WYCA 3GWHA 2V26A 3HKBE 5FMNA 2XAQB 2LOPA 3RYFE 3M65A 3WAJA 3N9QA 3ZYKA 2K9QA 3SOLA 2JPFA 2PFVA 2VB6A 3FB2A 5EK3A 1X79A 2V7IA 3C98B 2CCQA 3P8CD 1ZKEA 5LBQB 5JDHA 5LBMA 3R6NA 3VKHA 4OYKA 5E0OA 1D0ZA 2XAJB 3FBLA 4QHOA 3NRYA 4PJJA 2BZBA 2C0SA 2VL8A 2WBLA 3CQXC 3AAEB 1OWAA 4H9RC 3NZPA 5H6QB 2KLQA 3K8PC 4OK0A 3EDVA 5FYMA 1MIWA 2X9XA 3KDSE 5GONE 2VK9A 3KV4A 3AAAB 4UXNB 4WBOA 3WAKA 4YJ3E 3ZYLA 2D0UA 4H9PC 3V5SA 4EOZB 2W63A 3PTRB 4TN7B 5EK2A 2IW5B 1KNZA 2CXDA 3S4UA 5AFUL 2V7JA 2YINA 1YW0A 3LJCA 1S94A 5J2UE 5JQGE 2ZM8A 3K3OA 1HS7A 2VKHA 4I50E 5ADXL 4YFSA 3WI3A 3N9LA 2CWYA 2NW8A 3LK42 4JEUB 4H9OC 4XZCA 2EHOC 3UT5E 4IE5A 3Q5XA 1G73A 4FI5A 2CB9A 3PDYA 5LJMA 4IE4A 5JR9C 2E9XA 3BQLA 1MMGA 3EDUA 2LE8A 5LCYA 4UVCB 1UCUA 3IEEA 1MMNA 4UIGA 4ZOLE 4QKNA 3KBUA 2K48A 3N9NA 2BVLA 3I0OA 2L8KA 4UF0A 4ZI2D 3MA9A 1WLXA 3OJAA 3CVRA 2L3LA 3FHNA 1D1AA 5HWXA 2ODUA 5CA0E 5JDNA 3U3IA 3FXDB 3C4XA 5JDLA 1FMWA 2PJQA 5JR9B 3T8OA 3N5LA 1FIOA 3JC6C 2KNDA 4L0RA 4HN9A 4YLHA 5HXEA 3K3QC 1MIVA 3ZC1A 4CI2B 4MALA 4M1PA 3MK7C 3W15B 2KT9A 2LT3A 4E7ZA 5L3CB 3DTOA 5JRCB 4AKIA 3FBZA 4KP3C 4XAXB 2X68A 4NUUA 2DHRA 3NRXA 5IHYA 2JQQA 2MTQA 4O2AE 4X20E 1HCIA 1MNDA 3E08A 4ZI3C 1NWMX 2LOSA 4V1Av 3ZCJA 4JEHB 2YU2A 5LXTE 5EK4A 4WNKA 2D2SA 3HI2A 2DCFA 5HWYA 2XTLA 1LVKA 1WRDA 2LM9A 4P0AA 3NBXX 5LNKA 2DWGA 3OBVE 5FXZA 4H9SE 3BQIA 3ZN1B 4O2BE 4L9IA 2QA7A 2LEHA 5DQVA 2IC6A 1H7CA 2C5IT 2OA5A 3K3NA 4IGUA 3UFEA 3I9WA 5JVDE 4CXWA 1BR4A 5A1LA 2ZLYA 1Z0PA 2JJ9A 2E9XD 3HKDE 3BK9A 5FXWA 5ETWA 3L3PA 3UUMA 2ZM0A 3KVAA 5F3JA 5L3GB 3Q2MA 4AI6A 3LBXB 4A56A 3CPZA 2CM0A 1MIYA 3QC9A 3GN5B 4MBQA 4PFPA 4UV9B 5HAXA 3D0TA 4DNDA 5EZYE 4PK6A 4CI3B 2KINB 3KV6A 5J1GA 4TV8E 4ZI7E 2C5JA 4HGAA 4IE0A 3CKDA 3MACA 2YEVC 3AA0B 3QUJA 5LHHB 2X67A 1OXZA 4WBNE 2CEAA 2XQYA 4O8SA 3ESLA 2RQYA 4H9NC 3ZLIA 4OHFA 4C90A 2M67A 2LSIA 1FEWA 4QX7B 2ZM2A 3ZMVB 4QX8B 3IBPA 4PJLA 3ZYMA 5CA1E 1HTJF 4L5GA 1EZ3A 2V7KA 3RYIE 2WM9A 2JMHA 4H63H 3N9PA 2Y48B 2A72A 4O4IE 2RP4A 1T98A 5HXCA 4EYUA 2CXFA 2NTXA 1YKHB 3SS1A 1SHZC 2RA1A 3KINB 2K9AA 3OYXA 2DI4A 4ISTA 1WR6A 3RX6A 3TKLB 2V7MA 2J1DG 5M4YA 2DLRA 4HEAA 4AKLA 4EYYR 4P09A 1D0YA 2N9DA 3KV5A 4AXPA 5JH7E 2YK0A 2NP9A 2EHOA 5LJNA 4E7SA 2XASB 4G2AA 4HTEA 2X51A 3C4ZA 3VHLA 4BAYB 4G63A 5JR9A 3UUNA 3ZMUB 4CXYA 4UELA 3LK2B 2WMOA 3AVRA 2Q9QC 4MLKA 5LGTB 4AKHA 2CBGA 3AVSA 3HA4A 5IYZE 2DNXA 2LHRA 3AB3B 1U5PA 1VOMA 4ISSA 4WW0A 5C8YE 2WAUA 3Q5WA 2IC9A 3PE0A 5JRCA 3F2EA 2EHOB 3LK3B 1HG5A 4QXCB 1LVFA 4O4LE 4AQFC 2MOZA 2V7LA 4IE7A 4NUVA 3PU3A 2LJLA 3RYHE 2LHNA 2BDEA 3PUSA 4C91A 4QWNB 5LGNB 2NOXA 3LFMA 4OYJA 2XUEA 3PUGA 1SA0E 1KK7A 3HKEE 1MNEA 3PUAA 3P7IA 4YJ2E 4JUYA 4Z8XA 4IHJE 2NW7A 4ADZA 3VKGA 4I4TE 5JREA 4TUYE 4X1YE 2IAKA 2N2NA 3L09A 2W61A 3ANWB 4F6RC 3ZMTB 3E22E 3F31A 1HF8A 1G8XA 2K24A 2LSJA 3KV9A 3LG7A 4HE8A 2NW9A 5J2TE 3LBXA 4YHJA 4EZHA 1U4QA 3N2GE 4GK0E 2PBIA 3GN5A 5HYAA 3ETUA 2WMNA 2XAHB 3CX8B 2Z6EA 3QK6A 4DVDA 3ZJ1A 5HXHA 1V9DA 4UVBB 4I55E 4IDZA 2EHOD 3ZJ2A 4QXBB 2VKJA 3ZC0A 1ZEEA 4ERRA 4PW8A 4GYSA 3RRWA 3B13A 4PNIA 4ZS3A 3N2OA 3F57A 4UV8B 4JLEA 3N2KE 3MKDA 4N78D 4UVAB 5LGUB 5DABA 1HX8A 2MYSA 4AKRB 2LSGA 5L3BB 3PUQA 4AQGA 1D1CA 4BJMA 3PU8A 2CWOA 4FJOA 5FY0A 2CLYC 4GYRA 2G0UA 2D0TA 1QSDA 3GMIA 2L9QA 2DWKA 4PAGA 3CQGB 4CZZB 2BVMA 1NAFA 3C4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFE A;  3GWH A; 
#chains in the Genus database with same CATH topology
 2NTY A;  2OUT A;  2V8S V;  1MMA A;  4ZI2 C;  2KNG A;  3RIA A;  4HFV A;  4JI5 T;  3JC6 D;  4YSX A;  2A2F X;  3KFW X;  4CQI A;  2XM2 A;  2DRN A;  2QGS A;  4O4J E;  3AA1 B;  1E7P A;  3LDQ B;  3I9Y A;  4EAH A;  4DID B;  4ZI3 D;  2UUC T;  3RQW A;  4YHH T;  4IL9 A;  5F8P A;  4DR6 T;  3UUX B;  1D0X A;  1VRB A;  1QLB A;  1D1B A;  2I15 A;  5JDM A;  3A7M A;  2KMF A;  2SPC A;  5FY1 A;  1YKE B;  4B3M T;  4ZZB A;  5HXR A;  2RPA A;  4TX5 A;  3ONX A;  1WYB A;  5FNV E;  4BJN A;  3RPU A;  4PFO A;  2ODV A;  3AA6 B;  3P4P A;  3VU7 H;  1N36 T;  2ACZ A;  1KF6 A;  3PV0 F;  5HCM A;  4U31 A;  1Y64 B;  1IBL T;  5L4H A;  1N34 T;  2E9X B;  1O3X A;  4TWD A;  3X1D A;  1MMD A;  1IZN B;  3QFZ A;  4UF0 B;  2LSK A;  2X0H A;  5TAO A;  3GA8 A;  4RIQ A;  2K3W A;  1HX1 B;  3HL6 A;  1LKX A;  5HCJ A;  3ZT6 A;  4CXX A;  2LRL A;  2BS2 A;  4B3T T;  3CWZ B;  1JNZ A;  3A5X A;  2VKD A;  3NZQ A;  4J2C A;  1CUN A;  1X9B A;  2LSY A;  4I43 B;  1IAP A;  4YTP A;  3AEE A;  3ABV A;  2WS3 A;  4IT4 A;  4UEM A;  5LP6 E;  3O4X E;  4LFA T;  3HKB E;  4TNW A;  2LOP A;  3RYF E;  2BBH A;  3ZYK A;  4U2Z A;  3C98 B;  5LBQ B;  3R6N A;  4OYK A;  5E0O A;  2W2U A;  2BZB A;  2C0S A;  2VL8 A;  4NXN T;  1OWA A;  5AQF B;  2X9X A;  3ZSS A;  3WAK A;  4YJ3 E;  4H9P C;  2UXC T;  2AXD S;  1JNR A;  3PTR B;  5EK2 A;  1KNZ A;  4DV5 T;  5AFU L;  2YIN A;  3LJC A;  3K1S A;  4LF9 T;  4YFS A;  4XZC A;  4RT4 A;  2CB9 A;  3BQL A;  3EDU A;  1UCU A;  3G06 A;  2BKO A;  3N9N A;  3I0O A;  2L8K A;  1T8B A;  3VR9 A;  3AED A;  2ODU A;  5JDN A;  4DUY T;  3VRA A;  3T8O A;  2UXD T;  3N5L A;  3JC6 C;  2WP9 A;  5HXE A;  1MIV A;  1W0A A;  3ZC1 A;  3MK7 C;  2KT9 A;  2LT3 A;  4E7Z A;  3AE9 A;  1SE7 A;  2XQ9 A;  5AQQ B;  2X68 A;  3AE5 A;  4NUU A;  2MTQ A;  3EHZ A;  3E08 A;  4ZI3 C;  3FZF B;  2YU2 A;  3CIR A;  5EK4 A;  2IDO B;  2LM9 A;  1IBM T;  3NBX X;  2DWG A;  2BS4 A;  3OBV E;  5FXZ A;  3BQI A;  2V6Y B;  2HN1 A;  5DQV A;  1H7C A;  2C5I T;  5A1L A;  5FKY A;  2ZLY A;  1Z0P A;  2E9X D;  5ETW A;  4NPP A;  3L3P A;  2NR4 A;  4DV3 T;  3CPZ A;  5J0Z A;  3QC9 A;  4MBQ A;  4F9K A;  5HAX A;  2BG9 C;  4HWF A;  4HGA A;  3MAC A;  3AA0 B;  1OXZ A;  4WBN E;  4JI3 T;  2XQY A;  4HFD A;  2WDV A;  3ESL A;  4C90 A;  2M67 A;  4DR3 T;  3IM3 A;  4QX8 B;  2MPK A;  5CA1 E;  3PUY F;  2JMH A;  4OX9 T;  3QDE A;  2A72 A;  2CBJ A;  3AE1 A;  5HXC A;  2CXF A;  3RQU A;  4JI4 T;  2VVS A;  3OYX A;  2DI4 A;  1WR6 A;  5M4Y A;  4EYY R;  3KV5 A;  5JH7 E;  2H88 A;  4U7Y A;  5C2T A;  2XAS B;  2X51 A;  3VHL A;  3ZMU B;  3OTO T;  4JBW F;  2WMO A;  4AKH A;  5LGT B;  2XY8 B;  2CBG A;  1SUM B;  5C8Y E;  2WAU A;  1HG5 A;  1LVF A;  3PUS A;  2BDE A;  4QWN B;  5LGN B;  2AE9 A;  1MNE A;  3CK6 A;  3RRS A;  4JUY A;  2YDR A;  4X5T A;  2NW7 A;  4I4T E;  4TUY E;  3L09 A;  5ABE A;  3ANW B;  3ZMT B;  4LML A;  4IDN A;  3KV9 A;  4HE8 A;  3P4Q A;  4EZH A;  1U4Q A;  3AE8 A;  3ETU A;  2WMN A;  3CX8 B;  3NKZ A;  1V9D A;  1R8I A;  2FJB A;  4QXB B;  3ZC0 A;  1XDO A;  4ERR A;  3RRW A;  4UV8 B;  5LGU B;  1HX8 A;  2XQ8 A;  2MYS A;  5L3B B;  1WR0 A;  4IRE A;  4FJO A;  5FY0 A;  4GYR A;  2G0U A;  2D0T A;  1YQ4 A;  2BG9 A;  5HEH A;  2IZY A;  2BVM A;  3U78 A;  3DJB A;  1I6Z A;  3O1J A;  4DMV A;  4H63 V;  4GOU A;  5HEO A;  2H3R A;  3Q9D A;  2X9W A;  3OYZ A;  2CLY B;  5KDM C;  1NEN A;  3RC8 A;  3CML A;  2YOE A;  3FXE B;  4LF5 T;  4XBF B;  2FBW A;  5LG3 A;  4HWH A;  4DO0 A;  3LSV A;  3OVU A;  2KSR A;  2XAG B;  4TNV A;  2VKO A;  1HNZ T;  5LOV E;  2CBI A;  5DQW A;  5AQT B;  4ANJ A;  3QFY A;  2ZMA A;  3ETV A;  3IHR A;  5FXV A;  2XAF B;  2WWU A;  3EI0 A;  2A3D A;  1FMV A;  2E9X C;  4LF8 T;  4K0U A;  3PUR A;  2VL0 A;  4KBM B;  3RRC A;  4EB6 E;  3AE6 A;  2CXL A;  4AKG A;  1XMO T;  5LB7 B;  3HKC E;  2LKG A;  2J62 A;  3J9X 1;  1E1H B;  1BR1 A;  2KYG A;  3UTK A;  4HWC A;  5AQS B;  5LG4 A;  2DL1 A;  4X1K E;  3PMI A;  3C64 A;  1XMQ T;  2YU1 A;  4ASK A;  1AJ3 A;  3CQC B;  5FP3 A;  1W0B A;  2V1D B;  4CI1 B;  2X9Y A;  2UXN B;  4ILU A;  4GIW A;  1IJ6 A;  3ONJ A;  1LRZ A;  2J47 A;  3I0Q A;  5FL1 A;  5FY7 A;  1BR2 A;  3JAE A;  5L3F B;  1HFA A;  4I0U A;  2LKH A;  2WU2 A;  2W0G A;  4PK4 A;  4EXT A;  4GK5 E;  5JDF A;  1WYC A;  2WCA A;  2XJ7 A;  5FMN A;  3N9Q A;  2JPF A;  2PFV A;  2VB6 A;  1W09 A;  1D0Z A;  2XAJ B;  2QVA A;  4Z91 A;  2FJD A;  3CQX C;  4H9R C;  3UU4 A;  2KLQ A;  3JAF A;  5GON E;  2VK9 A;  1DU2 A;  2D9D A;  3RI5 A;  4UXN B;  2XM1 A;  3ZYL A;  4EOZ B;  4TN7 B;  1IBK T;  2V5D A;  2IW5 B;  3UU6 A;  2WDR A;  2V7J A;  4I50 E;  4U2Y A;  2CWY A;  1UUS A;  3SFE A;  2NW8 A;  4K0K T;  3UU8 A;  3Q5X A;  2WB5 A;  5LJM A;  4QH5 A;  2E9X A;  4UVC B;  3NVO A;  2JQH A;  2IIU A;  4UIG A;  3KBU A;  2BVL A;  4UF0 A;  3A8Y C;  1WLX A;  2L3L A;  1D1A A;  2W67 A;  3U3I A;  5JDL A;  2ZM6 T;  2FUP A;  3ZT7 A;  2BS3 A;  2KND A;  4L0R A;  4HN9 A;  3K3Q C;  3P4W A;  4DV6 T;  2BKN A;  4LF6 T;  5IHY A;  2JQQ A;  5HEJ A;  4O2A E;  4X20 E;  2HHH T;  3ZCJ A;  3JAD A;  4IDQ A;  5HWY A;  2XTL A;  1LVK A;  4DR7 T;  2LRK A;  2IC6 A;  3UFE A;  5JVD E;  4LF7 T;  2JJ9 A;  3HKD E;  2BG9 E;  3Q2M A;  4KX6 A;  4HFH A;  3LBX B;  1MIY A;  4UV9 B;  4DV2 T;  4WYV A;  2WY2 A;  4ZI7 E;  3CKD A;  3AE2 A;  5LHH B;  4KHP T;  3ZLI A;  1I94 T;  3FZH B;  2LSI A;  4QX7 B;  4QH1 A;  2FJA A;  2ZM2 A;  4IL4 A;  3IBP A;  3ZYM A;  2IUB A;  4X64 T;  4IDP A;  3RYI E;  2WM9 A;  4Z90 A;  3N9P A;  2CHO A;  2NTX A;  1YKH B;  2E2A A;  5FL0 A;  2K9A A;  3TLS A;  3TKL B;  4TWH A;  2V7M A;  2J1D G;  1D0Y A;  2J4G A;  2NP9 A;  3Q5D A;  5LJN A;  4E7S A;  4HTE A;  4BAY B;  3QOF A;  3HA4 A;  1UGO A;  2LHR A;  1U5P A;  4ISS A;  1J1J A;  2PTF A;  4AQF C;  2MOZ A;  4IE7 A;  4NUV A;  3PU3 A;  4JI8 T;  5AQM B;  4TWF A;  2YN6 A;  4DV4 T;  2LHN A;  3P4R A;  2NOX A;  4U33 A;  2WDQ A;  2XUE A;  3S4D A;  3PUG A;  1KK7 A;  4JV5 T;  2V6Y A;  2QYW A;  4ADZ A;  5JRE A;  4X1Y E;  3F31 A;  5J2T E;  4YHJ A;  5HYA A;  2Z6E A;  5HXH A;  5KXJ A;  5IWA T;  4UVB B;  2EHO D;  4CN6 A;  1ZEE A;  4PW8 A;  4PNI A;  4JLE A;  4N78 D;  3MKD A;  3RSY A;  4BJM A;  2CLY C;  4PAG A;  5L47 A;  3VR8 A;  3JCF A;  3IF8 B;  5DJQ C;  3MZK B;  3O1H A;  3EVY A;  4YSY A;  3MXZ A;  2HH7 A;  2H7V C;  2XPK A;  5AQH B;  2D5U A;  1YQ3 A;  1UK5 A;  4PJM A;  3BQK A;  1QUU A;  4EZ4 A;  2XQ3 A;  3H37 A;  2CMR A;  3DP7 A;  5LYJ E;  2K5B B;  3ZST A;  1S35 A;  3N9M A;  3UUL A;  3AAI A;  2VUR A;  4OFZ A;  5LA6 E;  1VCT A;  1WFD A;  5ABF B;  3RC3 A;  5FVK A;  4EIW A;  4ZZC A;  5L3D B;  2B1E A;  2XSA A;  4KUM B;  3NWI A;  2PG8 A;  3B57 A;  4B6X A;  3ZEF B;  1ZHC A;  1UX4 A;  4ZS2 A;  2WSS V;  3H3A A;  4IDO A;  4PK5 A;  4AIS A;  5KX5 E;  3CX6 B;  4AQF A;  4MHC A;  4BA9 A;  2CQS A;  4JI2 T;  2C5K T;  3ANW A;  3O9X A;  2X9H A;  4B3S T;  3SWH A;  3UU5 A;  5ABH A;  4X66 T;  1VCS A;  4KMC A;  2MBG A;  1ZV4 X;  4GKK T;  3RH3 A;  3J7Y q;  1XNR T;  5HVZ A;  5L2L A;  2X0L B;  1IJ5 A;  3L8R A;  4DV1 T;  2HPL A;  5FXX A;  2XHE B;  1HG2 A;  4YY3 T;  5BMV E;  3RKO A;  3HR0 A;  5FVL A;  4HFC A;  4TZ4 C;  2CE7 A;  1HNW T;  2XSB A;  4ZEY A;  2GK9 A;  1UUR A;  3C51 A;  3EAM A;  4TV9 E;  3AEF A;  4IE6 A;  5AQU B;  3RYC E;  2KWI B;  3EUH A;  4ZHQ E;  5L4E A;  4X1I E;  1KNR A;  3AA7 B;  3E0Z A;  2KZ7 B;  2Q9Q D;  2Y8D A;  4JI7 T;  3SRZ A;  2V6X A;  5H6R B;  3ZPO A;  3GWH A;  3IA3 A;  3PUV F;  3M65 A;  2K9Q A;  2CHN A;  2MAW A;  2LM2 A;  3FB2 A;  5EK3 A;  1X79 A;  2YDS A;  2M6B A;  2V7I A;  1ZKE A;  5JDH A;  3VKH A;  3FBL A;  4QHO A;  3NRY A;  3AAE B;  5H6Q B;  5AQJ B;  3K8P C;  4OK0 A;  3EDV A;  2F4V T;  5FYM A;  1MIW A;  4AIU A;  1OED C;  2CQT A;  4JYA T;  1Y01 A;  3KV4 A;  1M7K A;  4WBO A;  5AQO B;  3FZL B;  2BKP A;  1GQE A;  1YW0 A;  1XNQ T;  5J2U E;  5JQG E;  2ZM8 A;  3K3O A;  2VKH A;  5ADX L;  3WI3 A;  3N9L A;  3P4S A;  4H9O C;  3RGL A;  2EHO C;  1G73 A;  4IE4 A;  1MMG A;  2LE8 A;  3IEE A;  2OLT A;  1MMN A;  4QKN A;  2K48 A;  2VQF T;  3UFG A;  3MA9 A;  5AQV B;  3OJA A;  3RHW A;  3CVR A;  5HWX A;  3AXJ B;  1FMW A;  1T72 A;  4KHZ F;  5JR9 B;  4ILB A;  4JI1 T;  1ZOY A;  4MAL A;  4M1P A;  5L3C B;  1XWM A;  3DTO A;  5JRC B;  3FBZ A;  4KP3 C;  4XAX B;  2DHR A;  1HCI A;  1MND A;  1Z8U A;  5LMN T;  4V1A v;  4JEH B;  5LXT E;  4WNK A;  3H3M A;  2DCF A;  4WZX A;  4P0A A;  5LNK A;  3ONL C;  4L9I A;  2LEH A;  2ZM0 A;  3FZK B;  5L3G B;  5ABG A;  3L39 A;  4AI6 A;  2CM0 A;  4PFP A;  3GN5 B;  4EEB A;  3ZT5 A;  2UXB T;  3D0T A;  5EZY E;  4PK6 A;  4CI3 B;  4TV8 E;  2YEV C;  3QUJ A;  2X67 A;  2CEA A;  3QG0 A;  4H9N C;  4OHF A;  1XDP A;  1OED A;  2YDQ A;  3AEC A;  2E5V A;  1HTJ F;  1KEY A;  4GKJ T;  4H63 H;  2RP4 A;  1T98 A;  4NXM T;  3SS1 A;  1SHZ C;  2RA1 A;  3T1H T;  1OED B;  4AXP A;  4P09 A;  2N9D A;  4U3C A;  3UU3 A;  5AQK B;  2EHO A;  3QB5 A;  4UR9 A;  3P50 A;  4P1N A;  1N32 T;  4AQY T;  4CXY A;  3LK2 B;  2JQK A;  3AVR A;  2Q9Q C;  5IYZ E;  3AB3 B;  4DR4 T;  1VOM A;  4WW0 A;  2W4X A;  4LFC T;  4YXD A;  2V5C A;  3F2E A;  2EHO B;  4O4L E;  2HN2 A;  2V7L A;  5CFB A;  2LJL A;  3VRB A;  3M3Z B;  3LFM A;  1ZP0 A;  1SA0 E;  3HKE E;  4YJ2 E;  4IHJ E;  5CJ5 A;  3AEA A;  3VKG A;  4COF A;  4HFE A;  2N2N A;  1YXR A;  2W61 A;  4A5X A;  2LSJ A;  4HFI A;  3LBX A;  3N2G E;  2PBI A;  2XAH B;  3QK6 A;  3ZJ1 A;  4A98 A;  3S4B A;  4IDZ A;  3ZJ2 A;  4NIQ A;  4GYS A;  4ZS3 A;  5JTG A;  4UVA B;  5DAB A;  2UU9 T;  2LSG A;  3PUQ A;  1D1C A;  4CN4 A;  1QSD A;  3GMI A;  2DWK A;  3CQG B;  4CZZ B;  5AQL B;  3ACT A;  3C4W A;  3RF1 A;  4QH4 A;  5LHI B;  3N9O A;  3QB5 K;  2VAS A;  2HPJ A;  2CA5 A;  2W00 A;  2XQ4 A;  5HEG A;  3TLV A;  1L0V A;  2N1G A;  1US7 B;  1R2A A;  1N33 T;  3SFD A;  1YD8 G;  2WQY A;  3ZMS B;  2NWB A;  1BR0 A;  4U74 A;  2Y6X A;  5CB4 E;  4JI6 T;  4MFR A;  4H9Q C;  2JMK A;  4X62 T;  2VWA A;  5LHG B;  2CRB A;  3B5M A;  4ILA A;  2X0Y A;  5LMU T;  3TLT A;  2H7O A;  3O1I A;  3PUX F;  3OKQ A;  5KMG P;  1M62 A;  3R84 B;  2Q9Q A;  4PJN A;  2X66 A;  1UX5 A;  1KFY A;  5AQG B;  4P0B A;  3RIF A;  2XQ6 A;  1NEK A;  5F5W A;  1CHU A;  4O4H E;  3T1Y T;  4HWI B;  3ZN0 B;  2E5L T;  3UQ4 A;  3MJX A;  2Q9Q B;  2XQA A;  4YTN A;  5HXS A;  2I59 A;  4LMJ A;  3AE3 A;  2W62 A;  5L3E B;  4QXH B;  2JQ9 A;  5JDG A;  4U72 A;  3KVB A;  2ES0 A;  2E8I A;  3EAB A;  2WWV A;  2JRK A;  3I1A A;  3KBT A;  2UXX B;  4KI0 F;  4DBR A;  4HWD A;  4IIJ E;  2R6G F;  4F8H A;  2KWH A;  3PUZ F;  5AQN B;  3ZCI A;  4HKA A;  4B3R T;  4DMW A;  3ZMZ B;  2KXP B;  5CGM A;  3V5U A;  2ACX A;  4DBQ A;  2P9B A;  4YT0 A;  1B7T A;  3C50 A;  3CX7 B;  2BBJ A;  2WZH A;  5JDQ A;  4DR5 T;  3RKG A;  2V26 A;  4EGW A;  2XAQ B;  3WAJ A;  4ZP3 A;  4EV6 A;  3SOL A;  2VQE T;  2CCQ A;  3P8C D;  5LBM A;  3AFJ A;  5ABF A;  1OED E;  4PJJ A;  2WBL A;  3NZP A;  3KDS E;  3AAA B;  2D0U A;  2QRX A;  3V5S A;  2JIW A;  2W63 A;  2W66 A;  2CXD A;  3S4U A;  1S94 A;  3UQ7 A;  1J5W A;  1HS7 A;  2UUB T;  3LK4 2;  2WZI A;  4JEU B;  5AQP B;  3UT5 E;  4IE5 A;  2XZE A;  4FI5 A;  3PDY A;  5JR9 C;  5LCY A;  2XQ7 A;  1W9R A;  4ZOL E;  2OV9 A;  2LLY A;  2CPT A;  4ZI2 D;  4DV0 T;  4CN1 A;  3FHN A;  5CA0 E;  3FXD B;  3C4X A;  2PJQ A;  3PJA J;  5IUX A;  3RLF F;  1FIO A;  4LFB T;  2I6H A;  4YLH A;  3G36 A;  4CI2 B;  3RIU C;  3W15 B;  3ZKR A;  2A9U A;  2I0M A;  2WU5 A;  4DUZ T;  4AKI A;  3NRX A;  2H89 A;  1NWM X;  2LOS A;  1FJG T;  4LF4 T;  2D2S A;  5AQI B;  3HI2 A;  3QNU A;  3TLW A;  1L6E A;  1E2A A;  1WRD A;  4LMK A;  4H9S E;  3ZN1 B;  4YTM A;  4O2B E;  2QA7 A;  4CXW A;  2OA5 A;  3K3N A;  4IGU A;  3I9W A;  1BR4 A;  1XZY A;  3BK9 A;  5FXW A;  3UUM A;  3KVA A;  5F3J A;  3Q5E A;  4A56 A;  2EZW A;  1J5E T;  2VVN A;  4DND A;  3S4A A;  2KIN B;  3KV6 A;  5J1G A;  2C5J A;  4IE0 A;  3TLU A;  4ILC A;  3AE7 A;  4ZXL A;  4O8S A;  2B76 A;  2RQY A;  3FZM B;  2IHR 1;  1FEW A;  3ZMV B;  2BG9 B;  4PJL A;  5C3J A;  4L5G A;  1EZ3 A;  2V7K A;  3S4C A;  2Y48 B;  4O4I E;  2IML A;  4EYU A;  4HFB A;  3KIN B;  4Q25 A;  4IST A;  3RX6 A;  2DLR A;  4HEA A;  4AKL A;  2YK0 A;  3AXJ A;  4G2A A;  3C4Z A;  4G63 A;  5JR9 A;  3UUN A;  4UEL A;  4DR2 T;  4MLK A;  3AVS A;  2DNX A;  1HR0 T;  3Q5W A;  2IC9 A;  3PE0 A;  3OPC A;  5JRC A;  3AEG A;  2UUA T;  3LK3 B;  4QXC B;  4U7I A;  2YKS A;  3ACS A;  3AE4 A;  3RYH E;  2M6I A;  4C91 A;  4RTA A;  4X65 T;  4OYJ A;  5HEU A;  3PJA A;  3RIU A;  1WCR A;  3PUA A;  3P7I A;  1HNX T;  2H9R A;  4Z8X A;  4YSZ A;  4A97 A;  2IAK A;  2XQ5 A;  4F6R C;  3E22 E;  1HF8 A;  1G8X A;  2K24 A;  3LG7 A;  2NW9 A;  5BR8 T;  3AEB A;  4GK0 E;  1T7S A;  3GN5 A;  4DVD A;  4I55 E;  1KNP A;  2VKJ A;  5AQR B;  4JI0 T;  4DV7 T;  3IM4 A;  3B13 A;  3N2O A;  3F57 A;  3N2K E;  4EED A;  4AKR B;  4AQG A;  3PU8 A;  2CWO A;  3PUW F;  2FJE A;  2L9Q A;  4DR1 T;  3UUB A;  1NAF A; 
#chains in the Genus database with same CATH homology
 3IF8 B;  3DJB A;  2NTY A;  5DJQ C;  2OUT A;  5LHI B;  3N9O A;  3MZK B;  2VAS A;  1MMA A;  4ZI2 C;  3O1J A;  2KNG A;  4HFV A;  2HPJ A;  3JC6 D;  3O1H A;  4DMV A;  2CA5 A;  2W00 A;  2A2F X;  4H63 V;  4GOU A;  3EVY A;  2H3R A;  3KFW X;  3Q9D A;  2X9W A;  3OYZ A;  2N1G A;  4CQI A;  2CLY B;  5KDM C;  2QGS A;  3MXZ A;  4O4J E;  2HH7 A;  2H7V C;  1US7 B;  3RC8 A;  3CML A;  3AA1 B;  3I9Y A;  2D5U A;  1YD8 G;  3FXE B;  3ZMS B;  4EAH A;  2NWB A;  4PJM A;  4ZI3 D;  3BQK A;  1QUU A;  4EZ4 A;  4XBF B;  1BR0 A;  3H37 A;  2Y6X A;  2CMR A;  4U74 A;  3DP7 A;  5CB4 E;  5LYJ E;  2K5B B;  4MFR A;  4H9Q C;  2JMK A;  1S35 A;  2VWA A;  3N9M A;  3UUL A;  3AAI A;  4DO0 A;  5F8P A;  5LHG B;  3UUX B;  1D0X A;  4OFZ A;  5LA6 E;  1VRB A;  3RC3 A;  2XAG B;  1D1B A;  2VKO A;  4EIW A;  5JDM A;  5LOV E;  2KMF A;  2H7O A;  3O1I A;  5L3D B;  2B1E A;  5DQW A;  3OKQ A;  4ANJ A;  5KMG P;  3R84 B;  2ZMA A;  2Q9Q A;  3ETV A;  3IHR A;  4PJN A;  2SPC A;  4KUM B;  5FXV A;  2X66 A;  1UX5 A;  2PG8 A;  5FY1 A;  1YKE B;  2XAF B;  3B57 A;  4P0B A;  4B6X A;  2WWU A;  1ZHC A;  3ZEF B;  1UX4 A;  4ZS2 A;  2WSS V;  2A3D A;  3H3A A;  4PK5 A;  1FMV A;  2E9X C;  5KX5 E;  3CX6 B;  4K0U A;  4O4H E;  4AQF A;  4MHC A;  4BA9 A;  5HXR A;  3PUR A;  3ZN0 B;  4TX5 A;  3ONX A;  4KBM B;  1WYB A;  3RRC A;  2C5K T;  3ANW A;  5FNV E;  4BJN A;  2X9H A;  4EB6 E;  3O9X A;  2CXL A;  3RPU A;  3SWH A;  4PFO A;  3MJX A;  2Q9Q B;  2ODV A;  3AA6 B;  5HXS A;  2I59 A;  3VU7 H;  4AKG A;  4KMC A;  2W62 A;  3HKC E;  5L3E B;  4QXH B;  2MBG A;  1ZV4 X;  1Y64 B;  3J9X 1;  3RH3 A;  4U72 A;  5JDG A;  3J7Y q;  1E1H B;  1BR1 A;  5L2L A;  2E9X B;  2X0L B;  3KVB A;  1O3X A;  1IJ5 A;  3UTK A;  2ES0 A;  2E8I A;  2HPL A;  5FXX A;  2XHE B;  5LG4 A;  1HG2 A;  4X1K E;  5BMV E;  3RKO A;  1MMD A;  3PMI A;  1IZN B;  3C64 A;  2YU1 A;  3HR0 A;  2JRK A;  4UF0 B;  2LSK A;  3I1A A;  3KBT A;  2UXX B;  4ASK A;  1AJ3 A;  4DBR A;  4TZ4 C;  5TAO A;  2CE7 A;  3GA8 A;  4IIJ E;  2KWH A;  3HL6 A;  3CQC B;  2GK9 A;  1LKX A;  3C51 A;  4TV9 E;  3ZCI A;  4IE6 A;  5FP3 A;  2V1D B;  4CXX A;  4HKA A;  4CI1 B;  2X9Y A;  3RYC E;  2KWI B;  3EUH A;  4ZHQ E;  4DMW A;  2UXN B;  4ILU A;  4GIW A;  3ZMZ B;  1IJ6 A;  3CWZ B;  2KXP B;  4X1I E;  3V5U A;  2ACX A;  3U78 A;  1LRZ A;  3A5X A;  2VKD A;  3NZQ A;  4DBQ A;  2P9B A;  4J2C A;  3AA7 B;  3E0Z A;  1CUN A;  2KZ7 B;  2Q9Q D;  2Y8D A;  3I0Q A;  1B7T A;  3C50 A;  2LSY A;  4I43 B;  1IAP A;  5FY7 A;  1BR2 A;  3CX7 B;  3SRZ A;  5L3F B;  1HFA A;  5H6R B;  5JDQ A;  4UEM A;  5LP6 E;  2W0G A;  4PK4 A;  4EXT A;  4GK5 E;  5JDF A;  3O4X E;  3ZPO A;  1WYC A;  3GWH A;  2V26 A;  3HKB E;  5FMN A;  2XAQ B;  2LOP A;  3RYF E;  3M65 A;  3WAJ A;  3N9Q A;  3ZYK A;  2K9Q A;  3SOL A;  2JPF A;  2PFV A;  2VB6 A;  3FB2 A;  5EK3 A;  1X79 A;  2V7I A;  3C98 B;  2CCQ A;  3P8C D;  1ZKE A;  5LBQ B;  5JDH A;  5LBM A;  3R6N A;  3VKH A;  4OYK A;  5E0O A;  1D0Z A;  2XAJ B;  3FBL A;  4QHO A;  3NRY A;  4PJJ A;  2BZB A;  2C0S A;  2VL8 A;  2WBL A;  3CQX C;  3AAE B;  1OWA A;  4H9R C;  3NZP A;  5H6Q B;  2KLQ A;  3K8P C;  4OK0 A;  3EDV A;  5FYM A;  1MIW A;  2X9X A;  3KDS E;  5GON E;  2VK9 A;  3KV4 A;  3AAA B;  4UXN B;  4WBO A;  3WAK A;  4YJ3 E;  3ZYL A;  2D0U A;  4H9P C;  3V5S A;  4EOZ B;  2W63 A;  3PTR B;  4TN7 B;  5EK2 A;  2IW5 B;  1KNZ A;  2CXD A;  3S4U A;  5AFU L;  2V7J A;  2YIN A;  1YW0 A;  3LJC A;  1S94 A;  5J2U E;  5JQG E;  2ZM8 A;  3K3O A;  1HS7 A;  2VKH A;  4I50 E;  5ADX L;  4YFS A;  3WI3 A;  3N9L A;  2CWY A;  2NW8 A;  3LK4 2;  4JEU B;  4H9O C;  4XZC A;  2EHO C;  3UT5 E;  4IE5 A;  3Q5X A;  1G73 A;  4FI5 A;  2CB9 A;  3PDY A;  5LJM A;  4IE4 A;  5JR9 C;  2E9X A;  3BQL A;  1MMG A;  3EDU A;  2LE8 A;  5LCY A;  4UVC B;  1UCU A;  3IEE A;  1MMN A;  4UIG A;  4ZOL E;  4QKN A;  3KBU A;  2K48 A;  3N9N A;  2BVL A;  3I0O A;  2L8K A;  4UF0 A;  4ZI2 D;  3MA9 A;  1WLX A;  3OJA A;  3CVR A;  2L3L A;  3FHN A;  1D1A A;  5HWX A;  2ODU A;  5CA0 E;  5JDN A;  3U3I A;  3FXD B;  3C4X A;  5JDL A;  1FMW A;  2PJQ A;  5JR9 B;  3T8O A;  3N5L A;  1FIO A;  3JC6 C;  2KND A;  4L0R A;  4HN9 A;  4YLH A;  5HXE A;  3K3Q C;  1MIV A;  3ZC1 A;  4CI2 B;  4MAL A;  4M1P A;  3MK7 C;  3W15 B;  2KT9 A;  2LT3 A;  4E7Z A;  5L3C B;  3DTO A;  5JRC B;  4AKI A;  3FBZ A;  4KP3 C;  4XAX B;  2X68 A;  4NUU A;  2DHR A;  3NRX A;  5IHY A;  2JQQ A;  2MTQ A;  4O2A E;  4X20 E;  1HCI A;  1MND A;  3E08 A;  4ZI3 C;  1NWM X;  2LOS A;  4V1A v;  3ZCJ A;  4JEH B;  2YU2 A;  5LXT E;  5EK4 A;  4WNK A;  2D2S A;  3HI2 A;  2DCF A;  5HWY A;  2XTL A;  1LVK A;  1WRD A;  2LM9 A;  4P0A A;  3NBX X;  5LNK A;  2DWG A;  3OBV E;  5FXZ A;  4H9S E;  3BQI A;  3ZN1 B;  4O2B E;  4L9I A;  2QA7 A;  2LEH A;  5DQV A;  2IC6 A;  1H7C A;  2C5I T;  2OA5 A;  3K3N A;  4IGU A;  3UFE A;  3I9W A;  5JVD E;  4CXW A;  1BR4 A;  5A1L A;  2ZLY A;  1Z0P A;  2JJ9 A;  2E9X D;  3HKD E;  3BK9 A;  5FXW A;  5ETW A;  3L3P A;  3UUM A;  2ZM0 A;  3KVA A;  5F3J A;  5L3G B;  3Q2M A;  4AI6 A;  3LBX B;  4A56 A;  3CPZ A;  2CM0 A;  1MIY A;  3QC9 A;  3GN5 B;  4MBQ A;  4PFP A;  4UV9 B;  5HAX A;  3D0T A;  4DND A;  5EZY E;  4PK6 A;  4CI3 B;  2KIN B;  3KV6 A;  5J1G A;  4TV8 E;  4ZI7 E;  2C5J A;  4HGA A;  4IE0 A;  3CKD A;  3MAC A;  2YEV C;  3AA0 B;  3QUJ A;  5LHH B;  2X67 A;  1OXZ A;  4WBN E;  2CEA A;  2XQY A;  4O8S A;  3ESL A;  2RQY A;  4H9N C;  3ZLI A;  4OHF A;  4C90 A;  2M67 A;  2LSI A;  1FEW A;  4QX7 B;  2ZM2 A;  3ZMV B;  4QX8 B;  3IBP A;  4PJL A;  3ZYM A;  5CA1 E;  1HTJ F;  4L5G A;  1EZ3 A;  2V7K A;  3RYI E;  2WM9 A;  2JMH A;  4H63 H;  3N9P A;  2Y48 B;  2A72 A;  4O4I E;  2RP4 A;  1T98 A;  5HXC A;  4EYU A;  2CXF A;  2NTX A;  1YKH B;  3SS1 A;  1SHZ C;  2RA1 A;  3KIN B;  2K9A A;  3OYX A;  2DI4 A;  4IST A;  1WR6 A;  3RX6 A;  3TKL B;  2V7M A;  2J1D G;  5M4Y A;  2DLR A;  4HEA A;  4AKL A;  4EYY R;  4P09 A;  1D0Y A;  2N9D A;  3KV5 A;  4AXP A;  5JH7 E;  2YK0 A;  2NP9 A;  2EHO A;  5LJN A;  4E7S A;  2XAS B;  4G2A A;  4HTE A;  2X51 A;  3C4Z A;  3VHL A;  4BAY B;  4G63 A;  5JR9 A;  3UUN A;  3ZMU B;  4CXY A;  4UEL A;  3LK2 B;  2WMO A;  3AVR A;  2Q9Q C;  4MLK A;  5LGT B;  4AKH A;  2CBG A;  3AVS A;  3HA4 A;  5IYZ E;  2DNX A;  2LHR A;  3AB3 B;  1U5P A;  1VOM A;  4ISS A;  4WW0 A;  5C8Y E;  2WAU A;  3Q5W A;  2IC9 A;  3PE0 A;  5JRC A;  3F2E A;  2EHO B;  3LK3 B;  1HG5 A;  4QXC B;  1LVF A;  4O4L E;  4AQF C;  2MOZ A;  2V7L A;  4IE7 A;  4NUV A;  3PU3 A;  2LJL A;  3RYH E;  2LHN A;  2BDE A;  3PUS A;  4C91 A;  4QWN B;  5LGN B;  2NOX A;  3LFM A;  4OYJ A;  2XUE A;  3PUG A;  1SA0 E;  1KK7 A;  3HKE E;  1MNE A;  3PUA A;  3P7I A;  4YJ2 E;  4JUY A;  4Z8X A;  4IHJ E;  2NW7 A;  4ADZ A;  3VKG A;  4I4T E;  5JRE A;  4TUY E;  4X1Y E;  2IAK A;  2N2N A;  3L09 A;  2W61 A;  3ANW B;  4F6R C;  3ZMT B;  3E22 E;  3F31 A;  1HF8 A;  1G8X A;  2K24 A;  2LSJ A;  3KV9 A;  3LG7 A;  4HE8 A;  2NW9 A;  5J2T E;  3LBX A;  4YHJ A;  4EZH A;  1U4Q A;  3N2G E;  4GK0 E;  2PBI A;  3GN5 A;  5HYA A;  3ETU A;  2WMN A;  2XAH B;  3CX8 B;  2Z6E A;  3QK6 A;  4DVD A;  3ZJ1 A;  5HXH A;  1V9D A;  4UVB B;  4I55 E;  4IDZ A;  2EHO D;  3ZJ2 A;  4QXB B;  2VKJ A;  3ZC0 A;  1ZEE A;  4ERR A;  4PW8 A;  4GYS A;  3RRW A;  3B13 A;  4PNI A;  4ZS3 A;  3N2O A;  3F57 A;  4UV8 B;  4JLE A;  3N2K E;  3MKD A;  4N78 D;  4UVA B;  5LGU B;  5DAB A;  1HX8 A;  2MYS A;  4AKR B;  2LSG A;  5L3B B;  3PUQ A;  4AQG A;  1D1C A;  4BJM A;  3PU8 A;  2CWO A;  4FJO A;  5FY0 A;  2CLY C;  4GYR A;  2G0U A;  2D0T A;  1QSD A;  3GMI A;  2L9Q A;  2DWK A;  4PAG A;  3CQG B;  4CZZ B;  2BVM A;  1NAF A;  3C4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...