3GWHA

Crystallographic ab initio protein solution far below atomic resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
HSQLMAQLVEVIEDSFQMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLMLLLKNEYPLCYNTAWKLIKILQQTLKKPVHEAEAVYLTLHLIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional antiterminator (BglG family)
publication title Crystallographic ab initio protein structure solution below atomic resolution
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gwhA02
1.20.890.100 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3gwhA01
3UFEA 3GWHA
chains in the Genus database with same CATH superfamily
4A97A 3MXZA 1KEYA 4G63A 2CEAA 4U74A 2UXCT 3CPZA 4UVBB 4CI1B 3AVRA 2BZBA 2DI4A 4KP3C 4IREA 2VVSA 2XQ8A 2CHOA 2LSKA 2K48A 4QKNA 1HG5A 4HE8A 2HN1A 2L8KA 2CLYC 3ZMTB 3BK9A 2CXDA 2WZIA 4CQIA 5HXCA 2MTQA 5KX5E 2G0UA 1IBKT 1MNDA 3O9XA 3CVRA 1D0ZA 3TLSA 2ODVA 1HNZT 1HX8A 1BR2A 4ZS2A 4RIQA 1H7CA 4LF4T 3T8OA 1BR0A 5JQGE 4YLHA 1D1AA 4L5GA 2VL0A 4BAYB 2X9WA 2BG9E 5LMUT 4H63H 5E0OA 2YU2A 2XQ7A 4HKAA 2EHOD 3WI3A 4IDZA 2WM9A 3TLUA 2H3RA 4A56A 2WP9A 2IDOB 3LG7A 2YU1A 2DNXA 5JDLA 2M6BA 2A3DA 2ZLYA 5JREA 2XQAA 4JI4T 2WWVA 2H7OA 3VRBA 3H3MA 2QRXA 5F5WA 3AA1B 3SRZA 2IHR1 2CHNA 2I0MA 5HWYA 1MMGA 1WCRA 5L2LA 2W4XA 5JDHA 4UF0A 3K3OA 2W62A 1QUUA 3PUYF 1HNWT 2Y8DA 4X5TA 3G36A 2OUTA 1EZ3A 4H9PC 2EHOB 3I0OA 4PJMA 3IA3A 4JEUB 2DL1A 3ZJ2A 4B3RT 1QLBA 3AEFA 1OEDC 2QVAA 3EHZA 3NKZA 3AVSA 2YK0A 3I9YA 2XPKA 3ESLA 4DV0T 2V6YB 2WZHA 5LCYA 2XQ6A 4YHJA 2V7IA 1OXZA 4XZCA 2BKNA 4JI6T 3K3QC 4ZZCA 2CBIA 3R84B 5CA0E 1YQ4A 3HKEE 3FZKB 2VQFT 1UK5A 5LBQB 5AQQB 5L3GB 3FB2A 2UUAT 1WYCA 2V7KA 3S4DA 2EHOA 4K0UA 3RRCA 3C4XA 2CE7A 5AQGB 4ZS3A 4ISTA 2H7VC 3M3ZB 3JADA 4C91A 1CHUA 4L0RA 3ZPOA 4N78D 4IL4A 2WWUA 1D1BA 5HXHA 3J9X1 1HNXT 2V6YA 1IJ6A 5FNVE 4ERRA 4ASKA 3CIRA 1NAFA 3LK2B 5ABHA 5HCJA 4JLEA 3R6NA 2YDSA 2WU2A 2YINA 2CXLA 3PUWF 1AJ3A 3NZPA 2LLYA 4JI5T 3SWHA 2LSGA 4HFHA 2CCQA 5ABFB 2WDQA 4DBQA 2A9UA 5JDNA 1LVFA 2E5VA 2V7LA 3K8PC 1X79A 3AEDA 1UX4A 3IM4A 4DV3T 1XDPA 2LM9A 4ZI3D 3S4BA 4B3MT 3AXJB 3P4SA 4X1IE 2R6GF 5CB4E 3BQLA 1OWAA 5H6RB 4TZ4C 1D1CA 2IZYA 1Y01A 4TNVA 4CXXA 4DV6T 5L47A 3ZYMA 4DNDA 3QFYA 1LVKA 2X9XA 3G06A 4H9QC 5FP3A 5FL1A 2LJLA 2M67A 3V5SA 5AQJB 4O4JE 2IAKA 5ABFA 2XQ9A 4GOUA 2CQSA 3VKHA 3FZFB 3PUSA 4IE0A 3AA7B 4F8HA 4ZI3C 4L9IA 1N34T 4QXHB 2I6HA 4HFDA 4YSXA 3KV6A 2JQKA 3AXJA 4BA9A 5FXVA 4EAHA 3BQIA 4U7YA 3ZKRA 5FVLA 4MHCA 1VCTA 5AQMB 3KVAA 2YKSA 4QXCB 3OYXA 4U33A 4HEAA 4YFSA 4IE5A 2E2AA 4KX6A 4PAGA 2FJEA 2NTYA 4DUZT 2MPKA 3CK6A 2FUPA 3SFDA 2RP4A 2IW5B 2MAWA 3RYFE 4LFCT 5LHIB 3FXEB 2D0TA 4IT4A 1DU2A 5KXJA 5LYJE 2W67A 3A5XA 2CBGA 3ZCIA 2JMKA 3N9QA 1FMWA 1T98A 1KNPA 4PJLA 3AE4A 2WU5A 3K3NA 3RF1A 5GONE 1JNRA 3MKDA 3E08A 2C0SA 2IC9A 5LA6E 1FJGT 4UR9A 1M62A 4WYVA 4UIGA 1G73A 4NUVA 3IBPA 3PUGA 2AE9A 3S4CA 3VHLA 3IEEA 4ILUA 4GKKT 5AQOB 5LJNA 4Z91A 5JDFA 1YXRA 4JUYA 2B1EA 1W9RA 4NIQA 1KF6A 3ACSA 4X66T 5HXSA 1HX1B 4AQYT 4AIUA 4IDQA 5LB7B 2HPLA 4O4IE 3H3AA 3P4RA 4GK0E 3Q5WA 3AE3A 1LKXA 2XUEA 3ZCJA 3NZQA 2E8IA 2BS4A 4DV7T 3ONJA 5L3DB 2LT3A 4WZXA 1XZYA 2J4GA 1U5PA 4ZP3A 3CQXC 1L6EA 1Z0PA 5FMNA 2X51A 2KSRA 3VRAA 5ABGA 4HFIA 4DV2T 3ZYKA 5LBMA 2PG8A 3PU8A 5FY0A 4KUMB 4U72A 3ZLIA 1IJ5A 2HH7A 3CQCB 5AQNB 1YW0A 2VB6A 3PJAA 4Q25A 4EOZB 5AQRB 3PUVF 2VL8A 3F2EA 2X66A 5M4YA 4WNKA 2OA5A 5AQPB 1D0YA 5AFUL 4I0UA 1NWMX 3O1IA 3D0TA 4O4LE 4AQFC 4HWDA 4GKJT 4PK6A 2D0UA 3PURA 3RPUA 5LG4A 4CN4A 2PFVA 3RQUA 1G8XA 3ZN0B 3L3PA 4B3ST 2YDQA 4LMLA 4DIDB 3OBVE 4B3TT 1WFDA 1ZV4X 5AQSB 2XQ5A 1HCIA 5EK4A 3EVYA 4QHOA 3O4XE 3Q5DA 3RGLA 3AA6B 2WMOA 2VQET 5AQVB 4X65T 3DJBA 2V1DB 4AQGA 1W0BA 5IUXA 2LE8A 4I4TE 4NXMT 3RX6A 3Q2MA 3SOLA 3TLVA 2N1GA 5C3JA 1SA0E 2HHHT 2GK9A 4AQFA 1XNRT 4ZI7E 3ZMZB 2DWGA 3KVBA 2JMHA 1MNEA 5FXZA 1MIWA 1HS7A 1L0VA 1GQEA 4YSYA 3RKGA 4TV8E 5HYAA 3IF8B 3KV4A 4UXNB 3RIFA 3ZT5A 2PTFA 3MK7C 3ZMSB 5ABEA 5TAOA 4AKLA 3U78A 3ANWB 2WMNA 3LK3B 3MJXA 4ZEYA 4ILBA 5L3EB 4ZHQE 2KINB 4DR3T 4RTAA 4P0BA 4DMVA 5AQKB 2UXDT 5BMVE 4KBMB 4LF7T 1VCSA 2XAFB 3I1AA 3P4WA 4DR5T 4IE7A 5FY7A 4YTMA 1S94A 2EHOC 5DJQC 3RQWA 2I59A 3S4UA 5C8YE 2XM2A 5JR9C 1YQ3A 1E7PA 2P9BA 1HF8A 4WW0A 3ZYLA 3BQKA 5JR9B 2LSJA 3AAEB 4CXYA 4U2ZA 2XQYA 2VURA 2OV9A 1UCUA 2WQYA 2K5BB 3P50A 1NENA 5ADXL 4HWFA 2W63A 3HKBE 5AQHB 4RT4A 3UU8A 2D5UA 5JRCB 2D9DA 3ANWA 1UUSA 3ZT7A 2HN2A 3ZMUB 2ACZA 4TUYE 2AXDS 2VKDA 2UXNB 3AAIA 4KHZF 1U4QA 1IAPA 2DRNA 4ZI2D 3NBXX 5LG3A 1N36T 2V5DA 4I50E 4H9OC 1J5ET 1MMNA 3DP7A 2YOEA 5AQIB 4U31A 1W09A 1IZNB 2WAUA 5LHGB 4JV5T 4KHPT 4HFBA 2FJDA 5EK2A 5FKYA 4CXWA 5JR9A 3O1HA 5HVZA 2LSIA 1WLXA 4ZI2C 5JRCA 4LMJA 5FXXA 2DWKA 3CMLA 3JAEA 4UELA 3AFJA 2C5IT 2UUBT 3HI2A 4P09A 3C51A 3GWHA 2VVNA 4PFPA 3AEGA 3RRWA 3W15B 1E2AA 3N9NA 3AE1A 3PTRB 4V1Av 3U3IA 5J0ZA 2NR4A 1MIYA 3C50A 5CFBA 2BG9C 3LDQB 5LXTE 4QH1A 4F6RC 2BG9B 2KWHA 4ILCA 3B5MA 3ACTA 4JI7T 3B57A 2K3WA 2DHRA 2WB5A 4YTNA 1ZP0A 2XSAA 3DTOA 4NXNT 4ZOLE 2VKJA 2JQ9A 2BBHA 4IHJE 4OFZA 2XHEB 4K0KT 3QFZA 2XZEA 2F4VT 2XQ4A 3C4WA 4FJOA 1WR0A 5F8PA 2CWOA 1SE7A 4J2CA 3AAAB 2BG9A 3T1YT 4PNIA 2CA5A 3NRYA 4AKHA 3C4ZA 4O2BE 1SHZC 5LGUB 3UFEA 2J62A 1UX5A 4DR7T 2X9HA 4QWNB 5LJMA 4EYUA 3HR0A 1W0AA 3WAJA 4P0AA 3AEAA 4HGAA 3OVUA 3ZT6A 3PUXF 5KMGP 2PJQA 4KMCA 3QDEA 2LRLA 3QB5K 1Y64B 3PMIA 3PU3A 5FXWA 4ZZBA 1B7TA 4A5XA 4JI3T 3HA4A 3FZLB 4Z90A 1MMDA 2WSSV 4HWHA 3NRXA 5C2TA 2W0GA 2XAJB 1T8BA 4H9SE 4DBRA 3PE0A 2K9QA 1ZHCA 2BS2A 1YKEB 5AQUB 2ZM6T 2M6IA 2PBIA 4I43B 4CN1A 3AECA 3OTOT 2LSYA 2CM0A 4EV6A 3UUXB 3I9WA 3SFEA 3C98B 2E9XD 1R2AA 2CBJA 4GIWA 4X62T 4MLKA 5HEUA 1BR1A 5L3BB 4UVAB 3ZEFB 1SUMB 4HFCA 1X9BA 2JIWA 4JEHB 1WRDA 2V7JA 1MMAA 2BVLA 3UUMA 4WBNE 3JCFA 4IIJE 3ZJ1A 4COFA 1WR6A 4UEMA 4WBOA 2E5LT 4DR1T 3A8YC 4OYJA 2VKOA 2X68A 4U7IA 2YEVC 1HFAA 3EI0A 2E9XC 2XY8B 3CQGB 3UU6A 4JI1T 2E9XB 3QB5A 3O1JA 3RKOA 2DLRA 4MFRA 4X1YE 5AQFB 3N2GE 4EGWA 2CWYA 2LM2A 1XMQT 3KDSE 3KBTA 2I15A 4TWDA 4DV4T 5FYMA 4QH5A 2VASA 3QUJA 4NPPA 4FI5A 4YJ3E 3AE8A 2KNDA 5HEGA 4DV5T 1V9DA 2EZWA 2H89A 2X0LB 4HFEA 4DR6T 2MOZA 3KINB 5DABA 2KLQA 4I55E 2H88A 3PJAJ 2B76A 2MBGA 2MYSA 3EUHA 4JI0T 5ETWA 3UU4A 4NUUA 4HTEA 4H63V 2E9XA 5LOVE 1O3XA 2NW8A 3L8RA 2BKPA 4YHHT 2BKOA 3K1SA 3LJCA 3OPCA 4CN6A 3QOFA 1ZKEA 5DQWA 3PUQA 2WBLA 5EK3A 3CKDA 2UXBT 2V7MA 5JDQA 4PK5A 3J7Yq 2ZM8A 3UTKA 3MACA 3RYCE 3LSVA 3P8CD 2N9DA 1OEDE 3EAMA 3LBXB 3UULA 3RRSA 4KI0F 2YDRA 3LFMA 2HPJA 2IC6A 1Z8UA 3AA0B 1QSDA 5CJ5A 4OHFA 1XDOA 3UQ4A 4JI2T 1HR0T 3PUZF 2Y48B 2NWBA 1HG2A 1XNQT 3JC6D 3FZHB 4IDNA 5HAXA 4EEDA 5LHHB 5EZYE 3TLWA 3GA8A 2BDEA 1NEKA 4O2AE 4AISA 4TWHA 2XTLA 2KNGA 2V5CA 3X1DA 2DCFA 3S4AA 2XAGB 3LBXA 4LFBT 5J2UE 5L3CB 2CLYB 2IIUA 2LHRA 5CA1E 2ODUA 5AQLB 3ETUA 2X0HA 1I6ZA 4F9KA 2J1DG 5JVDE 3JC6C 3B13A 3F57A 3N2KE 2JPFA 2XAHB 2WS3A 4DMWA 2Z6EA 4UF0B 4AKIA 5LGTB 2BBJA 4AKRB 3UT5E 3QNUA 2NOXA 4IDOA 2WDVA 3GN5B 4LF5T 5JDGA 1S35A 3E22E 2K24A 3KFWX 2CQTA 5HXRA 5HEOA 4JBWF 3RIAA 3AEBA 2XJ7A 3H37A 2JJ9A 1J1JA 4H9NC 3EABA 5LGNB 2W2UA 5AQTB 2SPCA 4XBFB 3V5UA 4DUYT 2J47A 4PJJA 2V26A 3SS1A 4CI2B 2VKHA 3IHRA 2V8SV 3FBZA 2KZ7B 4O8SA 2LOSA 2V6XA 3P4PA 4OK0A 1ZEEA 2QYWA 1D0XA 1WYBA 2FJBA 2X0YA 3GN5A 5HEJA 3M65A 2FBWA 4ANJA 3N2OA 4YXDA 3AE5A 3EDUA 1E1HB 2C5KT 3UU3A 3PUAA 1ZOYA 2UXXB 3QK6A 2CXFA 3ZC1A 4EIWA 1OEDB 2K9AA 3L39A 3AE9A 2L9QA 5LMNT 3KBUA 3LK42 4TNWA 1YKHB 2XQ3A 2QGSA 2CMRA 2A2FX 5BR8T 1N32T 5L4EA 4EXTA 2FJAA 4YY3T 3ABVA 3KV5A 3TKLB 3QC9A 4LF8T 4BJMA 2WDRA 2H9RA 5IYZE 1YD8G 2XASB 1KFYA 4QXBB 1XWMA 4HN9A 3UUNA 4YJ2E 3VR8A 2RPAA 3HL6A 1OEDA 4IDPA 4EZHA 3CX8B 2C5JA 3CWZB 5J1GA 4GYRA 3ETVA 2W00A 2KMFA 4PW8A 1CUNA 3OJAA 4M1PA 1KK7A 5KDMC 3IM3A 3GMIA 4ZXLA 4IE4A 4CI3B 3KV9A 1T7SA 4LMKA 4C90A 3C64A 3L09A 3NWIA 1IBLT 2UUCT 5H6QB 5CGMA 3ZC0A 2NP9A 3N9LA 1MIVA 2LKGA 1N33T 2QA7A 3Q9DA 5FY1A 3HKDE 3QG0A 1JNZA 3AE7A 4HFVA 4E7SA 2ZM2A 4GK5E 1J5WA 3TLTA 3N9OA 2WY2A 4H9RC 1I94T 4TX5A 3AE6A 4DO0A 4Z8XA 5HCMA 3A7MA 1M7KA 4JYAT 5FL0A 4UV9B 1KNZA 5JH7E 4X20E 4B6XA 4DV1T 4IE6A 1UGOA 3AB3B 4OX9T 3RYIE 4G2AA 3AE2A 4YTPA 4CZZB 5IWAT 4BJNA 4TN7B 3WAKA 4AKGA 2VK9A 3OYZA 4LF9T 4GYSA 4EEBA 5A1LA 1T72A 3RC3A 2KXPB 4EB6E 2X9YA 3RYHE 2IUBA 1BR4A 4A98A 1FIOA 4HWIB 1FEWA 5LP6E 2RA1A 2NW7A 4DVDA 5JTGA 3UFGA 2CPTA 4QH4A 3ZN1B 3RI5A 2YN6A 2LHNA 4JI8T 3FBLA 2X67A 1R8IA 2RQYA 3F31A 2UU9T 2ES0A 3ZMVB 3N9PA 4PFOA 1US7B 4DR4T 1FMVA 2NTXA 4TWFA 5FVKA 2W66A 2A72A 3ZSSA 4OYKA 4QX8B 5L4HA 3AEEA 3I0QA 3PV0F 4ADZA 3Q5XA 4AI6A 4EZ4A 2ACXA 5HWXA 3UU5A 2KWIB 4U3CA 5IHYA 5LNKA 2JQQA 4PK4A 3Q5EA 2OLTA 4X64T 3CX7B 4AXPA 5DQVA 4LFAT 4P1NA 3FXDB 3N5LA 2JRKA 3NVOA 3JAFA 4TV9E 3RSYA 4UV8B 4XAXB 1VOMA 2BVMA 4MALA 4E7ZA 2BS3A 1UURA 4LF6T 4QX7B 4IGUA 4ILAA 2L3LA 4HWCA 4YT0A 2XAQB 1KNRA 3RIUC 4MBQA 2Y6XA 4O4HE 1VRBA 2Q9QD 3E0ZA 3VU7H 4EYYR 1LRZA 3N9MA 3VKGA 2D2SA 2LEHA 3MZKB 5HEHA 3ONXA 4UVCB 3FZMB 3ONLC 4X1KE 1IBMT 2IMLA 3UUBA 3T1HT 5JDMA 3EDVA 3OKQA 3ZSTA 2VWAA 3PDYA 4IL9A 2Q9QC 3VR9A 2Q9QB 4DR2T 2WCAA 5F3JA 4PJNA 2LKHA 3RHWA 3RIUA 2N2NA 2CB9A 4ISSA 2ZM0A 3FHNA 4U2YA 5J2TE 1XMOT 5L3FB 2CRBA 2KT9A 2W61A 2LOPA 3RC8A 1HTJF 2NW9A 2XSBA 3UQ7A 2ZMAA 4YSZA 2KYGA 2LRKA 3CX6B 5HXEA 3RLFF 3RH3A 3MA9A 3P7IA 2JQHA 3HKCE 3P4QA 2XM1A 2Q9QA
chains in the Genus database with same CATH topology
5F8PA 2CWOA 2C5KT 3MXZA 4G63A 3PUAA 2CEAA 2UXXB 3QK6A 2CXFA 4U74A 4J2CA 4UIGA 3AAAB 3ZC1A 1G73A 4NUVA 3CPZA 3IBPA 3PUGA 4EIWA 4UVBB 4PNIA 3VHLA 2CA5A 4CI1B 3AVRA 2BZBA 3IEEA 3NRYA 2DI4A 4AKHA 3C4ZA 4KP3C 4O2BE 2K9AA 1SHZC 4ILUA 5LGUB 3UFEA 2L9QA 1UX5A 2X9HA 3KBUA 2LSKA 5LJNA 4QWNB 5LJMA 2K48A 4EYUA 3LK42 4QKNA 1HG5A 4HE8A 2L8KA 2CLYC 1YKHB 3BK9A 2CXDA 3HR0A 5JDFA 3ZMTB 2QGSA 2CMRA 2A2FX 3WAJA 4CQIA 5HXCA 2MTQA 5KX5E 2G0UA 1MNDA 4JUYA 3O9XA 2B1EA 4P0AA 3CVRA 1D0ZA 4EXTA 2ODVA 4HGAA 1HX8A 5HXSA 1BR2A 3KV5A 4ZS2A 3TKLB 5KMGP 3QC9A 2PJQA 2HPLA 4BJMA 4O4IE 3H3AA 4KMCA 1H7CA 4GK0E 3Q5WA 3PMIA 1Y64B 5IYZE 1YD8G 1LKXA 3T8OA 2XUEA 1BR0A 2XASB 3PU3A 5FXWA 3ZCJA 3NZQA 5JQGE 2E8IA 4QXBB 1B7TA 3HA4A 4HN9A 4YLHA 3UUNA 1MMDA 2WSSV 5L3DB 2LT3A 3NRXA 4YJ2E 1D1AA 4L5GA 3HL6A 4BAYB 2W0GA 1U5PA 2X9WA 4EZHA 3CX8B 2C5JA 3CWZB 2XAJB 4H63H 5E0OA 3CQXC 2YU2A 4GYRA 3ETVA 5J1GA 2W00A 2KMFA 4PW8A 1Z0PA 4H9SE 4HKAA 4DBRA 2EHOD 1CUNA 5FMNA 3WI3A 4IDZA 2WM9A 2X51A 3OJAA 3PE0A 2H3RA 4M1PA 4A56A 2K9QA 1ZHCA 3LG7A 3ZYKA 5LBMA 1KK7A 5KDMC 3GMIA 2YU1A 1YKEB 2DNXA 4IE4A 5JDLA 2A3DA 3EDUA 2ZLYA 4CI3B 5JREA 2PG8A 3PU8A 5FY0A 4KUMB 3KV9A 2PBIA 4I43B 4U72A 3ZLIA 2H7OA 1IJ5A 2HH7A 3CQCB 1YW0A 2VB6A 4C90A 3C64A 3AA1B 4EOZB 3L09A 3SRZA 5H6QB 2LSYA 2CM0A 5HWYA 3UUXB 3ZC0A 2NP9A 3N9LA 3I9WA 1MIVA 1MMGA 5L2LA 3C98B 2VL8A 2E9XD 3F2EA 2QA7A 3Q9DA 5FY1A 3HKDE 4GIWA 2X66A 5JDHA 5M4YA 4MLKA 4UF0A 3K3OA 2W62A 1BR1A 4WNKA 5L3BB 4HFVA 1QUUA 2OA5A 4E7SA 4UVAB 2ZM2A 2Y8DA 4GK5E 1D0YA 3N9OA 2OUTA 3ZEFB 5AFUL 1EZ3A 1NWMX 4H9RC 4H9PC 3O1IA 3D0TA 2EHOB 4O4LE 3I0OA 4PJMA 4TX5A 4JEHB 4AQFC 4PK6A 1WRDA 4JEUB 2V7JA 4DO0A 4Z8XA 1MMAA 2D0UA 2BVLA 3UUMA 3PURA 3RPUA 3ZJ2A 5LG4A 4WBNE 2PFVA 4IIJE 3ZJ1A 1G8XA 3ZN0B 3L3PA 4UV9B 1WR6A 4UEMA 4WBOA 3AVSA 2YK0A 3I9YA 4OYJA 1KNZA 3ESLA 5JH7E 2VKOA 2X68A 2YEVC 4X20E 1HFAA 3OBVE 4B6XA 2E9XC 1ZV4X 4IE6A 3CQGB 1HCIA 5LCYA 5EK4A 4YHJA 3EVYA 2E9XB 3AB3B 4QHOA 3O1JA 3RKOA 2DLRA 3RYIE 2V7IA 1OXZA 4G2AA 4MFRA 4XZCA 3O4XE 4X1YE 3K3QC 3N2GE 2CWYA 4CZZB 4BJNA 4TN7B 3AA6B 2WMOA 3R84B 3WAKA 5CA0E 4AKGA 3HKEE 2VK9A 3KDSE 3KBTA 3OYZA 3DJBA 5LBQB 2V1DB 4GYSA 4AQGA 5L3GB 5FYMA 3FB2A 5A1LA 2VASA 1WYCA 2LE8A 2V7KA 3QUJA 4FI5A 4I4TE 4YJ3E 3RC3A 2KNDA 2EHOA 3RX6A 4K0UA 3Q2MA 1V9DA 3RRCA 3SOLA 3C4XA 2CE7A 2KXPB 2N1GA 2X0LB 4EB6E 1SA0E 2GK9A 4AQFA 2X9YA 2MOZA 3KINB 4ZS3A 4ISTA 3RYHE 4ZI7E 5DABA 2KLQA 2H7VC 4I55E 3ZMZB 1BR4A 2DWGA 3KVBA 4C91A 1FIOA 2JMHA 1MNEA 5FXZA 4L0RA 1MIWA 2MBGA 1HS7A 2MYSA 3EUHA 3ZPOA 4N78D 2WWUA 1D1BA 5HXHA 3J9X1 5ETWA 4TV8E 4NUUA 3IF8B 1IJ6A 5HYAA 4HTEA 4H63V 1FEWA 5FNVE 4ERRA 2E9XA 3KV4A 4UXNB 4ASKA 5LP6E 1NAFA 3LK2B 5LOVE 1O3XA 2NW8A 2RA1A 2NW7A 4DVDA 3MK7C 3ZMSB 4JLEA 3R6NA 5TAOA 4AKLA 3LJCA 3U78A 3ANWB 2WMNA 3LK3B 3MJXA 2YINA 2CXLA 1AJ3A 3NZPA 3ZN1B 5L3EB 2LHNA 3FBLA 4ZHQE 1ZKEA 2X67A 3SWHA 2KINB 5DQWA 2LSGA 3PUQA 2CCQA 4P0BA 4DBQA 2WBLA 4DMVA 2RQYA 5BMVE 5JDNA 4KBMB 3F31A 5EK3A 3CKDA 1LVFA 2XAFB 3I1AA 2V7LA 4IE7A 2ES0A 5FY7A 3K8PC 3ZMVB 2V7MA 1X79A 3N9PA 4PFOA 1US7B 5JDQA 4PK5A 3J7Yq 1FMVA 2NTXA 1S94A 2ZM8A 2EHOC 5DJQC 3UTKA 2I59A 1UX4A 3MACA 3S4UA 2A72A 5C8YE 3RYCE 4OYKA 5JR9C 4QX8B 3P8CD 2N9DA 2LM9A 2P9BA 1HF8A 4WW0A 3ZYLA 3BQKA 4ZI3D 3LBXB 2LSJA 3AAEB 3UULA 5JR9B 4CXYA 3I0QA 2XQYA 1UCUA 4ADZA 3Q5XA 3LFMA 4AI6A 4X1IE 4EZ4A 2ACXA 2HPJA 5HWXA 2K5BB 5CB4E 3BQLA 2KWIB 2IC6A 5ADXL 1OWAA 5H6RB 2W63A 4TZ4C 3HKBE 1D1CA 5IHYA 3AA0B 5LNKA 2JQQA 4CXXA 1QSDA 2D5UA 4PK4A 5JRCB 3ANWA 4OHFA 3ZYMA 3ZMUB 4DNDA 4TUYE 3CX7B 4AXPA 1LVKA 2VKDA 5DQVA 2X9XA 4H9QC 2UXNB 3AAIA 5FP3A 1U4QA 1IAPA 2Y48B 2NWBA 1HG2A 3FXDB 3N5LA 4ZI2D 2LJLA 2M67A 3JC6D 2JRKA 3V5SA 4TV9E 3NBXX 4O4JE 4UV8B 2IAKA 4XAXB 1VOMA 2BVMA 4MALA 5HAXA 4E7ZA 4GOUA 5LHHB 5EZYE 4QX7B 4I50E 4IGUA 4H9OC 2L3LA 2XAQB 3GA8A 3VKHA 1MMNA 2BDEA 3DP7A 4MBQA 2Y6XA 3PUSA 4IE0A 4O4HE 3AA7B 4O2AE 4ZI3C 1VRBA 2Q9QD 3E0ZA 4L9IA 3VU7H 2XTLA 1IZNB 2WAUA 5LHGB 2KNGA 4EYYR 1LRZA 2DCFA 5EK2A 4QXHB 4CXWA 2XAGB 3LBXA 3N9MA 5JR9A 3KV6A 5J2UE 2D2SA 3VKGA 5L3CB 2CLYB 2LEHA 3O1HA 2LHRA 3MZKB 5CA1E 2ODUA 4BA9A 3ONXA 5FXVA 4UVCB 4EAHA 2LSIA 1WLXA 3ETUA 3BQIA 4ZI2C 2J1DG 5JVDE 5JRCA 4X1KE 5FXXA 2DWKA 3CMLA 3JC6C 3B13A 4MHCA 3F57A 4UELA 5JDMA 3EDVA 3N2KE 3OKQA 2JPFA 2XAHB 3KVAA 4DMWA 2Z6EA 4UF0B 4AKIA 2VWAA 2C5IT 5LGTB 4AKRB 3PDYA 3HI2A 4P09A 4QXCB 3UT5E 3OYXA 3C51A 2NOXA 4HEAA 3GWHA 3GN5B 4YFSA 4PFPA 5JDGA 1S35A 3RRWA 3E22E 2Q9QC 3W15B 4IE5A 2K24A 3KFWX 4PAGA 3N9NA 3PTRB 2NTYA 5HXRA 2Q9QB 4V1Av 3U3IA 1MIYA 3C50A 5F3JA 4PJNA 2RP4A 2IW5B 2N2NA 3H37A 2JJ9A 5LXTE 2CB9A 4ISSA 4H9NC 4F6RC 3RYFE 5LGNB 2ZM0A 5LHIB 2SPCA 3FXEB 2D0TA 3FHNA 4XBFB 2KWHA 3V5UA 5J2TE 5L3FB 5LYJE 4PJJA 2KT9A 3A5XA 2V26A 2W61A 3SS1A 4CI2B 2LOPA 3B57A 3ZCIA 2CBGA 2VKHA 3RC8A 2JMKA 1HTJF 3N9QA 3IHRA 2DHRA 1FMWA 2NW9A 1T98A 2ZMAA 3FBZA 4PJLA 2KZ7B 3K3NA 5GONE 4O8SA 3DTOA 2LOSA 4ZOLE 3CX6B 2VKJA 5HXEA 4IHJE 4OFZA 4OK0A 1ZEEA 2XHEB 1D0XA 1WYBA 3MKDA 3RH3A 3GN5A 3E08A 2C0SA 3MA9A 3P7IA 2IC9A 3M65A 4ANJA 3N2OA 3HKCE 5LA6E 3C4WA 4FJOA 2Q9QA 1E1HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFE A;  3GWH A; 
#chains in the Genus database with same CATH topology
 4A97 A;  3MXZ A;  1KEY A;  4G63 A;  2CEA A;  4U74 A;  2UXC T;  3CPZ A;  4UVB B;  4CI1 B;  3AVR A;  2BZB A;  2DI4 A;  4KP3 C;  4IRE A;  2VVS A;  2XQ8 A;  2CHO A;  2LSK A;  2K48 A;  4QKN A;  1HG5 A;  4HE8 A;  2HN1 A;  2L8K A;  2CLY C;  3ZMT B;  3BK9 A;  2CXD A;  2WZI A;  4CQI A;  5HXC A;  2MTQ A;  5KX5 E;  2G0U A;  1IBK T;  1MND A;  3O9X A;  3CVR A;  1D0Z A;  3TLS A;  2ODV A;  1HNZ T;  1HX8 A;  1BR2 A;  4ZS2 A;  4RIQ A;  1H7C A;  4LF4 T;  3T8O A;  1BR0 A;  5JQG E;  4YLH A;  1D1A A;  4L5G A;  2VL0 A;  4BAY B;  2X9W A;  2BG9 E;  5LMU T;  4H63 H;  5E0O A;  2YU2 A;  2XQ7 A;  4HKA A;  2EHO D;  3WI3 A;  4IDZ A;  2WM9 A;  3TLU A;  2H3R A;  4A56 A;  2WP9 A;  2IDO B;  3LG7 A;  2YU1 A;  2DNX A;  5JDL A;  2M6B A;  2A3D A;  2ZLY A;  5JRE A;  2XQA A;  4JI4 T;  2WWV A;  2H7O A;  3VRB A;  3H3M A;  2QRX A;  5F5W A;  3AA1 B;  3SRZ A;  2IHR 1;  2CHN A;  2I0M A;  5HWY A;  1MMG A;  1WCR A;  5L2L A;  2W4X A;  5JDH A;  4UF0 A;  3K3O A;  2W62 A;  1QUU A;  3PUY F;  1HNW T;  2Y8D A;  4X5T A;  3G36 A;  2OUT A;  1EZ3 A;  4H9P C;  2EHO B;  3I0O A;  4PJM A;  3IA3 A;  4JEU B;  2DL1 A;  3ZJ2 A;  4B3R T;  1QLB A;  3AEF A;  1OED C;  2QVA A;  3EHZ A;  3NKZ A;  3AVS A;  2YK0 A;  3I9Y A;  2XPK A;  3ESL A;  4DV0 T;  2V6Y B;  2WZH A;  5LCY A;  2XQ6 A;  4YHJ A;  2V7I A;  1OXZ A;  4XZC A;  2BKN A;  4JI6 T;  3K3Q C;  4ZZC A;  2CBI A;  3R84 B;  5CA0 E;  1YQ4 A;  3HKE E;  3FZK B;  2VQF T;  1UK5 A;  5LBQ B;  5AQQ B;  5L3G B;  3FB2 A;  2UUA T;  1WYC A;  2V7K A;  3S4D A;  2EHO A;  4K0U A;  3RRC A;  3C4X A;  2CE7 A;  5AQG B;  4ZS3 A;  4IST A;  2H7V C;  3M3Z B;  3JAD A;  4C91 A;  1CHU A;  4L0R A;  3ZPO A;  4N78 D;  4IL4 A;  2WWU A;  1D1B A;  5HXH A;  3J9X 1;  1HNX T;  2V6Y A;  1IJ6 A;  5FNV E;  4ERR A;  4ASK A;  3CIR A;  1NAF A;  3LK2 B;  5ABH A;  5HCJ A;  4JLE A;  3R6N A;  2YDS A;  2WU2 A;  2YIN A;  2CXL A;  3PUW F;  1AJ3 A;  3NZP A;  2LLY A;  4JI5 T;  3SWH A;  2LSG A;  4HFH A;  2CCQ A;  5ABF B;  2WDQ A;  4DBQ A;  2A9U A;  5JDN A;  1LVF A;  2E5V A;  2V7L A;  3K8P C;  1X79 A;  3AED A;  1UX4 A;  3IM4 A;  4DV3 T;  1XDP A;  2LM9 A;  4ZI3 D;  3S4B A;  4B3M T;  3AXJ B;  3P4S A;  4X1I E;  2R6G F;  5CB4 E;  3BQL A;  1OWA A;  5H6R B;  4TZ4 C;  1D1C A;  2IZY A;  1Y01 A;  4TNV A;  4CXX A;  4DV6 T;  5L47 A;  3ZYM A;  4DND A;  3QFY A;  1LVK A;  2X9X A;  3G06 A;  4H9Q C;  5FP3 A;  5FL1 A;  2LJL A;  2M67 A;  3V5S A;  5AQJ B;  4O4J E;  2IAK A;  5ABF A;  2XQ9 A;  4GOU A;  2CQS A;  3VKH A;  3FZF B;  3PUS A;  4IE0 A;  3AA7 B;  4F8H A;  4ZI3 C;  4L9I A;  1N34 T;  4QXH B;  2I6H A;  4HFD A;  4YSX A;  3KV6 A;  2JQK A;  3AXJ A;  4BA9 A;  5FXV A;  4EAH A;  3BQI A;  4U7Y A;  3ZKR A;  5FVL A;  4MHC A;  1VCT A;  5AQM B;  3KVA A;  2YKS A;  4QXC B;  3OYX A;  4U33 A;  4HEA A;  4YFS A;  4IE5 A;  2E2A A;  4KX6 A;  4PAG A;  2FJE A;  2NTY A;  4DUZ T;  2MPK A;  3CK6 A;  2FUP A;  3SFD A;  2RP4 A;  2IW5 B;  2MAW A;  3RYF E;  4LFC T;  5LHI B;  3FXE B;  2D0T A;  4IT4 A;  1DU2 A;  5KXJ A;  5LYJ E;  2W67 A;  3A5X A;  2CBG A;  3ZCI A;  2JMK A;  3N9Q A;  1FMW A;  1T98 A;  1KNP A;  4PJL A;  3AE4 A;  2WU5 A;  3K3N A;  3RF1 A;  5GON E;  1JNR A;  3MKD A;  3E08 A;  2C0S A;  2IC9 A;  5LA6 E;  1FJG T;  4UR9 A;  1M62 A;  4WYV A;  4UIG A;  1G73 A;  4NUV A;  3IBP A;  3PUG A;  2AE9 A;  3S4C A;  3VHL A;  3IEE A;  4ILU A;  4GKK T;  5AQO B;  5LJN A;  4Z91 A;  5JDF A;  1YXR A;  4JUY A;  2B1E A;  1W9R A;  4NIQ A;  1KF6 A;  3ACS A;  4X66 T;  5HXS A;  1HX1 B;  4AQY T;  4AIU A;  4IDQ A;  5LB7 B;  2HPL A;  4O4I E;  3H3A A;  3P4R A;  4GK0 E;  3Q5W A;  3AE3 A;  1LKX A;  2XUE A;  3ZCJ A;  3NZQ A;  2E8I A;  2BS4 A;  4DV7 T;  3ONJ A;  5L3D B;  2LT3 A;  4WZX A;  1XZY A;  2J4G A;  1U5P A;  4ZP3 A;  3CQX C;  1L6E A;  1Z0P A;  5FMN A;  2X51 A;  2KSR A;  3VRA A;  5ABG A;  4HFI A;  4DV2 T;  3ZYK A;  5LBM A;  2PG8 A;  3PU8 A;  5FY0 A;  4KUM B;  4U72 A;  3ZLI A;  1IJ5 A;  2HH7 A;  3CQC B;  5AQN B;  1YW0 A;  2VB6 A;  3PJA A;  4Q25 A;  4EOZ B;  5AQR B;  3PUV F;  2VL8 A;  3F2E A;  2X66 A;  5M4Y A;  4WNK A;  2OA5 A;  5AQP B;  1D0Y A;  5AFU L;  4I0U A;  1NWM X;  3O1I A;  3D0T A;  4O4L E;  4AQF C;  4HWD A;  4GKJ T;  4PK6 A;  2D0U A;  3PUR A;  3RPU A;  5LG4 A;  4CN4 A;  2PFV A;  3RQU A;  1G8X A;  3ZN0 B;  3L3P A;  4B3S T;  2YDQ A;  4LML A;  4DID B;  3OBV E;  4B3T T;  1WFD A;  1ZV4 X;  5AQS B;  2XQ5 A;  1HCI A;  5EK4 A;  3EVY A;  4QHO A;  3O4X E;  3Q5D A;  3RGL A;  3AA6 B;  2WMO A;  2VQE T;  5AQV B;  4X65 T;  3DJB A;  2V1D B;  4AQG A;  1W0B A;  5IUX A;  2LE8 A;  4I4T E;  4NXM T;  3RX6 A;  3Q2M A;  3SOL A;  3TLV A;  2N1G A;  5C3J A;  1SA0 E;  2HHH T;  2GK9 A;  4AQF A;  1XNR T;  4ZI7 E;  3ZMZ B;  2DWG A;  3KVB A;  2JMH A;  1MNE A;  5FXZ A;  1MIW A;  1HS7 A;  1L0V A;  1GQE A;  4YSY A;  3RKG A;  4TV8 E;  5HYA A;  3IF8 B;  3KV4 A;  4UXN B;  3RIF A;  3ZT5 A;  2PTF A;  3MK7 C;  3ZMS B;  5ABE A;  5TAO A;  4AKL A;  3U78 A;  3ANW B;  2WMN A;  3LK3 B;  3MJX A;  4ZEY A;  4ILB A;  5L3E B;  4ZHQ E;  2KIN B;  4DR3 T;  4RTA A;  4P0B A;  4DMV A;  5AQK B;  2UXD T;  5BMV E;  4KBM B;  4LF7 T;  1VCS A;  2XAF B;  3I1A A;  3P4W A;  4DR5 T;  4IE7 A;  5FY7 A;  4YTM A;  1S94 A;  2EHO C;  5DJQ C;  3RQW A;  2I59 A;  3S4U A;  5C8Y E;  2XM2 A;  5JR9 C;  1YQ3 A;  1E7P A;  2P9B A;  1HF8 A;  4WW0 A;  3ZYL A;  3BQK A;  5JR9 B;  2LSJ A;  3AAE B;  4CXY A;  4U2Z A;  2XQY A;  2VUR A;  2OV9 A;  1UCU A;  2WQY A;  2K5B B;  3P50 A;  1NEN A;  5ADX L;  4HWF A;  2W63 A;  3HKB E;  5AQH B;  4RT4 A;  3UU8 A;  2D5U A;  5JRC B;  2D9D A;  3ANW A;  1UUS A;  3ZT7 A;  2HN2 A;  3ZMU B;  2ACZ A;  4TUY E;  2AXD S;  2VKD A;  2UXN B;  3AAI A;  4KHZ F;  1U4Q A;  1IAP A;  2DRN A;  4ZI2 D;  3NBX X;  5LG3 A;  1N36 T;  2V5D A;  4I50 E;  4H9O C;  1J5E T;  1MMN A;  3DP7 A;  2YOE A;  5AQI B;  4U31 A;  1W09 A;  1IZN B;  2WAU A;  5LHG B;  4JV5 T;  4KHP T;  4HFB A;  2FJD A;  5EK2 A;  5FKY A;  4CXW A;  5JR9 A;  3O1H A;  5HVZ A;  2LSI A;  1WLX A;  4ZI2 C;  5JRC A;  4LMJ A;  5FXX A;  2DWK A;  3CML A;  3JAE A;  4UEL A;  3AFJ A;  2C5I T;  2UUB T;  3HI2 A;  4P09 A;  3C51 A;  3GWH A;  2VVN A;  4PFP A;  3AEG A;  3RRW A;  3W15 B;  1E2A A;  3N9N A;  3AE1 A;  3PTR B;  4V1A v;  3U3I A;  5J0Z A;  2NR4 A;  1MIY A;  3C50 A;  5CFB A;  2BG9 C;  3LDQ B;  5LXT E;  4QH1 A;  4F6R C;  2BG9 B;  2KWH A;  4ILC A;  3B5M A;  3ACT A;  4JI7 T;  3B57 A;  2K3W A;  2DHR A;  2WB5 A;  4YTN A;  1ZP0 A;  2XSA A;  3DTO A;  4NXN T;  4ZOL E;  2VKJ A;  2JQ9 A;  2BBH A;  4IHJ E;  4OFZ A;  2XHE B;  4K0K T;  3QFZ A;  2XZE A;  2F4V T;  2XQ4 A;  3C4W A;  4FJO A;  1WR0 A;  5F8P A;  2CWO A;  1SE7 A;  4J2C A;  3AAA B;  2BG9 A;  3T1Y T;  4PNI A;  2CA5 A;  3NRY A;  4AKH A;  3C4Z A;  4O2B E;  1SHZ C;  5LGU B;  3UFE A;  2J62 A;  1UX5 A;  4DR7 T;  2X9H A;  4QWN B;  5LJM A;  4EYU A;  3HR0 A;  1W0A A;  3WAJ A;  4P0A A;  3AEA A;  4HGA A;  3OVU A;  3ZT6 A;  3PUX F;  5KMG P;  2PJQ A;  4KMC A;  3QDE A;  2LRL A;  3QB5 K;  1Y64 B;  3PMI A;  3PU3 A;  5FXW A;  4ZZB A;  1B7T A;  4A5X A;  4JI3 T;  3HA4 A;  3FZL B;  4Z90 A;  1MMD A;  2WSS V;  4HWH A;  3NRX A;  5C2T A;  2W0G A;  2XAJ B;  1T8B A;  4H9S E;  4DBR A;  3PE0 A;  2K9Q A;  1ZHC A;  2BS2 A;  1YKE B;  5AQU B;  2ZM6 T;  2M6I A;  2PBI A;  4I43 B;  4CN1 A;  3AEC A;  3OTO T;  2LSY A;  2CM0 A;  4EV6 A;  3UUX B;  3I9W A;  3SFE A;  3C98 B;  2E9X D;  1R2A A;  2CBJ A;  4GIW A;  4X62 T;  4MLK A;  5HEU A;  1BR1 A;  5L3B B;  4UVA B;  3ZEF B;  1SUM B;  4HFC A;  1X9B A;  2JIW A;  4JEH B;  1WRD A;  2V7J A;  1MMA A;  2BVL A;  3UUM A;  4WBN E;  3JCF A;  4IIJ E;  3ZJ1 A;  4COF A;  1WR6 A;  4UEM A;  4WBO A;  2E5L T;  4DR1 T;  3A8Y C;  4OYJ A;  2VKO A;  2X68 A;  4U7I A;  2YEV C;  1HFA A;  3EI0 A;  2E9X C;  2XY8 B;  3CQG B;  3UU6 A;  4JI1 T;  2E9X B;  3QB5 A;  3O1J A;  3RKO A;  2DLR A;  4MFR A;  4X1Y E;  5AQF B;  3N2G E;  4EGW A;  2CWY A;  2LM2 A;  1XMQ T;  3KDS E;  3KBT A;  2I15 A;  4TWD A;  4DV4 T;  5FYM A;  4QH5 A;  2VAS A;  3QUJ A;  4NPP A;  4FI5 A;  4YJ3 E;  3AE8 A;  2KND A;  5HEG A;  4DV5 T;  1V9D A;  2EZW A;  2H89 A;  2X0L B;  4HFE A;  4DR6 T;  2MOZ A;  3KIN B;  5DAB A;  2KLQ A;  4I55 E;  2H88 A;  3PJA J;  2B76 A;  2MBG A;  2MYS A;  3EUH A;  4JI0 T;  5ETW A;  3UU4 A;  4NUU A;  4HTE A;  4H63 V;  2E9X A;  5LOV E;  1O3X A;  2NW8 A;  3L8R A;  2BKP A;  4YHH T;  2BKO A;  3K1S A;  3LJC A;  3OPC A;  4CN6 A;  3QOF A;  1ZKE A;  5DQW A;  3PUQ A;  2WBL A;  5EK3 A;  3CKD A;  2UXB T;  2V7M A;  5JDQ A;  4PK5 A;  3J7Y q;  2ZM8 A;  3UTK A;  3MAC A;  3RYC E;  3LSV A;  3P8C D;  2N9D A;  1OED E;  3EAM A;  3LBX B;  3UUL A;  3RRS A;  4KI0 F;  2YDR A;  3LFM A;  2HPJ A;  2IC6 A;  1Z8U A;  3AA0 B;  1QSD A;  5CJ5 A;  4OHF A;  1XDO A;  3UQ4 A;  4JI2 T;  1HR0 T;  3PUZ F;  2Y48 B;  2NWB A;  1HG2 A;  1XNQ T;  3JC6 D;  3FZH B;  4IDN A;  5HAX A;  4EED A;  5LHH B;  5EZY E;  3TLW A;  3GA8 A;  2BDE A;  1NEK A;  4O2A E;  4AIS A;  4TWH A;  2XTL A;  2KNG A;  2V5C A;  3X1D A;  2DCF A;  3S4A A;  2XAG B;  3LBX A;  4LFB T;  5J2U E;  5L3C B;  2CLY B;  2IIU A;  2LHR A;  5CA1 E;  2ODU A;  5AQL B;  3ETU A;  2X0H A;  1I6Z A;  4F9K A;  2J1D G;  5JVD E;  3JC6 C;  3B13 A;  3F57 A;  3N2K E;  2JPF A;  2XAH B;  2WS3 A;  4DMW A;  2Z6E A;  4UF0 B;  4AKI A;  5LGT B;  2BBJ A;  4AKR B;  3UT5 E;  3QNU A;  2NOX A;  4IDO A;  2WDV A;  3GN5 B;  4LF5 T;  5JDG A;  1S35 A;  3E22 E;  2K24 A;  3KFW X;  2CQT A;  5HXR A;  5HEO A;  4JBW F;  3RIA A;  3AEB A;  2XJ7 A;  3H37 A;  2JJ9 A;  1J1J A;  4H9N C;  3EAB A;  5LGN B;  2W2U A;  5AQT B;  2SPC A;  4XBF B;  3V5U A;  4DUY T;  2J47 A;  4PJJ A;  2V26 A;  3SS1 A;  4CI2 B;  2VKH A;  3IHR A;  2V8S V;  3FBZ A;  2KZ7 B;  4O8S A;  2LOS A;  2V6X A;  3P4P A;  4OK0 A;  1ZEE A;  2QYW A;  1D0X A;  1WYB A;  2FJB A;  2X0Y A;  3GN5 A;  5HEJ A;  3M65 A;  2FBW A;  4ANJ A;  3N2O A;  4YXD A;  3AE5 A;  3EDU A;  1E1H B;  2C5K T;  3UU3 A;  3PUA A;  1ZOY A;  2UXX B;  3QK6 A;  2CXF A;  3ZC1 A;  4EIW A;  1OED B;  2K9A A;  3L39 A;  3AE9 A;  2L9Q A;  5LMN T;  3KBU A;  3LK4 2;  4TNW A;  1YKH B;  2XQ3 A;  2QGS A;  2CMR A;  2A2F X;  5BR8 T;  1N32 T;  5L4E A;  4EXT A;  2FJA A;  4YY3 T;  3ABV A;  3KV5 A;  3TKL B;  3QC9 A;  4LF8 T;  4BJM A;  2WDR A;  2H9R A;  5IYZ E;  1YD8 G;  2XAS B;  1KFY A;  4QXB B;  1XWM A;  4HN9 A;  3UUN A;  4YJ2 E;  3VR8 A;  2RPA A;  3HL6 A;  1OED A;  4IDP A;  4EZH A;  3CX8 B;  2C5J A;  3CWZ B;  5J1G A;  4GYR A;  3ETV A;  2W00 A;  2KMF A;  4PW8 A;  1CUN A;  3OJA A;  4M1P A;  1KK7 A;  5KDM C;  3IM3 A;  3GMI A;  4ZXL A;  4IE4 A;  4CI3 B;  3KV9 A;  1T7S A;  4LMK A;  4C90 A;  3C64 A;  3L09 A;  3NWI A;  1IBL T;  2UUC T;  5H6Q B;  5CGM A;  3ZC0 A;  2NP9 A;  3N9L A;  1MIV A;  2LKG A;  1N33 T;  2QA7 A;  3Q9D A;  5FY1 A;  3HKD E;  3QG0 A;  1JNZ A;  3AE7 A;  4HFV A;  4E7S A;  2ZM2 A;  4GK5 E;  1J5W A;  3TLT A;  3N9O A;  2WY2 A;  4H9R C;  1I94 T;  4TX5 A;  3AE6 A;  4DO0 A;  4Z8X A;  5HCM A;  3A7M A;  1M7K A;  4JYA T;  5FL0 A;  4UV9 B;  1KNZ A;  5JH7 E;  4X20 E;  4B6X A;  4DV1 T;  4IE6 A;  1UGO A;  3AB3 B;  4OX9 T;  3RYI E;  4G2A A;  3AE2 A;  4YTP A;  4CZZ B;  5IWA T;  4BJN A;  4TN7 B;  3WAK A;  4AKG A;  2VK9 A;  3OYZ A;  4LF9 T;  4GYS A;  4EEB A;  5A1L A;  1T72 A;  3RC3 A;  2KXP B;  4EB6 E;  2X9Y A;  3RYH E;  2IUB A;  1BR4 A;  4A98 A;  1FIO A;  4HWI B;  1FEW A;  5LP6 E;  2RA1 A;  2NW7 A;  4DVD A;  5JTG A;  3UFG A;  2CPT A;  4QH4 A;  3ZN1 B;  3RI5 A;  2YN6 A;  2LHN A;  4JI8 T;  3FBL A;  2X67 A;  1R8I A;  2RQY A;  3F31 A;  2UU9 T;  2ES0 A;  3ZMV B;  3N9P A;  4PFO A;  1US7 B;  4DR4 T;  1FMV A;  2NTX A;  4TWF A;  5FVK A;  2W66 A;  2A72 A;  3ZSS A;  4OYK A;  4QX8 B;  5L4H A;  3AEE A;  3I0Q A;  3PV0 F;  4ADZ A;  3Q5X A;  4AI6 A;  4EZ4 A;  2ACX A;  5HWX A;  3UU5 A;  2KWI B;  4U3C A;  5IHY A;  5LNK A;  2JQQ A;  4PK4 A;  3Q5E A;  2OLT A;  4X64 T;  3CX7 B;  4AXP A;  5DQV A;  4LFA T;  4P1N A;  3FXD B;  3N5L A;  2JRK A;  3NVO A;  3JAF A;  4TV9 E;  3RSY A;  4UV8 B;  4XAX B;  1VOM A;  2BVM A;  4MAL A;  4E7Z A;  2BS3 A;  1UUR A;  4LF6 T;  4QX7 B;  4IGU A;  4ILA A;  2L3L A;  4HWC A;  4YT0 A;  2XAQ B;  1KNR A;  3RIU C;  4MBQ A;  2Y6X A;  4O4H E;  1VRB A;  2Q9Q D;  3E0Z A;  3VU7 H;  4EYY R;  1LRZ A;  3N9M A;  3VKG A;  2D2S A;  2LEH A;  3MZK B;  5HEH A;  3ONX A;  4UVC B;  3FZM B;  3ONL C;  4X1K E;  1IBM T;  2IML A;  3UUB A;  3T1H T;  5JDM A;  3EDV A;  3OKQ A;  3ZST A;  2VWA A;  3PDY A;  4IL9 A;  2Q9Q C;  3VR9 A;  2Q9Q B;  4DR2 T;  2WCA A;  5F3J A;  4PJN A;  2LKH A;  3RHW A;  3RIU A;  2N2N A;  2CB9 A;  4ISS A;  2ZM0 A;  3FHN A;  4U2Y A;  5J2T E;  1XMO T;  5L3F B;  2CRB A;  2KT9 A;  2W61 A;  2LOP A;  3RC8 A;  1HTJ F;  2NW9 A;  2XSB A;  3UQ7 A;  2ZMA A;  4YSZ A;  2KYG A;  2LRK A;  3CX6 B;  5HXE A;  3RLF F;  3RH3 A;  3MA9 A;  3P7I A;  2JQH A;  3HKC E;  3P4Q A;  2XM1 A;  2Q9Q A; 
#chains in the Genus database with same CATH homology
 5F8P A;  2CWO A;  2C5K T;  3MXZ A;  4G63 A;  3PUA A;  2CEA A;  2UXX B;  3QK6 A;  2CXF A;  4U74 A;  4J2C A;  4UIG A;  3AAA B;  3ZC1 A;  1G73 A;  4NUV A;  3CPZ A;  3IBP A;  3PUG A;  4EIW A;  4UVB B;  4PNI A;  3VHL A;  2CA5 A;  4CI1 B;  3AVR A;  2BZB A;  3IEE A;  3NRY A;  2DI4 A;  4AKH A;  3C4Z A;  4KP3 C;  4O2B E;  2K9A A;  1SHZ C;  4ILU A;  5LGU B;  3UFE A;  2L9Q A;  1UX5 A;  2X9H A;  3KBU A;  2LSK A;  5LJN A;  4QWN B;  5LJM A;  2K48 A;  4EYU A;  3LK4 2;  4QKN A;  1HG5 A;  4HE8 A;  2L8K A;  2CLY C;  1YKH B;  3BK9 A;  2CXD A;  3HR0 A;  5JDF A;  3ZMT B;  2QGS A;  2CMR A;  2A2F X;  3WAJ A;  4CQI A;  5HXC A;  2MTQ A;  5KX5 E;  2G0U A;  1MND A;  4JUY A;  3O9X A;  2B1E A;  4P0A A;  3CVR A;  1D0Z A;  4EXT A;  2ODV A;  4HGA A;  1HX8 A;  5HXS A;  1BR2 A;  3KV5 A;  4ZS2 A;  3TKL B;  5KMG P;  3QC9 A;  2PJQ A;  2HPL A;  4BJM A;  4O4I E;  3H3A A;  4KMC A;  1H7C A;  4GK0 E;  3Q5W A;  3PMI A;  1Y64 B;  5IYZ E;  1YD8 G;  1LKX A;  3T8O A;  2XUE A;  1BR0 A;  2XAS B;  3PU3 A;  5FXW A;  3ZCJ A;  3NZQ A;  5JQG E;  2E8I A;  4QXB B;  1B7T A;  3HA4 A;  4HN9 A;  4YLH A;  3UUN A;  1MMD A;  2WSS V;  5L3D B;  2LT3 A;  3NRX A;  4YJ2 E;  1D1A A;  4L5G A;  3HL6 A;  4BAY B;  2W0G A;  1U5P A;  2X9W A;  4EZH A;  3CX8 B;  2C5J A;  3CWZ B;  2XAJ B;  4H63 H;  5E0O A;  3CQX C;  2YU2 A;  4GYR A;  3ETV A;  5J1G A;  2W00 A;  2KMF A;  4PW8 A;  1Z0P A;  4H9S E;  4HKA A;  4DBR A;  2EHO D;  1CUN A;  5FMN A;  3WI3 A;  4IDZ A;  2WM9 A;  2X51 A;  3OJA A;  3PE0 A;  2H3R A;  4M1P A;  4A56 A;  2K9Q A;  1ZHC A;  3LG7 A;  3ZYK A;  5LBM A;  1KK7 A;  5KDM C;  3GMI A;  2YU1 A;  1YKE B;  2DNX A;  4IE4 A;  5JDL A;  2A3D A;  3EDU A;  2ZLY A;  4CI3 B;  5JRE A;  2PG8 A;  3PU8 A;  5FY0 A;  4KUM B;  3KV9 A;  2PBI A;  4I43 B;  4U72 A;  3ZLI A;  2H7O A;  1IJ5 A;  2HH7 A;  3CQC B;  1YW0 A;  2VB6 A;  4C90 A;  3C64 A;  3AA1 B;  4EOZ B;  3L09 A;  3SRZ A;  5H6Q B;  2LSY A;  2CM0 A;  5HWY A;  3UUX B;  3ZC0 A;  2NP9 A;  3N9L A;  3I9W A;  1MIV A;  1MMG A;  5L2L A;  3C98 B;  2VL8 A;  2E9X D;  3F2E A;  2QA7 A;  3Q9D A;  5FY1 A;  3HKD E;  4GIW A;  2X66 A;  5JDH A;  5M4Y A;  4MLK A;  4UF0 A;  3K3O A;  2W62 A;  1BR1 A;  4WNK A;  5L3B B;  4HFV A;  1QUU A;  2OA5 A;  4E7S A;  4UVA B;  2ZM2 A;  2Y8D A;  4GK5 E;  1D0Y A;  3N9O A;  2OUT A;  3ZEF B;  5AFU L;  1EZ3 A;  1NWM X;  4H9R C;  4H9P C;  3O1I A;  3D0T A;  2EHO B;  4O4L E;  3I0O A;  4PJM A;  4TX5 A;  4JEH B;  4AQF C;  4PK6 A;  1WRD A;  4JEU B;  2V7J A;  4DO0 A;  4Z8X A;  1MMA A;  2D0U A;  2BVL A;  3UUM A;  3PUR A;  3RPU A;  3ZJ2 A;  5LG4 A;  4WBN E;  2PFV A;  4IIJ E;  3ZJ1 A;  1G8X A;  3ZN0 B;  3L3P A;  4UV9 B;  1WR6 A;  4UEM A;  4WBO A;  3AVS A;  2YK0 A;  3I9Y A;  4OYJ A;  1KNZ A;  3ESL A;  5JH7 E;  2VKO A;  2X68 A;  2YEV C;  4X20 E;  1HFA A;  3OBV E;  4B6X A;  2E9X C;  1ZV4 X;  4IE6 A;  3CQG B;  1HCI A;  5LCY A;  5EK4 A;  4YHJ A;  3EVY A;  2E9X B;  3AB3 B;  4QHO A;  3O1J A;  3RKO A;  2DLR A;  3RYI E;  2V7I A;  1OXZ A;  4G2A A;  4MFR A;  4XZC A;  3O4X E;  4X1Y E;  3K3Q C;  3N2G E;  2CWY A;  4CZZ B;  4BJN A;  4TN7 B;  3AA6 B;  2WMO A;  3R84 B;  3WAK A;  5CA0 E;  4AKG A;  3HKE E;  2VK9 A;  3KDS E;  3KBT A;  3OYZ A;  3DJB A;  5LBQ B;  2V1D B;  4GYS A;  4AQG A;  5L3G B;  5FYM A;  3FB2 A;  5A1L A;  2VAS A;  1WYC A;  2LE8 A;  2V7K A;  3QUJ A;  4FI5 A;  4I4T E;  4YJ3 E;  3RC3 A;  2KND A;  2EHO A;  3RX6 A;  4K0U A;  3Q2M A;  1V9D A;  3RRC A;  3SOL A;  3C4X A;  2CE7 A;  2KXP B;  2N1G A;  2X0L B;  4EB6 E;  1SA0 E;  2GK9 A;  4AQF A;  2X9Y A;  2MOZ A;  3KIN B;  4ZS3 A;  4IST A;  3RYH E;  4ZI7 E;  5DAB A;  2KLQ A;  2H7V C;  4I55 E;  3ZMZ B;  1BR4 A;  2DWG A;  3KVB A;  4C91 A;  1FIO A;  2JMH A;  1MNE A;  5FXZ A;  4L0R A;  1MIW A;  2MBG A;  1HS7 A;  2MYS A;  3EUH A;  3ZPO A;  4N78 D;  2WWU A;  1D1B A;  5HXH A;  3J9X 1;  5ETW A;  4TV8 E;  4NUU A;  3IF8 B;  1IJ6 A;  5HYA A;  4HTE A;  4H63 V;  1FEW A;  5FNV E;  4ERR A;  2E9X A;  3KV4 A;  4UXN B;  4ASK A;  5LP6 E;  1NAF A;  3LK2 B;  5LOV E;  1O3X A;  2NW8 A;  2RA1 A;  2NW7 A;  4DVD A;  3MK7 C;  3ZMS B;  4JLE A;  3R6N A;  5TAO A;  4AKL A;  3LJC A;  3U78 A;  3ANW B;  2WMN A;  3LK3 B;  3MJX A;  2YIN A;  2CXL A;  1AJ3 A;  3NZP A;  3ZN1 B;  5L3E B;  2LHN A;  3FBL A;  4ZHQ E;  1ZKE A;  2X67 A;  3SWH A;  2KIN B;  5DQW A;  2LSG A;  3PUQ A;  2CCQ A;  4P0B A;  4DBQ A;  2WBL A;  4DMV A;  2RQY A;  5BMV E;  5JDN A;  4KBM B;  3F31 A;  5EK3 A;  3CKD A;  1LVF A;  2XAF B;  3I1A A;  2V7L A;  4IE7 A;  2ES0 A;  5FY7 A;  3K8P C;  3ZMV B;  2V7M A;  1X79 A;  3N9P A;  4PFO A;  1US7 B;  5JDQ A;  4PK5 A;  3J7Y q;  1FMV A;  2NTX A;  1S94 A;  2ZM8 A;  2EHO C;  5DJQ C;  3UTK A;  2I59 A;  1UX4 A;  3MAC A;  3S4U A;  2A72 A;  5C8Y E;  3RYC E;  4OYK A;  5JR9 C;  4QX8 B;  3P8C D;  2N9D A;  2LM9 A;  2P9B A;  1HF8 A;  4WW0 A;  3ZYL A;  3BQK A;  4ZI3 D;  3LBX B;  2LSJ A;  3AAE B;  3UUL A;  5JR9 B;  4CXY A;  3I0Q A;  2XQY A;  1UCU A;  4ADZ A;  3Q5X A;  3LFM A;  4AI6 A;  4X1I E;  4EZ4 A;  2ACX A;  2HPJ A;  5HWX A;  2K5B B;  5CB4 E;  3BQL A;  2KWI B;  2IC6 A;  5ADX L;  1OWA A;  5H6R B;  2W63 A;  4TZ4 C;  3HKB E;  1D1C A;  5IHY A;  3AA0 B;  5LNK A;  2JQQ A;  4CXX A;  1QSD A;  2D5U A;  4PK4 A;  5JRC B;  3ANW A;  4OHF A;  3ZYM A;  3ZMU B;  4DND A;  4TUY E;  3CX7 B;  4AXP A;  1LVK A;  2VKD A;  5DQV A;  2X9X A;  4H9Q C;  2UXN B;  3AAI A;  5FP3 A;  1U4Q A;  1IAP A;  2Y48 B;  2NWB A;  1HG2 A;  3FXD B;  3N5L A;  4ZI2 D;  2LJL A;  2M67 A;  3JC6 D;  2JRK A;  3V5S A;  4TV9 E;  3NBX X;  4O4J E;  4UV8 B;  2IAK A;  4XAX B;  1VOM A;  2BVM A;  4MAL A;  5HAX A;  4E7Z A;  4GOU A;  5LHH B;  5EZY E;  4QX7 B;  4I50 E;  4IGU A;  4H9O C;  2L3L A;  2XAQ B;  3GA8 A;  3VKH A;  1MMN A;  2BDE A;  3DP7 A;  4MBQ A;  2Y6X A;  3PUS A;  4IE0 A;  4O4H E;  3AA7 B;  4O2A E;  4ZI3 C;  1VRB A;  2Q9Q D;  3E0Z A;  4L9I A;  3VU7 H;  2XTL A;  1IZN B;  2WAU A;  5LHG B;  2KNG A;  4EYY R;  1LRZ A;  2DCF A;  5EK2 A;  4QXH B;  4CXW A;  2XAG B;  3LBX A;  3N9M A;  5JR9 A;  3KV6 A;  5J2U E;  2D2S A;  3VKG A;  5L3C B;  2CLY B;  2LEH A;  3O1H A;  2LHR A;  3MZK B;  5CA1 E;  2ODU A;  4BA9 A;  3ONX A;  5FXV A;  4UVC B;  4EAH A;  2LSI A;  1WLX A;  3ETU A;  3BQI A;  4ZI2 C;  2J1D G;  5JVD E;  5JRC A;  4X1K E;  5FXX A;  2DWK A;  3CML A;  3JC6 C;  3B13 A;  4MHC A;  3F57 A;  4UEL A;  5JDM A;  3EDV A;  3N2K E;  3OKQ A;  2JPF A;  2XAH B;  3KVA A;  4DMW A;  2Z6E A;  4UF0 B;  4AKI A;  2VWA A;  2C5I T;  5LGT B;  4AKR B;  3PDY A;  3HI2 A;  4P09 A;  4QXC B;  3UT5 E;  3OYX A;  3C51 A;  2NOX A;  4HEA A;  3GWH A;  3GN5 B;  4YFS A;  4PFP A;  5JDG A;  1S35 A;  3RRW A;  3E22 E;  2Q9Q C;  3W15 B;  4IE5 A;  2K24 A;  3KFW X;  4PAG A;  3N9N A;  3PTR B;  2NTY A;  5HXR A;  2Q9Q B;  4V1A v;  3U3I A;  1MIY A;  3C50 A;  5F3J A;  4PJN A;  2RP4 A;  2IW5 B;  2N2N A;  3H37 A;  2JJ9 A;  5LXT E;  2CB9 A;  4ISS A;  4H9N C;  4F6R C;  3RYF E;  5LGN B;  2ZM0 A;  5LHI B;  2SPC A;  3FXE B;  2D0T A;  3FHN A;  4XBF B;  2KWH A;  3V5U A;  5J2T E;  5L3F B;  5LYJ E;  4PJJ A;  2KT9 A;  3A5X A;  2V26 A;  2W61 A;  3SS1 A;  4CI2 B;  2LOP A;  3B57 A;  3ZCI A;  2CBG A;  2VKH A;  3RC8 A;  2JMK A;  1HTJ F;  3N9Q A;  3IHR A;  2DHR A;  1FMW A;  2NW9 A;  1T98 A;  2ZMA A;  3FBZ A;  4PJL A;  2KZ7 B;  3K3N A;  5GON E;  4O8S A;  3DTO A;  2LOS A;  4ZOL E;  3CX6 B;  2VKJ A;  5HXE A;  4IHJ E;  4OFZ A;  4OK0 A;  1ZEE A;  2XHE B;  1D0X A;  1WYB A;  3MKD A;  3RH3 A;  3GN5 A;  3E08 A;  2C0S A;  3MA9 A;  3P7I A;  2IC9 A;  3M65 A;  4ANJ A;  3N2O A;  3HKC E;  5LA6 E;  3C4W A;  4FJO A;  2Q9Q A;  1E1H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...