3GWHA

Crystallographic ab initio protein solution far below atomic resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
HSQLMAQLVEVIEDSFQMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLMLLLKNEYPLCYNTAWKLIKILQQTLKKPVHEAEAVYLTLHLIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic ab initio protein structure solution below atomic resolution
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Transcriptional antiterminator (BglG family)
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gwhA02
1.20.890.100 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3gwhA01
3UFEA 3GWHA
chains in the Genus database with same CATH superfamily
4YY3T 2ODUA 4IHJE 4PAGA 3ZLIA 3AE1A 3HKBE 2KNGA 4G2AA 2Y8DA 5M4YA 2YINA 4DUZT 1SE7A 4IDPA 3FXEB 4NXMT 2ODVA 5HEHA 3R6NA 1N33T 4O2AE 2V7LA 4YJ3E 4YTMA 4AKIA 2CXLA 1NENA 4PFOA 4PFPA 5HCMA 2UUCT 2A3DA 2NW7A 1W0AA 3AVRA 1BR0A 2V7KA 4UXNB 4H63V 3ZJ2A 1W0BA 4QHOA 1Z0PA 2RP4A 2G0UA 3W15B 3PUVF 2MBGA 5LMUT 3T1YT 1HX8A 2QGSA 2HPJA 2B76A 3VHLA 4AQYT 5TAOA 4WNKA 4UIGA 2JQHA 4MLKA 4UF0B 4AIUA 4H9NC 4AKGA 2HN1A 2CA5A 3JAFA 4DIDB 3RPUA 3EDUA 2DLRA 1E7PA 2WQYA 5JDLA 2XAHB 4HE8A 4HFDA 2NR4A 5FP3A 2V6YB 1KNPA 2LE8A 3KVAA 3NVOA 4Z90A 3AB3B 2Q9QA 1D1CA 2R6GF 4IE6A 4YHJA 3SOLA 2LLYA 3UU5A 3RGLA 3L3PA 1CUNA 2MTQA 2P9BA 3P8CD 4OFZA 3NRXA 5ETWA 5H6RB 2X9HA 3IBPA 4ILAA 2I6HA 1MIYA 1JNZA 1MNDA 3ANWB 2QVAA 3CK6A 3CX7B 4U7IA 3RIFA 1VCTA 3S4AA 5BR8T 2VQET 1LVKA 4ZEYA 1UX4A 3C4ZA 2N1GA 3P4RA 1KFYA 2C5KT 2HPLA 5AQIB 5AQOB 3RIUC 4YFSA 3CQGB 4B6XA 2D0TA 2FUPA 1MMNA 4DV6T 1D1BA 3FB2A 4JYAT 3MA9A 4DR1T 4ERRA 2VWAA 3RIAA 5LHGB 2DCFA 3B57A 1J5WA 2J62A 4JI1T 2K9QA 4HEAA 2BG9E 3JCFA 2FBWA 4ILUA 4PJLA 4LF9T 2AXDS 2C5JA 2L8KA 3QFZA 2J47A 2Z6EA 3RF1A 3N9NA 2WAUA 1XNRT 4DBQA 2C5IT 1OEDB 4IE7A 3G06A 2BDEA 4UV8B 2WY2A 2NTYA 4MBQA 5FYMA 2UXDT 2X0YA 3Q5DA 5C8YE 3ZJ1A 3FZKB 2XQ3A 2JMHA 3AE7A 1N32T 1XZYA 3QB5K 1UX5A 4JI3T 2IHR1 3O1IA 5FXVA 2ZMAA 3JAEA 3PUQA 4O4IE 5FXXA 5JR9A 3SS1A 3ZC1A 4DV2T 5CFBA 4JI2T 2J4GA 3L09A 4NUUA 4PK6A 3V5SA 2VKOA 4JI5T 2IC6A 2XAFB 2X51A 3HKCE 5JTGA 3QFYA 1J1JA 2CEAA 2WDVA 2X9YA 3DTOA 3ETUA 2WS3A 2IDOB 3GMIA 4KBMB 2X66A 3O1HA 5JRCA 4UV9B 4CQIA 3K3NA 3RLFF 2EHOC 3H3MA 2HN2A 5LOVE 3VKHA 2YEVC 5F3JA 2WWUA 4B3ST 1KNRA 4JI7T 2VKHA 2XHEB 3M3ZB 1VOMA 4AKRB 1U5PA 3CX8B 3OPCA 1FJGT 3KV9A 4QKNA 1HTJF 5JDFA 3PE0A 3CQXC 4XAXB 2IZYA 2CPTA 2WDQA 1G8XA 3ONLC 2EHOB 4TUYE 4I0UA 5LG4A 5LJNA 2KT9A 2QRXA 3S4CA 5ADXL 1YKEB 5HYAA 5J2UE 2RA1A 5ABFA 1YW0A 3N9QA 2B1EA 5HEJA 4DR7T 5IHYA 1FIOA 3X1DA 4L9IA 3KDSE 4ZZCA 5LGNB 5LJMA 3PV0F 3H37A 1H7CA 2FJAA 3OJAA 1WR0A 1QUUA 2YDQA 2ZLYA 3I0QA 2BG9A 2ACZA 2BKNA 3I9WA 4U2YA 3RX6A 3PUSA 1MMDA 3P7IA 2VASA 4IDNA 5AQUB 2XQAA 3IHRA 1BR2A 4HFBA 5FKYA 2A72A 4C91A 2M67A 2F4VT 3OVUA 3RYFE 4K0KT 5FMNA 2UXBT 4TZ4C 4GKKT 1GQEA 3SWHA 1T7SA 3TLUA 2CWYA 3U78A 2KYGA 4Q25A 2CRBA 4MFRA 3R84B 4I55E 4BJMA 4CZZB 4DNDA 5IWAT 3UU3A 2LM9A 4PK5A 2N9DA 3UUBA 4DR2T 2UUBT 2LSGA 2X9XA 1XMQT 3FBZA 2I15A 2WWVA 2J1DG 2Q9QD 5E0OA 4TV8E 4U2ZA 2LEHA 4TWDA 3ZSTA 4RT4A 1S94A 2LRKA 3ZMVB 3GN5B 4ZP3A 1SHZC 4EGWA 3AEFA 3ACSA 4M1PA 3MXZA 1Y01A 5HEGA 4X5TA 3VRAA 4ISSA 1D1AA 3AAAB 5L3FB 4Z91A 3NWIA 2BVLA 4WYVA 1L6EA 4LFBT 4JBWF 4ZI3D 4UVCB 4PJJA 5AQRB 3RC3A 3FBLA 5IUXA 4YSXA 3N9OA 3VU7H 4LF6T 3VKGA 4MHCA 4DV0T 4HWFA 3J7Yq 1HG2A 3QB5A 1BR4A 4LMJA 4U7YA 2WU5A 2V6XA 1AJ3A 3T1HT 3D0TA 1S35A 3AAIA 4GK5E 2H7OA 4EIWA 4X65T 3RRCA 1WR6A 2PG8A 2XAQB 3LG7A 3VR9A 4YJ2E 4HGAA 3SFEA 5LXTE 1N36T 4ISTA 3PU8A 3UULA 1EZ3A 2WZIA 4JEHB 4X1YE 2BG9B 4RIQA 2NP9A 2KWHA 4EB6E 3QUJA 4TNVA 1XWMA 4U31A 3F2EA 2JQQA 3RYHE 5LP6E 2LM2A 4U72A 5ABGA 5CA1E 3A5XA 4UF0A 4YLHA 5LA6E 4IT4A 1SA0E 2XPKA 1CHUA 2ACXA 3CX6B 3PMIA 3MACA 4L5GA 2KNDA 2XTLA 2W62A 3ESLA 2CM0A 4NXNT 1YQ3A 3MZKB 3PURA 3NRYA 3F31A 3N5LA 4WBNE 5KMGP 3CPZA 3ABVA 4U33A 2C0SA 2JMKA 1X79A 3F57A 4QX7B 2E2AA 2E9XC 3AE2A 2AE9A 3RKGA 5HAXA 5BMVE 3O4XE 2IC9A 3UQ4A 2WP9A 3KFWX 2H3RA 5AQSB 3RYIE 4LMKA 1V9DA 3PJAJ 2CB9A 5EK4A 2ZM0A 2X68A 3CVRA 2DI4A 2MYSA 4NIQA 4PJMA 1XMOT 4TWHA 2ZM6T 3Q5XA 1UK5A 5FXZA 1OEDC 3C4WA 1Z8UA 1LRZA 1HX1B 3Q2MA 4NUVA 4YSZA 2LKHA 4X20E 4YHHT 5CGMA 3IM3A 3K1SA 3H3AA 3LK2B 5HXSA 2VQFT 4EYUA 2VB6A 3C4XA 2CCQA 3KBUA 5AQPB 2PFVA 4JLEA 2IIUA 3C51A 2CLYB 2XQ9A 1R2AA 3HL6A 4O2BE 4QXCB 5AQHB 1MMGA 5LCYA 1OEDA 3RQUA 4IDQA 1DU2A 2H7VC 2QYWA 2X67A 3CKDA 4CN4A 4LF5T 4HFIA 4CI1B 5AQKB 1FEWA 2VVNA 1ZV4X 3LJCA 2IW5B 2JPFA 3MK7C 3TLWA 4AKHA 1G73A 4F9KA 3ZPOA 4YTNA 5DQWA 4DR6T 1MMAA 4I4TE 4IDZA 4HFVA 5ABHA 1ZP0A 5AQVB 4DV7T 4KI0F 3UT5E 1IBLT 2CQTA 2A2FX 2E5LT 2E9XA 4HFEA 2D0UA 2BG9C 3OTOT 2V6YA 2CQSA 2XSBA 1OWAA 5IYZE 4DR4T 2YDSA 5AQQB 5LBQB 2D9DA 3UFEA 4H9SE 4A97A 5C2TA 3JADA 5FY1A 3J9X1 2W00A 2DNXA 4N78D 3EI0A 5HXHA 3TKLB 4ADZA 2I0MA 3N2KE 1KEYA 2DWGA 5FVLA 4OK0A 5L3GB 2OA5A 4PNIA 1WYBA 2A9UA 2YU1A 4YSYA 3ZCJA 3E08A 4CXYA 2W66A 1KNZA 2IAKA 4I43B 2KXPB 1FMWA 2YOEA 4AKLA 4AQFA 2EHOA 2CE7A 1IBMT 1NAFA 2QA7A 1WLXA 3FHNA 2WMOA 2XASB 4U74A 3K8PC 3CIRA 4LF8T 5ABFB 3RRSA 1HF8A 3UTKA 5LHIB 1O3XA 1I6ZA 4ZI3C 4E7ZA 1WFDA 3UUNA 2LT3A 4TV9E 2NOXA 3RH3A 5J0ZA 3P4SA 4HTEA 4OHFA 4QH5A 5JDMA 4U3CA 4H9PC 1UGOA 4QXHB 1T98A 4GIWA 4PK4A 4BJNA 5JR9C 3RSYA 2NW8A 2PJQA 5AQMB 2E9XD 3AA7B 5CA0E 4QXBB 2RPAA 2XQ7A 4HWDA 5LB7B 4BAYB 5L3BB 4QX8B 2ES0A 1XDPA 2XM2A 3AEGA 3LSVA 3NZQA 2V7JA 3HR0A 2K9AA 3P4QA 4WZXA 4DR3T 4P0AA 2LSJA 3ZMTB 2DHRA 4GYRA 4KP3C 4IGUA 4ILBA 5AQLB 4ZS2A 2NW9A 5EK2A 1IBKT 4E7SA 5DABA 1M62A 3EHZA 3LK42 3IEEA 3PUAA 2E9XB 4ZOLE 3VRBA 5C3JA 4DV1T 2LOSA 5F5WA 3ZT7A 2VL8A 2KLQA 2LJLA 3LDQB 3WI3A 4QH1A 2NWBA 3PUZF 2VKJA 3QNUA 2V7IA 3HA4A 4EV6A 1ZOYA 5ABEA 4DMVA 3N9LA 5J2TE 4DV5T 2WZHA 1HNWT 2LKGA 4H63H 1YKHB 3RIUA 4LF4T 2M6IA 3A7MA 4KHZF 4OYKA 2WSSV 1UCUA 1YD8G 3LBXA 2XSAA 3LFMA 3MKDA 2VKDA 3P4PA 2VL0A 2KSRA 4TNWA 3K3OA 4UR9A 3QOFA 4CI2B 2CHNA 3OBVE 4H9RC 2Q9QC 2VURA 3E22E 4FI5A 5LGUB 3RC8A 2OLTA 5HEUA 1KF6A 2DL1A 2CLYC 5FXWA 5A1LA 4EEDA 2FJDA 4PW8A 2W0GA 1BR1A 5LHHB 2WB5A 4CXWA 2YN6A 4ZI7E 1ZEEA 3Q9DA 3AA0B 4AI6A 1HCIA 3AVSA 3PUXF 3BK9A 2GK9A 4A56A 5HWXA 4TX5A 3BQIA 1NEKA 4FJOA 2YKSA 3RQWA 1B7TA 2DWKA 3GA8A 4F6RC 4DO0A 3EDVA 2MAWA 2UXXB 5JDNA 3C64A 2XAGB 3JC6C 4V1Av 4GKJT 3PDYA 3AA6B 2LOPA 3CMLA 3PTRB 5F8PA 1L0VA 2LSIA 4OYJA 2JRKA 4EXTA 4X1IE 3C98B 2XJ7A 1KK7A 2XY8B 4PJNA 3S4UA 4O4JE 2WDRA 5FL1A 3WAJA 1ZKEA 2N2NA 3RI5A 4HWCA 1D0XA 3PU3A 4ZI2D 5JREA 2L9QA 2Y6XA 3AECA 3NZPA 4O4LE 3ZYKA 4LFAT 4DV3T 2BS4A 3WAKA 4HWHA 3EUHA 4G63A 3JC6D 4IE4A 2LSYA 3KBTA 1IAPA 2OV9A 3PUYF 3KV6A 3ZEFB 4GYSA 2ZM2A 3ZCIA 4O8SA 4IREA 2EHOD 3BQLA 3ZYMA 2UU9T 2LSKA 3OYXA 3UU6A 1XDOA 1JNRA 2E8IA 4UVAB 4UEMA 4AQGA 5AQNB 3ANWA 4F8HA 4UVBB 4LFCT 2XUEA 4HFHA 2V8SV 4J2CA 3LBXB 1QLBA 4L0RA 4AISA 5CB4E 2XAJB 5FY7A 1E2AA 2H88A 2BZBA 4CI3B 5J1GA 3PUWF 4KUMB 3EABA 4TN7B 3EVYA 4H9QC 2W63A 2XQYA 5JVDE 2VK9A 3TLSA 3QK6A 3HKEE 3K3QC 2XQ6A 4MALA 5HXCA 1I94T 2JQKA 1WRDA 2W2UA 3GWHA 3ZC0A 2I59A 1D0YA 2D5UA 4WBOA 4ZXLA 2JIWA 4X62T 4B3RT 4IIJE 2K24A 1NWMX 3L8RA 3VR8A 2L3LA 3U3IA 5HWYA 2CXFA 3ONJA 3UUMA 4X64T 1LVFA 3AE9A 3TLTA 2YU2A 2BKPA 4CXXA 4H9OC 5L47A 3RKOA 4IL4A 1HS7A 3ZKRA 5EK3A 3E0ZA 2CBIA 3IA3A 1US7B 3PJAA 3QG0A 3ZMZB 3A8YC 3V5UA 2W67A 3NKZA 4BA9A 1WYCA 5LGTB 4HN9A 1T8BA 3AAEB 3AEBA 4WW0A 3ETVA 3ZT6A 5JR9B 3NBXX 2FJEA 3N2OA 4DV4T 3HI2A 3KVBA 5FY0A 2BKOA 5AQJB 1FMVA 1W9RA 3I9YA 4COFA 3OKQA 4JV5T 2OUTA 2Q9QB 3UFGA 3ZT5A 4ANJA 2KWIB 5KXJA 3SFDA 3ZN1B 3AEAA 2XQ5A 1M7KA 3Q5EA 3O1JA 1OXZA 1J5ET 4TWFA 5JH7E 2LRLA 4XZCA 2RQYA 3N9MA 4EZHA 3Q5WA 4P0BA 2FJBA 1HR0T 3SRZA 3ZN0B 2WU2A 3DP7A 2JJ9A 2NTXA 2XQ8A 5L4HA 3I1AA 3AXJA 5L3CB 2UXNB 2CXDA 4KHPT 5HVZA 1MIWA 5FL0A 3AE8A 3B13A 4Z8XA 1WCRA 1UURA 1QSDA 5L2LA 3G36A 3IM4A 1HNXT 5JDQA 1HG5A 4JUYA 3ZYLA 2W61A 4IL9A 4AXPA 2XQ4A 4JI0T 4RTAA 3MJXA 4X66T 1R8IA 1VCSA 3N2GE 4ASKA 3KINB 4X1KE 3S4DA 3C50A 2LHNA 3CWZB 5LBMA 1U4QA 2X9WA 3UQ7A 2EZWA 3UUXB 2JQ9A 4JI6T 5GONE 4HFCA 1ZHCA 3ONXA 3FZHB 3RRWA 4C90A 5AQGB 4EAHA 1UUSA 2V7MA 4XBFB 1Y64B 1SUMB 4ZI2C 2HHHT 2PBIA 5KX5E 3AEDA 5H6QB 4K0UA 2KZ7B 1IJ5A 4DVDA 4EZ4A 4DR5T 2K3WA 3S4BA 2K48A 3O9XA 2HH7A 3LK3B 4LF7T 4HKAA 4GOUA 5EZYE 5HCJA 2V26A 2W4XA 2IMLA 3KV5A 3FZFB 5LNKA 5HXRA 3BQKA 3FZMB 2LHRA 2SPCA 3GN5A 4LMLA 4O4HE 3T8OA 3ZMSB 2M6BA 3M65A 2UUAT 3AEEA 3L39A 3AE5A 2D2SA 5HEOA 2V5CA 2KMFA 2MPKA 3I0OA 4YT0A 1HNZT 4ZS3A 1LKXA 5FVKA 4JEUB 2CBGA 4GK0E 5DQVA 3KV4A 4B3TT 1W09A 4KX6A 3OYZA 3EAMA 4A98A 5HXEA 3TLVA 5L4EA 2IUBA 2MOZA 2KINB 4ILCA 5JQGE 4NPPA 5DJQC 3AXJB 1YQ4A 2BBJA 4EEBA 4P09A 4ZHQE 5LMNT 1HFAA 1MNEA 5L3DB 4EOZB 5LYJE 4IDOA 4JI8T 5JDGA 4YTPA 5JDHA 3IF8B 4DBRA 2YDRA 2K5BB 3ACTA 1XNQT 4UELA 3DJBA 2BBHA 2BS2A 2PTFA 1MIVA 4P1NA 4QWNB 3RYCE 1X9BA 2BS3A 2CWOA 2E5VA 2ZM8A 4IE0A 4OX9T 3QDEA 4DMWA 4A5XA 3PUGA 4IE5A 2WBLA 5FNVE 2XM1A 3AA1B 5L3EB 2CHOA 5AQTB 3RHWA 4JI4T 2WM9A 1E1HB 1YXRA 5CJ5A 4CN6A 2VVSA 1OEDE 3N9PA 2WCAA 2UXCT 1IJ6A 4ZZBA 5AQFB 2Y48B 3ZMUB 3ZSSA 3AE3A 3AE4A 3CQCB 5KDMC 2X0LB 4YXDA 2H9RA 3AFJA 4EYYR 2V5DA 3B5MA 3P4WA 3P50A 3FXDB 2XZEA 4KMCA 5JRCB 2CMRA 2BVMA 2V1DB 2X0HA 4I50E 2H89A 3AE6A 5LG3A 1IZNB 3HKDE 5AFUL 4DUYT 1D0ZA 2CBJA 3FZLB 4HWIB 4B3MT 2DRNA 2YK0A 3QC9A 1T72A 2WMNA 1VRBA 3UU4A 1N34T 4CN1A 4QH4A 3UU8A 4AQFC
chains in the Genus database with same CATH topology
2ODUA 4IHJE 4PAGA 3ZLIA 3HKBE 2KNGA 4G2AA 2Y8DA 5M4YA 2YINA 3FXEB 2ODVA 3R6NA 4O2AE 2V7LA 4YJ3E 4AKIA 2CXLA 4PFOA 4PFPA 2A3DA 2NW7A 3AVRA 1BR0A 2V7KA 4UXNB 4H63V 4QHOA 1Z0PA 2RP4A 2G0UA 2MBGA 1HX8A 2QGSA 2HPJA 3VHLA 5TAOA 4WNKA 4UIGA 4MLKA 4UF0B 4H9NC 2CA5A 3RPUA 3EDUA 2DLRA 2XAHB 4HE8A 5FP3A 2LE8A 3KVAA 3AB3B 2Q9QA 1D1CA 4IE6A 4YHJA 3W15B 3SOLA 5L3GB 3L3PA 1CUNA 2MTQA 2P9BA 3P8CD 4OFZA 3NRXA 5ETWA 5H6RB 2X9HA 3IBPA 3ZJ2A 1MIYA 1MNDA 3ANWB 3CX7B 1LVKA 1UX4A 3C4ZA 2N1GA 2C5KT 2HPLA 4YFSA 3CQGB 4B6XA 2D0TA 1MMNA 1D1BA 3FB2A 3MA9A 4ERRA 2VWAA 5LHGB 2DCFA 3B57A 2K9QA 4HEAA 4ILUA 4PJLA 2C5JA 2L8KA 2Z6EA 3N9NA 2WAUA 4DBQA 2C5IT 4IE7A 2BDEA 4UV8B 2NTYA 4MBQA 5FYMA 5C8YE 2JMHA 1UX5A 3SS1A 3O1IA 5FXVA 2ZMAA 3PUQA 4O4IE 5FXXA 5JR9A 3ZC1A 3L09A 4NUUA 4PK6A 2VKOA 2IC6A 2XAFB 2X51A 3HKCE 2CEAA 2X9YA 3DTOA 3ETUA 3GMIA 4KBMB 2X66A 3O1HA 5JRCA 4UV9B 4CQIA 3K3NA 2EHOC 5LOVE 3VKHA 2YEVC 5F3JA 2WWUA 2VKHA 2XHEB 4AKRB 1VOMA 1U5PA 3CX8B 3KV9A 4QKNA 1HTJF 5JDFA 3PE0A 3CQXC 4XAXB 5LG4A 1G8XA 5LJNA 2EHOB 4TUYE 2KT9A 5ADXL 1YKEB 5HYAA 5J2UE 2RA1A 1YW0A 3N9QA 2B1EA 5IHYA 1FIOA 5LGNB 4L9IA 3KDSE 5LJMA 3H37A 1H7CA 3OJAA 3ZJ1A 3I0QA 1QUUA 2ZLYA 3RX6A 3U78A 3I9WA 3PUSA 1MMDA 3P7IA 2VASA 3IHRA 1BR2A 4C91A 2A72A 2M67A 3RYFE 5FMNA 4TZ4C 3SWHA 2CWYA 4MFRA 3R84B 4I55E 4BJMA 4CZZB 4DNDA 2LM9A 4PK5A 2N9DA 2LSGA 2X9XA 3FBZA 2J1DG 2Q9QD 5E0OA 4TV8E 2LEHA 1S94A 3ZMVB 3GN5B 1SHZC 4M1PA 3MXZA 4ISSA 1D1AA 3AAAB 5L3FB 2BVLA 4ZI3D 4UVCB 4PJJA 3RC3A 3FBLA 3N9OA 3VU7H 3VKGA 4MHCA 1HG2A 1AJ3A 1BR4A 3D0TA 1S35A 3AAIA 4GK5E 2H7OA 4EIWA 3RRCA 1WR6A 2PG8A 2XAQB 3LG7A 4YJ2E 5LXTE 4HGAA 4ISTA 3PU8A 3UULA 1EZ3A 4JEHB 4X1YE 2NP9A 2KWHA 4EB6E 3QUJA 3F2EA 2JQQA 3RYHE 5LP6E 4U72A 5CA1E 3A5XA 4UF0A 4YLHA 5LA6E 1SA0E 3PMIA 2ACXA 3CX6B 3MACA 4L5GA 2KNDA 2XTLA 2W62A 3ESLA 2CM0A 3MZKB 3PURA 3NRYA 3F31A 3N5LA 4WBNE 5KMGP 3CPZA 2C0SA 2JMKA 1X79A 3F57A 4QX7B 2E9XC 5HAXA 5BMVE 3O4XE 2IC9A 3KFWX 2H3RA 3RYIE 1V9DA 2CB9A 5EK4A 3CVRA 2ZM0A 2X68A 2DI4A 2MYSA 4PJMA 3Q5XA 5FXZA 3C4WA 3J7Yq 1LRZA 4NUVA 3Q2MA 4X20E 3H3AA 3LK2B 5HXSA 4EYUA 2VB6A 3C4XA 2CCQA 3KBUA 2PFVA 4JLEA 3C51A 2CLYB 3HL6A 4O2BE 4QXCB 1MMGA 5LCYA 2H7VC 3CKDA 2X67A 4CI1B 1FEWA 2IW5B 1ZV4X 3LJCA 2JPFA 3MK7C 4AKHA 1G73A 3ZPOA 5DQWA 1MMAA 4I4TE 4IDZA 4HFVA 3UT5E 2A2FX 2E9XA 2D0UA 1OWAA 5IYZE 5LBQB 3UFEA 4H9SE 5FY1A 3J9X1 2W00A 2DNXA 4N78D 5HXHA 3TKLB 4ADZA 3N2KE 2DWGA 4OK0A 2OA5A 4PNIA 1WYBA 2YU1A 3ZCJA 3E08A 4CXYA 1KNZA 2IAKA 4I43B 2KXPB 1FMWA 4AKLA 4AQFA 2EHOA 2CE7A 2OUTA 1NAFA 2QA7A 1WLXA 3FHNA 2WMOA 2XASB 4U74A 3K8PC 1HF8A 3UTKA 5LHIB 1O3XA 4ZI3C 4E7ZA 3UUNA 2LT3A 4TV9E 2NOXA 3RH3A 4HTEA 4OHFA 5JDMA 4H9PC 4QXHB 5JR9C 1T98A 4GIWA 4PK4A 4BJNA 2NW8A 2PJQA 2E9XD 3AA7B 5CA0E 4QXBB 5L3BB 4BAYB 4QX8B 2ES0A 3NZQA 2V7JA 3HR0A 2K9AA 4P0AA 2LSJA 3ZMTB 2DHRA 4GYRA 4KP3C 4IGUA 5EK2A 2NW9A 4ZS2A 4E7SA 5DABA 3LK42 3IEEA 3PUAA 2E9XB 4ZOLE 2LOSA 2VL8A 2KLQA 2LJLA 3WI3A 2NWBA 2VKJA 5J2TE 2V7IA 3HA4A 4DMVA 3N9LA 4H63H 1YKHB 4OYKA 2WSSV 1UCUA 1YD8G 3LBXA 3LFMA 3MKDA 3V5SA 2VKDA 5JDLA 3ZC0A 3K3OA 4CI2B 3OBVE 4H9RC 2Q9QC 3E22E 4FI5A 5LGUB 3RC8A 2CLYC 5FXWA 5A1LA 4PW8A 2W0GA 1BR1A 5LHHB 4ZI7E 4CXWA 4AI6A 1ZEEA 3Q9DA 3AA0B 1HCIA 3AVSA 3BK9A 2GK9A 4A56A 5HWXA 4TX5A 3BQIA 4FJOA 4F6RC 1B7TA 2DWKA 3GA8A 4DO0A 3EDVA 2UXXB 5JDNA 3C64A 2XAGB 3JC6C 4V1Av 3PDYA 3AA6B 2LOPA 3CMLA 3PTRB 5F8PA 2LSIA 4OYJA 2JRKA 4EXTA 4X1IE 3C98B 3S4UA 1KK7A 4PJNA 4O4JE 3WAJA 1ZKEA 2N2NA 5JREA 1D0XA 3PU3A 4ZI2D 2L9QA 2Y6XA 3NZPA 4O4LE 3ZYKA 3WAKA 3EUHA 4G63A 3JC6D 4IE4A 2LSYA 3KBTA 1IAPA 3KV6A 3ZEFB 4GYSA 2ZM2A 3ZCIA 4O8SA 3ZYMA 2EHOD 3BQLA 2LSKA 3OYXA 4AQGA 2E8IA 4UVAB 4UEMA 3ANWA 4UVBB 2XUEA 4J2CA 3LBXB 4L0RA 5CB4E 2XAJB 5FY7A 2BZBA 4CI3B 5J1GA 4KUMB 4TN7B 5JVDE 3EVYA 4H9QC 2W63A 2XQYA 2VK9A 3QK6A 3HKEE 3K3QC 4MALA 5HXCA 1WRDA 3GWHA 2I59A 1D0YA 2D5UA 4WBOA 4IIJE 2K24A 1NWMX 2L3LA 3U3IA 5HWYA 2CXFA 3UUMA 1LVFA 2YU2A 4CXXA 4H9OC 3RKOA 1HS7A 5EK3A 3E0ZA 1US7B 3ZMZB 3V5UA 4BA9A 5LGTB 1WYCA 4HN9A 4WW0A 3AAEB 3ETVA 5JR9B 3NBXX 3N2OA 3HI2A 3KVBA 5FY0A 1FMVA 3I9YA 3OKQA 2Q9QB 4ANJA 2KWIB 3ZN1B 3O1JA 1OXZA 5JH7E 4XZCA 2RQYA 3N9MA 4EZHA 3Q5WA 4P0BA 3SRZA 3ZN0B 3DP7A 2JJ9A 2NTXA 5L3CB 3I1AA 2UXNB 2CXDA 1MIWA 3B13A 4Z8XA 1QSDA 5L2LA 5JDQA 1HG5A 4JUYA 3ZYLA 2W61A 4AXPA 3MJXA 3N2GE 4ASKA 3KINB 4X1KE 3C50A 2LHNA 3CWZB 5LBMA 1U4QA 2X9WA 3UUXB 5GONE 1ZHCA 3ONXA 3RRWA 4C90A 4EAHA 4XBFB 2V7MA 1Y64B 4ZI2C 2PBIA 5KX5E 5H6QB 4K0UA 2KZ7B 1IJ5A 4DVDA 4EZ4A 2K48A 3O9XA 2HH7A 3LK3B 4HKAA 4GOUA 5EZYE 2V26A 3KV5A 5LNKA 5HXRA 3BQKA 3GN5A 2LHRA 2SPCA 4O4HE 3T8OA 3ZMSB 3M65A 2D2SA 2KMFA 3I0OA 4ZS3A 1LKXA 4JEUB 2CBGA 4GK0E 5DQVA 3KV4A 3OYZA 5HXEA 2MOZA 2KINB 5JQGE 5DJQC 4P09A 4ZHQE 1HFAA 1MNEA 5L3DB 4EOZB 5LYJE 4AKGA 5JDGA 5JDHA 3IF8B 4DBRA 2K5BB 4UELA 3DJBA 4QWNB 1MIVA 3RYCE 2CWOA 2ZM8A 4IE0A 4DMWA 3PUGA 4IE5A 2WBLA 5FNVE 3AA1B 5L3EB 2WM9A 1E1HB 3N9PA 1IJ6A 5KDMC 2Y48B 3ZMUB 3CQCB 2X0LB 4EYYR 3FXDB 4KMCA 5JRCB 2CMRA 2BVMA 2V1DB 4I50E 1IZNB 3HKDE 5AFUL 1D0ZA 2YK0A 3QC9A 2WMNA 1VRBA 4AQFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFE A;  3GWH A; 
#chains in the Genus database with same CATH topology
 4YY3 T;  2ODU A;  4IHJ E;  4PAG A;  3ZLI A;  3AE1 A;  3HKB E;  2KNG A;  4G2A A;  2Y8D A;  5M4Y A;  2YIN A;  4DUZ T;  1SE7 A;  4IDP A;  3FXE B;  4NXM T;  2ODV A;  5HEH A;  3R6N A;  1N33 T;  4O2A E;  2V7L A;  4YJ3 E;  4YTM A;  4AKI A;  2CXL A;  1NEN A;  4PFO A;  4PFP A;  5HCM A;  2UUC T;  2A3D A;  2NW7 A;  1W0A A;  3AVR A;  1BR0 A;  2V7K A;  4UXN B;  4H63 V;  3ZJ2 A;  1W0B A;  4QHO A;  1Z0P A;  2RP4 A;  2G0U A;  3W15 B;  3PUV F;  2MBG A;  5LMU T;  3T1Y T;  1HX8 A;  2QGS A;  2HPJ A;  2B76 A;  3VHL A;  4AQY T;  5TAO A;  4WNK A;  4UIG A;  2JQH A;  4MLK A;  4UF0 B;  4AIU A;  4H9N C;  4AKG A;  2HN1 A;  2CA5 A;  3JAF A;  4DID B;  3RPU A;  3EDU A;  2DLR A;  1E7P A;  2WQY A;  5JDL A;  2XAH B;  4HE8 A;  4HFD A;  2NR4 A;  5FP3 A;  2V6Y B;  1KNP A;  2LE8 A;  3KVA A;  3NVO A;  4Z90 A;  3AB3 B;  2Q9Q A;  1D1C A;  2R6G F;  4IE6 A;  4YHJ A;  3SOL A;  2LLY A;  3UU5 A;  3RGL A;  3L3P A;  1CUN A;  2MTQ A;  2P9B A;  3P8C D;  4OFZ A;  3NRX A;  5ETW A;  5H6R B;  2X9H A;  3IBP A;  4ILA A;  2I6H A;  1MIY A;  1JNZ A;  1MND A;  3ANW B;  2QVA A;  3CK6 A;  3CX7 B;  4U7I A;  3RIF A;  1VCT A;  3S4A A;  5BR8 T;  2VQE T;  1LVK A;  4ZEY A;  1UX4 A;  3C4Z A;  2N1G A;  3P4R A;  1KFY A;  2C5K T;  2HPL A;  5AQI B;  5AQO B;  3RIU C;  4YFS A;  3CQG B;  4B6X A;  2D0T A;  2FUP A;  1MMN A;  4DV6 T;  1D1B A;  3FB2 A;  4JYA T;  3MA9 A;  4DR1 T;  4ERR A;  2VWA A;  3RIA A;  5LHG B;  2DCF A;  3B57 A;  1J5W A;  2J62 A;  4JI1 T;  2K9Q A;  4HEA A;  2BG9 E;  3JCF A;  2FBW A;  4ILU A;  4PJL A;  4LF9 T;  2AXD S;  2C5J A;  2L8K A;  3QFZ A;  2J47 A;  2Z6E A;  3RF1 A;  3N9N A;  2WAU A;  1XNR T;  4DBQ A;  2C5I T;  1OED B;  4IE7 A;  3G06 A;  2BDE A;  4UV8 B;  2WY2 A;  2NTY A;  4MBQ A;  5FYM A;  2UXD T;  2X0Y A;  3Q5D A;  5C8Y E;  3ZJ1 A;  3FZK B;  2XQ3 A;  2JMH A;  3AE7 A;  1N32 T;  1XZY A;  3QB5 K;  1UX5 A;  4JI3 T;  2IHR 1;  3O1I A;  5FXV A;  2ZMA A;  3JAE A;  3PUQ A;  4O4I E;  5FXX A;  5JR9 A;  3SS1 A;  3ZC1 A;  4DV2 T;  5CFB A;  4JI2 T;  2J4G A;  3L09 A;  4NUU A;  4PK6 A;  3V5S A;  2VKO A;  4JI5 T;  2IC6 A;  2XAF B;  2X51 A;  3HKC E;  5JTG A;  3QFY A;  1J1J A;  2CEA A;  2WDV A;  2X9Y A;  3DTO A;  3ETU A;  2WS3 A;  2IDO B;  3GMI A;  4KBM B;  2X66 A;  3O1H A;  5JRC A;  4UV9 B;  4CQI A;  3K3N A;  3RLF F;  2EHO C;  3H3M A;  2HN2 A;  5LOV E;  3VKH A;  2YEV C;  5F3J A;  2WWU A;  4B3S T;  1KNR A;  4JI7 T;  2VKH A;  2XHE B;  3M3Z B;  1VOM A;  4AKR B;  1U5P A;  3CX8 B;  3OPC A;  1FJG T;  3KV9 A;  4QKN A;  1HTJ F;  5JDF A;  3PE0 A;  3CQX C;  4XAX B;  2IZY A;  2CPT A;  2WDQ A;  1G8X A;  3ONL C;  2EHO B;  4TUY E;  4I0U A;  5LG4 A;  5LJN A;  2KT9 A;  2QRX A;  3S4C A;  5ADX L;  1YKE B;  5HYA A;  5J2U E;  2RA1 A;  5ABF A;  1YW0 A;  3N9Q A;  2B1E A;  5HEJ A;  4DR7 T;  5IHY A;  1FIO A;  3X1D A;  4L9I A;  3KDS E;  4ZZC A;  5LGN B;  5LJM A;  3PV0 F;  3H37 A;  1H7C A;  2FJA A;  3OJA A;  1WR0 A;  1QUU A;  2YDQ A;  2ZLY A;  3I0Q A;  2BG9 A;  2ACZ A;  2BKN A;  3I9W A;  4U2Y A;  3RX6 A;  3PUS A;  1MMD A;  3P7I A;  2VAS A;  4IDN A;  5AQU B;  2XQA A;  3IHR A;  1BR2 A;  4HFB A;  5FKY A;  2A72 A;  4C91 A;  2M67 A;  2F4V T;  3OVU A;  3RYF E;  4K0K T;  5FMN A;  2UXB T;  4TZ4 C;  4GKK T;  1GQE A;  3SWH A;  1T7S A;  3TLU A;  2CWY A;  3U78 A;  2KYG A;  4Q25 A;  2CRB A;  4MFR A;  3R84 B;  4I55 E;  4BJM A;  4CZZ B;  4DND A;  5IWA T;  3UU3 A;  2LM9 A;  4PK5 A;  2N9D A;  3UUB A;  4DR2 T;  2UUB T;  2LSG A;  2X9X A;  1XMQ T;  3FBZ A;  2I15 A;  2WWV A;  2J1D G;  2Q9Q D;  5E0O A;  4TV8 E;  4U2Z A;  2LEH A;  4TWD A;  3ZST A;  4RT4 A;  1S94 A;  2LRK A;  3ZMV B;  3GN5 B;  4ZP3 A;  1SHZ C;  4EGW A;  3AEF A;  3ACS A;  4M1P A;  3MXZ A;  1Y01 A;  5HEG A;  4X5T A;  3VRA A;  4ISS A;  1D1A A;  3AAA B;  5L3F B;  4Z91 A;  3NWI A;  2BVL A;  4WYV A;  1L6E A;  4LFB T;  4JBW F;  4ZI3 D;  4UVC B;  4PJJ A;  5AQR B;  3RC3 A;  3FBL A;  5IUX A;  4YSX A;  3N9O A;  3VU7 H;  4LF6 T;  3VKG A;  4MHC A;  4DV0 T;  4HWF A;  3J7Y q;  1HG2 A;  3QB5 A;  1BR4 A;  4LMJ A;  4U7Y A;  2WU5 A;  2V6X A;  1AJ3 A;  3T1H T;  3D0T A;  1S35 A;  3AAI A;  4GK5 E;  2H7O A;  4EIW A;  4X65 T;  3RRC A;  1WR6 A;  2PG8 A;  2XAQ B;  3LG7 A;  3VR9 A;  4YJ2 E;  4HGA A;  3SFE A;  5LXT E;  1N36 T;  4IST A;  3PU8 A;  3UUL A;  1EZ3 A;  2WZI A;  4JEH B;  4X1Y E;  2BG9 B;  4RIQ A;  2NP9 A;  2KWH A;  4EB6 E;  3QUJ A;  4TNV A;  1XWM A;  4U31 A;  3F2E A;  2JQQ A;  3RYH E;  5LP6 E;  2LM2 A;  4U72 A;  5ABG A;  5CA1 E;  3A5X A;  4UF0 A;  4YLH A;  5LA6 E;  4IT4 A;  1SA0 E;  2XPK A;  1CHU A;  2ACX A;  3CX6 B;  3PMI A;  3MAC A;  4L5G A;  2KND A;  2XTL A;  2W62 A;  3ESL A;  2CM0 A;  4NXN T;  1YQ3 A;  3MZK B;  3PUR A;  3NRY A;  3F31 A;  3N5L A;  4WBN E;  5KMG P;  3CPZ A;  3ABV A;  4U33 A;  2C0S A;  2JMK A;  1X79 A;  3F57 A;  4QX7 B;  2E2A A;  2E9X C;  3AE2 A;  2AE9 A;  3RKG A;  5HAX A;  5BMV E;  3O4X E;  2IC9 A;  3UQ4 A;  2WP9 A;  3KFW X;  2H3R A;  5AQS B;  3RYI E;  4LMK A;  1V9D A;  3PJA J;  2CB9 A;  5EK4 A;  2ZM0 A;  2X68 A;  3CVR A;  2DI4 A;  2MYS A;  4NIQ A;  4PJM A;  1XMO T;  4TWH A;  2ZM6 T;  3Q5X A;  1UK5 A;  5FXZ A;  1OED C;  3C4W A;  1Z8U A;  1LRZ A;  1HX1 B;  3Q2M A;  4NUV A;  4YSZ A;  2LKH A;  4X20 E;  4YHH T;  5CGM A;  3IM3 A;  3K1S A;  3H3A A;  3LK2 B;  5HXS A;  2VQF T;  4EYU A;  2VB6 A;  3C4X A;  2CCQ A;  3KBU A;  5AQP B;  2PFV A;  4JLE A;  2IIU A;  3C51 A;  2CLY B;  2XQ9 A;  1R2A A;  3HL6 A;  4O2B E;  4QXC B;  5AQH B;  1MMG A;  5LCY A;  1OED A;  3RQU A;  4IDQ A;  1DU2 A;  2H7V C;  2QYW A;  2X67 A;  3CKD A;  4CN4 A;  4LF5 T;  4HFI A;  4CI1 B;  5AQK B;  1FEW A;  2VVN A;  1ZV4 X;  3LJC A;  2IW5 B;  2JPF A;  3MK7 C;  3TLW A;  4AKH A;  1G73 A;  4F9K A;  3ZPO A;  4YTN A;  5DQW A;  4DR6 T;  1MMA A;  4I4T E;  4IDZ A;  4HFV A;  5ABH A;  1ZP0 A;  5AQV B;  4DV7 T;  4KI0 F;  3UT5 E;  1IBL T;  2CQT A;  2A2F X;  2E5L T;  2E9X A;  4HFE A;  2D0U A;  2BG9 C;  3OTO T;  2V6Y A;  2CQS A;  2XSB A;  1OWA A;  5IYZ E;  4DR4 T;  2YDS A;  5AQQ B;  5LBQ B;  2D9D A;  3UFE A;  4H9S E;  4A97 A;  5C2T A;  3JAD A;  5FY1 A;  3J9X 1;  2W00 A;  2DNX A;  4N78 D;  3EI0 A;  5HXH A;  3TKL B;  4ADZ A;  2I0M A;  3N2K E;  1KEY A;  2DWG A;  5FVL A;  4OK0 A;  5L3G B;  2OA5 A;  4PNI A;  1WYB A;  2A9U A;  2YU1 A;  4YSY A;  3ZCJ A;  3E08 A;  4CXY A;  2W66 A;  1KNZ A;  2IAK A;  4I43 B;  2KXP B;  1FMW A;  2YOE A;  4AKL A;  4AQF A;  2EHO A;  2CE7 A;  1IBM T;  1NAF A;  2QA7 A;  1WLX A;  3FHN A;  2WMO A;  2XAS B;  4U74 A;  3K8P C;  3CIR A;  4LF8 T;  5ABF B;  3RRS A;  1HF8 A;  3UTK A;  5LHI B;  1O3X A;  1I6Z A;  4ZI3 C;  4E7Z A;  1WFD A;  3UUN A;  2LT3 A;  4TV9 E;  2NOX A;  3RH3 A;  5J0Z A;  3P4S A;  4HTE A;  4OHF A;  4QH5 A;  5JDM A;  4U3C A;  4H9P C;  1UGO A;  4QXH B;  1T98 A;  4GIW A;  4PK4 A;  4BJN A;  5JR9 C;  3RSY A;  2NW8 A;  2PJQ A;  5AQM B;  2E9X D;  3AA7 B;  5CA0 E;  4QXB B;  2RPA A;  2XQ7 A;  4HWD A;  5LB7 B;  4BAY B;  5L3B B;  4QX8 B;  2ES0 A;  1XDP A;  2XM2 A;  3AEG A;  3LSV A;  3NZQ A;  2V7J A;  3HR0 A;  2K9A A;  3P4Q A;  4WZX A;  4DR3 T;  4P0A A;  2LSJ A;  3ZMT B;  2DHR A;  4GYR A;  4KP3 C;  4IGU A;  4ILB A;  5AQL B;  4ZS2 A;  2NW9 A;  5EK2 A;  1IBK T;  4E7S A;  5DAB A;  1M62 A;  3EHZ A;  3LK4 2;  3IEE A;  3PUA A;  2E9X B;  4ZOL E;  3VRB A;  5C3J A;  4DV1 T;  2LOS A;  5F5W A;  3ZT7 A;  2VL8 A;  2KLQ A;  2LJL A;  3LDQ B;  3WI3 A;  4QH1 A;  2NWB A;  3PUZ F;  2VKJ A;  3QNU A;  2V7I A;  3HA4 A;  4EV6 A;  1ZOY A;  5ABE A;  4DMV A;  3N9L A;  5J2T E;  4DV5 T;  2WZH A;  1HNW T;  2LKG A;  4H63 H;  1YKH B;  3RIU A;  4LF4 T;  2M6I A;  3A7M A;  4KHZ F;  4OYK A;  2WSS V;  1UCU A;  1YD8 G;  3LBX A;  2XSA A;  3LFM A;  3MKD A;  2VKD A;  3P4P A;  2VL0 A;  2KSR A;  4TNW A;  3K3O A;  4UR9 A;  3QOF A;  4CI2 B;  2CHN A;  3OBV E;  4H9R C;  2Q9Q C;  2VUR A;  3E22 E;  4FI5 A;  5LGU B;  3RC8 A;  2OLT A;  5HEU A;  1KF6 A;  2DL1 A;  2CLY C;  5FXW A;  5A1L A;  4EED A;  2FJD A;  4PW8 A;  2W0G A;  1BR1 A;  5LHH B;  2WB5 A;  4CXW A;  2YN6 A;  4ZI7 E;  1ZEE A;  3Q9D A;  3AA0 B;  4AI6 A;  1HCI A;  3AVS A;  3PUX F;  3BK9 A;  2GK9 A;  4A56 A;  5HWX A;  4TX5 A;  3BQI A;  1NEK A;  4FJO A;  2YKS A;  3RQW A;  1B7T A;  2DWK A;  3GA8 A;  4F6R C;  4DO0 A;  3EDV A;  2MAW A;  2UXX B;  5JDN A;  3C64 A;  2XAG B;  3JC6 C;  4V1A v;  4GKJ T;  3PDY A;  3AA6 B;  2LOP A;  3CML A;  3PTR B;  5F8P A;  1L0V A;  2LSI A;  4OYJ A;  2JRK A;  4EXT A;  4X1I E;  3C98 B;  2XJ7 A;  1KK7 A;  2XY8 B;  4PJN A;  3S4U A;  4O4J E;  2WDR A;  5FL1 A;  3WAJ A;  1ZKE A;  2N2N A;  3RI5 A;  4HWC A;  1D0X A;  3PU3 A;  4ZI2 D;  5JRE A;  2L9Q A;  2Y6X A;  3AEC A;  3NZP A;  4O4L E;  3ZYK A;  4LFA T;  4DV3 T;  2BS4 A;  3WAK A;  4HWH A;  3EUH A;  4G63 A;  3JC6 D;  4IE4 A;  2LSY A;  3KBT A;  1IAP A;  2OV9 A;  3PUY F;  3KV6 A;  3ZEF B;  4GYS A;  2ZM2 A;  3ZCI A;  4O8S A;  4IRE A;  2EHO D;  3BQL A;  3ZYM A;  2UU9 T;  2LSK A;  3OYX A;  3UU6 A;  1XDO A;  1JNR A;  2E8I A;  4UVA B;  4UEM A;  4AQG A;  5AQN B;  3ANW A;  4F8H A;  4UVB B;  4LFC T;  2XUE A;  4HFH A;  2V8S V;  4J2C A;  3LBX B;  1QLB A;  4L0R A;  4AIS A;  5CB4 E;  2XAJ B;  5FY7 A;  1E2A A;  2H88 A;  2BZB A;  4CI3 B;  5J1G A;  3PUW F;  4KUM B;  3EAB A;  4TN7 B;  3EVY A;  4H9Q C;  2W63 A;  2XQY A;  5JVD E;  2VK9 A;  3TLS A;  3QK6 A;  3HKE E;  3K3Q C;  2XQ6 A;  4MAL A;  5HXC A;  1I94 T;  2JQK A;  1WRD A;  2W2U A;  3GWH A;  3ZC0 A;  2I59 A;  1D0Y A;  2D5U A;  4WBO A;  4ZXL A;  2JIW A;  4X62 T;  4B3R T;  4IIJ E;  2K24 A;  1NWM X;  3L8R A;  3VR8 A;  2L3L A;  3U3I A;  5HWY A;  2CXF A;  3ONJ A;  3UUM A;  4X64 T;  1LVF A;  3AE9 A;  3TLT A;  2YU2 A;  2BKP A;  4CXX A;  4H9O C;  5L47 A;  3RKO A;  4IL4 A;  1HS7 A;  3ZKR A;  5EK3 A;  3E0Z A;  2CBI A;  3IA3 A;  1US7 B;  3PJA A;  3QG0 A;  3ZMZ B;  3A8Y C;  3V5U A;  2W67 A;  3NKZ A;  4BA9 A;  1WYC A;  5LGT B;  4HN9 A;  1T8B A;  3AAE B;  3AEB A;  4WW0 A;  3ETV A;  3ZT6 A;  5JR9 B;  3NBX X;  2FJE A;  3N2O A;  4DV4 T;  3HI2 A;  3KVB A;  5FY0 A;  2BKO A;  5AQJ B;  1FMV A;  1W9R A;  3I9Y A;  4COF A;  3OKQ A;  4JV5 T;  2OUT A;  2Q9Q B;  3UFG A;  3ZT5 A;  4ANJ A;  2KWI B;  5KXJ A;  3SFD A;  3ZN1 B;  3AEA A;  2XQ5 A;  1M7K A;  3Q5E A;  3O1J A;  1OXZ A;  1J5E T;  4TWF A;  5JH7 E;  2LRL A;  4XZC A;  2RQY A;  3N9M A;  4EZH A;  3Q5W A;  4P0B A;  2FJB A;  1HR0 T;  3SRZ A;  3ZN0 B;  2WU2 A;  3DP7 A;  2JJ9 A;  2NTX A;  2XQ8 A;  5L4H A;  3I1A A;  3AXJ A;  5L3C B;  2UXN B;  2CXD A;  4KHP T;  5HVZ A;  1MIW A;  5FL0 A;  3AE8 A;  3B13 A;  4Z8X A;  1WCR A;  1UUR A;  1QSD A;  5L2L A;  3G36 A;  3IM4 A;  1HNX T;  5JDQ A;  1HG5 A;  4JUY A;  3ZYL A;  2W61 A;  4IL9 A;  4AXP A;  2XQ4 A;  4JI0 T;  4RTA A;  3MJX A;  4X66 T;  1R8I A;  1VCS A;  3N2G E;  4ASK A;  3KIN B;  4X1K E;  3S4D A;  3C50 A;  2LHN A;  3CWZ B;  5LBM A;  1U4Q A;  2X9W A;  3UQ7 A;  2EZW A;  3UUX B;  2JQ9 A;  4JI6 T;  5GON E;  4HFC A;  1ZHC A;  3ONX A;  3FZH B;  3RRW A;  4C90 A;  5AQG B;  4EAH A;  1UUS A;  2V7M A;  4XBF B;  1Y64 B;  1SUM B;  4ZI2 C;  2HHH T;  2PBI A;  5KX5 E;  3AED A;  5H6Q B;  4K0U A;  2KZ7 B;  1IJ5 A;  4DVD A;  4EZ4 A;  4DR5 T;  2K3W A;  3S4B A;  2K48 A;  3O9X A;  2HH7 A;  3LK3 B;  4LF7 T;  4HKA A;  4GOU A;  5EZY E;  5HCJ A;  2V26 A;  2W4X A;  2IML A;  3KV5 A;  3FZF B;  5LNK A;  5HXR A;  3BQK A;  3FZM B;  2LHR A;  2SPC A;  3GN5 A;  4LML A;  4O4H E;  3T8O A;  3ZMS B;  2M6B A;  3M65 A;  2UUA T;  3AEE A;  3L39 A;  3AE5 A;  2D2S A;  5HEO A;  2V5C A;  2KMF A;  2MPK A;  3I0O A;  4YT0 A;  1HNZ T;  4ZS3 A;  1LKX A;  5FVK A;  4JEU B;  2CBG A;  4GK0 E;  5DQV A;  3KV4 A;  4B3T T;  1W09 A;  4KX6 A;  3OYZ A;  3EAM A;  4A98 A;  5HXE A;  3TLV A;  5L4E A;  2IUB A;  2MOZ A;  2KIN B;  4ILC A;  5JQG E;  4NPP A;  5DJQ C;  3AXJ B;  1YQ4 A;  2BBJ A;  4EEB A;  4P09 A;  4ZHQ E;  5LMN T;  1HFA A;  1MNE A;  5L3D B;  4EOZ B;  5LYJ E;  4IDO A;  4JI8 T;  5JDG A;  4YTP A;  5JDH A;  3IF8 B;  4DBR A;  2YDR A;  2K5B B;  3ACT A;  1XNQ T;  4UEL A;  3DJB A;  2BBH A;  2BS2 A;  2PTF A;  1MIV A;  4P1N A;  4QWN B;  3RYC E;  1X9B A;  2BS3 A;  2CWO A;  2E5V A;  2ZM8 A;  4IE0 A;  4OX9 T;  3QDE A;  4DMW A;  4A5X A;  3PUG A;  4IE5 A;  2WBL A;  5FNV E;  2XM1 A;  3AA1 B;  5L3E B;  2CHO A;  5AQT B;  3RHW A;  4JI4 T;  2WM9 A;  1E1H B;  1YXR A;  5CJ5 A;  4CN6 A;  2VVS A;  1OED E;  3N9P A;  2WCA A;  2UXC T;  1IJ6 A;  4ZZB A;  5AQF B;  2Y48 B;  3ZMU B;  3ZSS A;  3AE3 A;  3AE4 A;  3CQC B;  5KDM C;  2X0L B;  4YXD A;  2H9R A;  3AFJ A;  4EYY R;  2V5D A;  3B5M A;  3P4W A;  3P50 A;  3FXD B;  2XZE A;  4KMC A;  5JRC B;  2CMR A;  2BVM A;  2V1D B;  2X0H A;  4I50 E;  2H89 A;  3AE6 A;  5LG3 A;  1IZN B;  3HKD E;  5AFU L;  4DUY T;  1D0Z A;  2CBJ A;  3FZL B;  4HWI B;  4B3M T;  2DRN A;  2YK0 A;  3QC9 A;  1T72 A;  2WMN A;  1VRB A;  3UU4 A;  1N34 T;  4CN1 A;  4QH4 A;  3UU8 A;  4AQF C; 
#chains in the Genus database with same CATH homology
 2ODU A;  4IHJ E;  4PAG A;  3ZLI A;  3HKB E;  2KNG A;  4G2A A;  2Y8D A;  5M4Y A;  2YIN A;  3FXE B;  2ODV A;  3R6N A;  4O2A E;  2V7L A;  4YJ3 E;  4AKI A;  2CXL A;  4PFO A;  4PFP A;  2A3D A;  2NW7 A;  3AVR A;  1BR0 A;  2V7K A;  4UXN B;  4H63 V;  4QHO A;  1Z0P A;  2RP4 A;  2G0U A;  2MBG A;  1HX8 A;  2QGS A;  2HPJ A;  3VHL A;  5TAO A;  4WNK A;  4UIG A;  4MLK A;  4UF0 B;  4H9N C;  2CA5 A;  3RPU A;  3EDU A;  2DLR A;  2XAH B;  4HE8 A;  5FP3 A;  2LE8 A;  3KVA A;  3AB3 B;  2Q9Q A;  1D1C A;  4IE6 A;  4YHJ A;  3W15 B;  3SOL A;  5L3G B;  3L3P A;  1CUN A;  2MTQ A;  2P9B A;  3P8C D;  4OFZ A;  3NRX A;  5ETW A;  5H6R B;  2X9H A;  3IBP A;  3ZJ2 A;  1MIY A;  1MND A;  3ANW B;  3CX7 B;  1LVK A;  1UX4 A;  3C4Z A;  2N1G A;  2C5K T;  2HPL A;  4YFS A;  3CQG B;  4B6X A;  2D0T A;  1MMN A;  1D1B A;  3FB2 A;  3MA9 A;  4ERR A;  2VWA A;  5LHG B;  2DCF A;  3B57 A;  2K9Q A;  4HEA A;  4ILU A;  4PJL A;  2C5J A;  2L8K A;  2Z6E A;  3N9N A;  2WAU A;  4DBQ A;  2C5I T;  4IE7 A;  2BDE A;  4UV8 B;  2NTY A;  4MBQ A;  5FYM A;  5C8Y E;  2JMH A;  1UX5 A;  3SS1 A;  3O1I A;  5FXV A;  2ZMA A;  3PUQ A;  4O4I E;  5FXX A;  5JR9 A;  3ZC1 A;  3L09 A;  4NUU A;  4PK6 A;  2VKO A;  2IC6 A;  2XAF B;  2X51 A;  3HKC E;  2CEA A;  2X9Y A;  3DTO A;  3ETU A;  3GMI A;  4KBM B;  2X66 A;  3O1H A;  5JRC A;  4UV9 B;  4CQI A;  3K3N A;  2EHO C;  5LOV E;  3VKH A;  2YEV C;  5F3J A;  2WWU A;  2VKH A;  2XHE B;  4AKR B;  1VOM A;  1U5P A;  3CX8 B;  3KV9 A;  4QKN A;  1HTJ F;  5JDF A;  3PE0 A;  3CQX C;  4XAX B;  5LG4 A;  1G8X A;  5LJN A;  2EHO B;  4TUY E;  2KT9 A;  5ADX L;  1YKE B;  5HYA A;  5J2U E;  2RA1 A;  1YW0 A;  3N9Q A;  2B1E A;  5IHY A;  1FIO A;  5LGN B;  4L9I A;  3KDS E;  5LJM A;  3H37 A;  1H7C A;  3OJA A;  3ZJ1 A;  3I0Q A;  1QUU A;  2ZLY A;  3RX6 A;  3U78 A;  3I9W A;  3PUS A;  1MMD A;  3P7I A;  2VAS A;  3IHR A;  1BR2 A;  4C91 A;  2A72 A;  2M67 A;  3RYF E;  5FMN A;  4TZ4 C;  3SWH A;  2CWY A;  4MFR A;  3R84 B;  4I55 E;  4BJM A;  4CZZ B;  4DND A;  2LM9 A;  4PK5 A;  2N9D A;  2LSG A;  2X9X A;  3FBZ A;  2J1D G;  2Q9Q D;  5E0O A;  4TV8 E;  2LEH A;  1S94 A;  3ZMV B;  3GN5 B;  1SHZ C;  4M1P A;  3MXZ A;  4ISS A;  1D1A A;  3AAA B;  5L3F B;  2BVL A;  4ZI3 D;  4UVC B;  4PJJ A;  3RC3 A;  3FBL A;  3N9O A;  3VU7 H;  3VKG A;  4MHC A;  1HG2 A;  1AJ3 A;  1BR4 A;  3D0T A;  1S35 A;  3AAI A;  4GK5 E;  2H7O A;  4EIW A;  3RRC A;  1WR6 A;  2PG8 A;  2XAQ B;  3LG7 A;  4YJ2 E;  5LXT E;  4HGA A;  4IST A;  3PU8 A;  3UUL A;  1EZ3 A;  4JEH B;  4X1Y E;  2NP9 A;  2KWH A;  4EB6 E;  3QUJ A;  3F2E A;  2JQQ A;  3RYH E;  5LP6 E;  4U72 A;  5CA1 E;  3A5X A;  4UF0 A;  4YLH A;  5LA6 E;  1SA0 E;  3PMI A;  2ACX A;  3CX6 B;  3MAC A;  4L5G A;  2KND A;  2XTL A;  2W62 A;  3ESL A;  2CM0 A;  3MZK B;  3PUR A;  3NRY A;  3F31 A;  3N5L A;  4WBN E;  5KMG P;  3CPZ A;  2C0S A;  2JMK A;  1X79 A;  3F57 A;  4QX7 B;  2E9X C;  5HAX A;  5BMV E;  3O4X E;  2IC9 A;  3KFW X;  2H3R A;  3RYI E;  1V9D A;  2CB9 A;  5EK4 A;  3CVR A;  2ZM0 A;  2X68 A;  2DI4 A;  2MYS A;  4PJM A;  3Q5X A;  5FXZ A;  3C4W A;  3J7Y q;  1LRZ A;  4NUV A;  3Q2M A;  4X20 E;  3H3A A;  3LK2 B;  5HXS A;  4EYU A;  2VB6 A;  3C4X A;  2CCQ A;  3KBU A;  2PFV A;  4JLE A;  3C51 A;  2CLY B;  3HL6 A;  4O2B E;  4QXC B;  1MMG A;  5LCY A;  2H7V C;  3CKD A;  2X67 A;  4CI1 B;  1FEW A;  2IW5 B;  1ZV4 X;  3LJC A;  2JPF A;  3MK7 C;  4AKH A;  1G73 A;  3ZPO A;  5DQW A;  1MMA A;  4I4T E;  4IDZ A;  4HFV A;  3UT5 E;  2A2F X;  2E9X A;  2D0U A;  1OWA A;  5IYZ E;  5LBQ B;  3UFE A;  4H9S E;  5FY1 A;  3J9X 1;  2W00 A;  2DNX A;  4N78 D;  5HXH A;  3TKL B;  4ADZ A;  3N2K E;  2DWG A;  4OK0 A;  2OA5 A;  4PNI A;  1WYB A;  2YU1 A;  3ZCJ A;  3E08 A;  4CXY A;  1KNZ A;  2IAK A;  4I43 B;  2KXP B;  1FMW A;  4AKL A;  4AQF A;  2EHO A;  2CE7 A;  2OUT A;  1NAF A;  2QA7 A;  1WLX A;  3FHN A;  2WMO A;  2XAS B;  4U74 A;  3K8P C;  1HF8 A;  3UTK A;  5LHI B;  1O3X A;  4ZI3 C;  4E7Z A;  3UUN A;  2LT3 A;  4TV9 E;  2NOX A;  3RH3 A;  4HTE A;  4OHF A;  5JDM A;  4H9P C;  4QXH B;  5JR9 C;  1T98 A;  4GIW A;  4PK4 A;  4BJN A;  2NW8 A;  2PJQ A;  2E9X D;  3AA7 B;  5CA0 E;  4QXB B;  5L3B B;  4BAY B;  4QX8 B;  2ES0 A;  3NZQ A;  2V7J A;  3HR0 A;  2K9A A;  4P0A A;  2LSJ A;  3ZMT B;  2DHR A;  4GYR A;  4KP3 C;  4IGU A;  5EK2 A;  2NW9 A;  4ZS2 A;  4E7S A;  5DAB A;  3LK4 2;  3IEE A;  3PUA A;  2E9X B;  4ZOL E;  2LOS A;  2VL8 A;  2KLQ A;  2LJL A;  3WI3 A;  2NWB A;  2VKJ A;  5J2T E;  2V7I A;  3HA4 A;  4DMV A;  3N9L A;  4H63 H;  1YKH B;  4OYK A;  2WSS V;  1UCU A;  1YD8 G;  3LBX A;  3LFM A;  3MKD A;  3V5S A;  2VKD A;  5JDL A;  3ZC0 A;  3K3O A;  4CI2 B;  3OBV E;  4H9R C;  2Q9Q C;  3E22 E;  4FI5 A;  5LGU B;  3RC8 A;  2CLY C;  5FXW A;  5A1L A;  4PW8 A;  2W0G A;  1BR1 A;  5LHH B;  4ZI7 E;  4CXW A;  4AI6 A;  1ZEE A;  3Q9D A;  3AA0 B;  1HCI A;  3AVS A;  3BK9 A;  2GK9 A;  4A56 A;  5HWX A;  4TX5 A;  3BQI A;  4FJO A;  4F6R C;  1B7T A;  2DWK A;  3GA8 A;  4DO0 A;  3EDV A;  2UXX B;  5JDN A;  3C64 A;  2XAG B;  3JC6 C;  4V1A v;  3PDY A;  3AA6 B;  2LOP A;  3CML A;  3PTR B;  5F8P A;  2LSI A;  4OYJ A;  2JRK A;  4EXT A;  4X1I E;  3C98 B;  3S4U A;  1KK7 A;  4PJN A;  4O4J E;  3WAJ A;  1ZKE A;  2N2N A;  5JRE A;  1D0X A;  3PU3 A;  4ZI2 D;  2L9Q A;  2Y6X A;  3NZP A;  4O4L E;  3ZYK A;  3WAK A;  3EUH A;  4G63 A;  3JC6 D;  4IE4 A;  2LSY A;  3KBT A;  1IAP A;  3KV6 A;  3ZEF B;  4GYS A;  2ZM2 A;  3ZCI A;  4O8S A;  3ZYM A;  2EHO D;  3BQL A;  2LSK A;  3OYX A;  4AQG A;  2E8I A;  4UVA B;  4UEM A;  3ANW A;  4UVB B;  2XUE A;  4J2C A;  3LBX B;  4L0R A;  5CB4 E;  2XAJ B;  5FY7 A;  2BZB A;  4CI3 B;  5J1G A;  4KUM B;  4TN7 B;  5JVD E;  3EVY A;  4H9Q C;  2W63 A;  2XQY A;  2VK9 A;  3QK6 A;  3HKE E;  3K3Q C;  4MAL A;  5HXC A;  1WRD A;  3GWH A;  2I59 A;  1D0Y A;  2D5U A;  4WBO A;  4IIJ E;  2K24 A;  1NWM X;  2L3L A;  3U3I A;  5HWY A;  2CXF A;  3UUM A;  1LVF A;  2YU2 A;  4CXX A;  4H9O C;  3RKO A;  1HS7 A;  5EK3 A;  3E0Z A;  1US7 B;  3ZMZ B;  3V5U A;  4BA9 A;  5LGT B;  1WYC A;  4HN9 A;  4WW0 A;  3AAE B;  3ETV A;  5JR9 B;  3NBX X;  3N2O A;  3HI2 A;  3KVB A;  5FY0 A;  1FMV A;  3I9Y A;  3OKQ A;  2Q9Q B;  4ANJ A;  2KWI B;  3ZN1 B;  3O1J A;  1OXZ A;  5JH7 E;  4XZC A;  2RQY A;  3N9M A;  4EZH A;  3Q5W A;  4P0B A;  3SRZ A;  3ZN0 B;  3DP7 A;  2JJ9 A;  2NTX A;  5L3C B;  3I1A A;  2UXN B;  2CXD A;  1MIW A;  3B13 A;  4Z8X A;  1QSD A;  5L2L A;  5JDQ A;  1HG5 A;  4JUY A;  3ZYL A;  2W61 A;  4AXP A;  3MJX A;  3N2G E;  4ASK A;  3KIN B;  4X1K E;  3C50 A;  2LHN A;  3CWZ B;  5LBM A;  1U4Q A;  2X9W A;  3UUX B;  5GON E;  1ZHC A;  3ONX A;  3RRW A;  4C90 A;  4EAH A;  4XBF B;  2V7M A;  1Y64 B;  4ZI2 C;  2PBI A;  5KX5 E;  5H6Q B;  4K0U A;  2KZ7 B;  1IJ5 A;  4DVD A;  4EZ4 A;  2K48 A;  3O9X A;  2HH7 A;  3LK3 B;  4HKA A;  4GOU A;  5EZY E;  2V26 A;  3KV5 A;  5LNK A;  5HXR A;  3BQK A;  3GN5 A;  2LHR A;  2SPC A;  4O4H E;  3T8O A;  3ZMS B;  3M65 A;  2D2S A;  2KMF A;  3I0O A;  4ZS3 A;  1LKX A;  4JEU B;  2CBG A;  4GK0 E;  5DQV A;  3KV4 A;  3OYZ A;  5HXE A;  2MOZ A;  2KIN B;  5JQG E;  5DJQ C;  4P09 A;  4ZHQ E;  1HFA A;  1MNE A;  5L3D B;  4EOZ B;  5LYJ E;  4AKG A;  5JDG A;  5JDH A;  3IF8 B;  4DBR A;  2K5B B;  4UEL A;  3DJB A;  4QWN B;  1MIV A;  3RYC E;  2CWO A;  2ZM8 A;  4IE0 A;  4DMW A;  3PUG A;  4IE5 A;  2WBL A;  5FNV E;  3AA1 B;  5L3E B;  2WM9 A;  1E1H B;  3N9P A;  1IJ6 A;  5KDM C;  2Y48 B;  3ZMU B;  3CQC B;  2X0L B;  4EYY R;  3FXD B;  4KMC A;  5JRC B;  2CMR A;  2BVM A;  2V1D B;  4I50 E;  1IZN B;  3HKD E;  5AFU L;  1D0Z A;  2YK0 A;  3QC9 A;  2WMN A;  1VRB A;  4AQF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...