3GWHA

Crystallographic ab initio protein solution far below atomic resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
HSQLMAQLVEVIEDSFQMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLMLLLKNEYPLCYNTAWKLIKILQQTLKKPVHEAEAVYLTLHLIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional antiterminator (BglG family)
publication title Crystallographic ab initio protein structure solution below atomic resolution
pubmed doi rcsb
source organism Bacillus subtilis
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3gwhA02
1.20.890.100 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A cAMP-dependent Protein Kinase, Chain A 3gwhA01
3GWHA 3UFEA
chains in the Genus database with same CATH superfamily
4BA9A 3L8RA 4Q25A 3SOLA 3M65A 4YXDA 5AQVB 2V7IA 3PE0A 2RPAA 3QUJA 3RF1A 4AXPA 3AA0B 3KVAA 1D0YA 2ODVA 1WR0A 4KHZF 3JAFA 1SA0E 2LRKA 2ZMAA 3U3IA 3V5UA 4ILAA 5AQQB 2CCQA 2YU1A 2XPKA 1QSDA 2HPLA 3CPZA 4TNVA 5FL0A 2X9WA 3RPUA 1HG2A 3AEAA 2K5BB 2LHRA 3ZYLA 3P50A 4I4TE 5HCJA 1N33T 3C51A 4X1IE 4ZI3C 5KXJA 4LF8T 2VK9A 3FZHB 4AISA 4ZI2D 3L3PA 3S4DA 3LJCA 4QX7B 5KX5E 1ZEEA 2JQ9A 3MZKB 2D9DA 2Y6XA 4FJOA 3MA9A 4IDZA 2WCAA 4PW8A 4U33A 2LE8A 4L0RA 4GIWA 2CHOA 4U74A 1HNWT 2FJAA 1N32T 4F9KA 2IHR1 3UU5A 3FXEB 1HS7A 5LJMA 1FMVA 3QDEA 4DUYT 4NUVA 1MIYA 3VKHA 1YD8G 2ACZA 2D2SA 1ZP0A 2IZYA 2JQQA 4O4LE 1Y64B 3Q5EA 1HFAA 4B6XA 4PJMA 3ZT6A 3BQLA 4H9QC 2YN6A 2L8KA 1GQEA 2BS3A 3UFGA 2BDEA 2BBHA 5E0OA 2W4XA 2XAGB 1W0AA 2XQ5A 2WU5A 5ABHA 3ACTA 1OEDB 1L6EA 5HEJA 2IDOB 3W15B 2N9DA 1UGOA 5ABFB 2XM2A 2DCFA 4BJMA 4ZZBA 4DV4T 5HXRA 2KYGA 3GA8A 2X66A 5IYZE 2XAHB 5BR8T 1JNRA 3R6NA 2KMFA 5F3JA 3AXJB 1CHUA 4AI6A 4K0UA 4P0AA 5J0ZA 1J5WA 2V5CA 3LK42 4IGUA 4DR4T 2FJDA 3AVSA 2BZBA 5AQNB 4ASKA 2CQSA 3PUGA 2W66A 4DMWA 1FEWA 2BKOA 1KNZA 2IC9A 3R84B 1IJ5A 3N2OA 4K0KT 3N5LA 4IHJE 3PDYA 3ZC1A 2EHOB 3AA6B 4IIJE 2MTQA 2LSGA 4DV1T 4DNDA 1N34T 3K1SA 3CWZB 3CX8B 2ACXA 5AQIB 4EEDA 2XQ3A 4DVDA 4L9IA 4UF0A 1O3XA 5C3JA 1KF6A 3LK2B 4IL9A 4JEUB 2DLRA 5FY1A 2LT3A 3EUHA 4GK5E 4ZI2C 3EVYA 4AQGA 2CA5A 2LKGA 5L3CB 1W09A 1SE7A 3OYXA 3QC9A 2NOXA 2RA1A 4YT0A 4WBOA 1JNZA 3CX6B 3ZYMA 2JJ9A 3FB2A 3RI5A 5BMVE 3RRSA 3FZFB 3ETUA 1WFDA 3OJAA 3UU3A 2C5KT 4TX5A 4LF5T 4XZCA 4DV2T 2KNDA 1HF8A 1UK5A 3PU8A 2V7MA 1UURA 1MMGA 5F8PA 3QNUA 2BS2A 4ANJA 5HAXA 3U78A 5LJNA 2CPTA 4V1Av 3TLTA 3PUQA 4I50E 3TLWA 3C4ZA 2UXBT 3N9MA 2DWKA 1BR2A 3ZCJA 5L3DB 4H63H 2AXDS 4TV8E 3JCFA 4OYJA 1XWMA 1OWAA 4OFZA 2E2AA 1LKXA 4HWIB 3ETVA 3ZKRA 4C90A 3IHRA 1XNRT 3UQ4A 4YJ3E 4B3ST 3N2GE 3OBVE 3ONLC 1SUMB 1WYCA 2Q9QC 1SHZC 4O4JE 5ABEA 4JI6T 1XMQT 4X5TA 4CI3B 5HEGA 4A56A 2BS4A 2WWUA 2L9QA 2NW8A 4LF4T 3C50A 2LSJA 4MLKA 1I94T 5FL1A 2K24A 4IE5A 2VWAA 5HVZA 5AQUB 4IREA 2KZ7B 2IMLA 2RQYA 4NXNT 4O4HE 3MXZA 2HPJA 1EZ3A 3AE5A 3ZPOA 3GN5B 5DQVA 1T8BA 1FJGT 3LBXA 3PUSA 5L3FB 2CXFA 2CHNA 3D0TA 2WSSV 2V5DA 3RIUC 3RGLA 5HXHA 4PJNA 2W2UA 2OA5A 4TWHA 3RIUA 4EEBA 2WZHA 4I43B 5CA1E 3GMIA 4CN4A 1XDOA 3RH3A 1OEDE 2P9BA 5JR9B 1KFYA 1D1AA 5AQRB 2C0SA 3RRCA 1X9BA 4O8SA 3A5XA 4ZXLA 2Y48B 5AQMB 5TAOA 4IE4A 1I6ZA 3JC6D 3RHWA 4KI0F 2XASB 2W0GA 3Q5WA 2DI4A 4CZZB 4H63V 2H7OA 1WLXA 5FNVE 2LSYA 4EAHA 3JAEA 3A8YC 3ZMUB 4HWFA 2KSRA 2V1DB 1WCRA 4CI2B 3TKLB 3P4RA 5JDHA 5LG3A 3UU8A 4DV3T 3QB5A 4L5GA 5JTGA 5L4HA 2UUAT 2XQ6A 3N2KE 5C8YE 5GONE 2W61A 5LGTB 1D0XA 2C5IT 4EYUA 3FBLA 3K3NA 3RC8A 4DR3T 4U3CA 2X9HA 2V26A 4LF7T 2VKDA 5FY7A 3SWHA 2BBJA 5AQJB 3ANWA 4HFIA 4NPPA 3CVRA 4UELA 3GWHA 3CQGB 4ILUA 5J2TE 3FZKB 1FIOA 5LMNT 3Q5DA 4PNIA 2WP9A 4C91A 5IUXA 4BAYB 4F8HA 1IJ6A 3EAMA 2FJEA 4ADZA 4P1NA 3H3MA 5HXSA 2MPKA 1S94A 3ZT5A 2I0MA 1E7PA 1H7CA 3I1AA 2V6YB 3P4WA 3Q5XA 5JH7E 5FVKA 2OV9A 2WY2A 3SFEA 3C64A 2ZM8A 3VR9A 3NZPA 2VKHA 2XUEA 3TLVA 3KV4A 2H89A 3N9PA 3RSYA 2EHOD 2LSIA 1KNRA 4WZXA 3C4XA 5JDMA 2A3DA 5LNKA 1BR1A 4O2BE 2DNXA 3UULA 5J1GA 2DRNA 1DU2A 4XBFB 1NENA 4Z90A 3CK6A 2BVLA 4J2CA 4NIQA 2BG9B 4MFRA 4H9OC 5FMNA 3KDSE 4OYKA 1XMOT 4YLHA 4TNWA 3JC6C 2MYSA 2ZM2A 2UXNB 3OYZA 3IF8B 5AQHB 3LSVA 2LHNA 3FZMB 4ISTA 3RYCE 3T1HT 3PUWF 4CXWA 2X68A 4LMJA 4ISSA 2FJBA 4DO0A 3PMIA 4QH1A 2W62A 2X9XA 4QH4A 4G63A 4H9SE 4IL4A 1LVFA 4HFBA 3E08A 3AEDA 3G06A 4QHOA 1KEYA 3FHNA 2PG8A 2H7VC 4JI4T 4NXMT 2XAQB 3TLUA 2E5LT 2CWOA 4LF9T 3UUBA 4JI2T 1OEDC 2R6GF 1MMNA 3RIFA 1OEDA 4EZ4A 3ZT7A 3AECA 4AQYT 2H3RA 2MOZA 3KV9A 3S4CA 4COFA 2E5VA 3S4AA 2UXCT 4UR9A 1MIVA 1G73A 2WB5A 2X0HA 5AFUL 2ZLYA 3EDUA 4KHPT 2Z6EA 5LA6E 5LOVE 4HKAA 3G36A 2LEHA 3AXJA 3H3AA 3LG7A 5IHYA 2W67A 3RX6A 3NBXX 2K9AA 3OKQA 2XM1A 2K9QA 2MBGA 3UQ7A 3KFWX 1T7SA 2EHOC 5ETWA 3O1HA 2EHOA 3IM4A 4QXCB 3VRAA 3S4UA 2EZWA 1UUSA 2V8SV 3UU6A 2X0LB 4IE6A 2B1EA 3T1YT 1J1JA 2QRXA 3AE8A 3QFYA 1CUNA 4ZHQE 2WDVA 2XHEB 3LK3B 2CMRA 3IBPA 2GK9A 1U5PA 4EV6A 1VCTA 2X9YA 2KWIB 4GKJT 3NZQA 2IUBA 3O4XE 3RYIE 1UX5A 4DR6T 1NWMX 3H37A 1BR4A 4PFOA 4ZZCA 2LJLA 5AQFB 4B3MT 4HFEA 3Q9DA 2HN1A 1R8IA 2VVSA 1S35A 4N78D 2D0TA 3M3ZB 3HL6A 2M6BA 2VKOA 2B76A 4LMKA 2L3LA 4U7IA 3RYHE 2FUPA 3MKDA 1UX4A 1YKEB 2WMOA 2UUCT 3J7Yq 4KP3C 2WAUA 3QOFA 1BR0A 5DQWA 2I6HA 3IA3A 5HXEA 3BK9A 4JLEA 1D1BA 2UUBT 1FMWA 5EK2A 1ZHCA 1B7TA 4U2YA 4UVBB 2XAFB 4AKHA 5FXZA 1HCIA 3RIAA 2XZEA 3AEEA 4RTAA 5FP3A 5C2TA 4IDNA 5AQPB 4HWCA 5CB4E 4Z8XA 5CGMA 1XDPA 5HWXA 1KNPA 3J9X1 2WBLA 2W63A 2VKJA 3VR8A 2BG9E 2K3WA 5LB7B 4DBQA 4IDPA 1X79A 2QGSA 3VRBA 5HEUA 4RT4A 2J1DG 2CQTA 3A7MA 1VRBA 3F57A 3AFJA 4HEAA 4X64T 4YHHT 5AQKB 1T72A 1Z0PA 4PK6A 4IT4A 5AQTB 5JDLA 4DV7T 4JV5T 3VKGA 4UXNB 3F2EA 4JI0T 2E9XD 2Q9QB 3S4BA 4ZOLE 3ESLA 1V9DA 2VVNA 2XQYA 3ZYKA 3K3QC 2VL0A 1R2AA 1ZV4X 3AAAB 3LFMA 3PUVF 4P0BA 1U4QA 3AE1A 1J5ET 1WYBA 2LKHA 5FXWA 5ABGA 3GN5A 3JADA 5FYMA 5AQSB 5LBMA 4UVAB 5JDNA 2YU2A 3KVBA 2XJ7A 3IM3A 4EGWA 1YQ3A 3WAJA 3SS1A 5FXXA 4UV9B 3PJAA 2PTFA 4I55E 4TZ4C 2WM9A 2KINB 5JR9C 3HKCE 5JR9A 5JDQA 3CX7B 5L4EA 2XSBA 4H9NC 4XAXB 3PJAJ 4AIUA 3E22E 5DABA 2QA7A 1QLBA 1WRDA 2ZM0A 5JRCB 1HNZT 3CQXC 2ES0A 4PK4A 3ZMZB 3N9OA 3VU7H 4DV6T 3ONJA 3ZMTB 4MALA 1W9RA 4X20E 3L39A 2LOPA 2CEAA 2WWVA 3MACA 4DIDB 3AEBA 3I9YA 4GYSA 5A1LA 4TUYE 1YW0A 3KV6A 2LM9A 2AE9A 3HR0A 1HR0T 3AA7B 4YSZA 2UU9T 2HHHT 2V7JA 3OPCA 4ZEYA 3AAIA 1IAPA 3K8PC 5LHIB 3RQWA 4JEHB 4JI3T 4HTEA 3SRZA 3I0OA 4UV8B 4KBMB 3RRWA 3AE9A 5JVDE 4A98A 1E2AA 3FZLB 3KBTA 2DHRA 4TN7B 4OK0A 4QXHB 3FBZA 4AQFC 3T8OA 4GYRA 4AQFA 2CRBA 2IW5B 1MIWA 4NUUA 2NTYA 1YKHB 2NWBA 4TWFA 2E9XB 2LRLA 2KT9A 3DJBA 4B3RT 2PJQA 1G8XA 2CXDA 2Y8DA 3ZN0B 2XQ9A 1VCSA 2XQ7A 3KV5A 1VOMA 3RKOA 2V6YA 5LMUT 3ZEFB 2VQET 3HA4A 4X65T 2V7KA 4DUZT 2PBIA 3KBUA 2HH7A 4YSXA 1OXZA 2WDQA 4PJLA 1IZNB 2CLYB 2SPCA 3HKEE 3RYFE 5H6QB 3ZMSB 4RIQA 4ZI7E 4CXXA 2A72A 3IEEA 4HN9A 2XY8B 2WS3A 3ACSA 1NAFA 3E0ZA 4TWDA 2XAJB 3WI3A 3ZSSA 3UUNA 3MK7C 2YINA 2BG9C 2YEVC 4HGAA 2QVAA 5HCMA 5EK4A 3UUXB 5CFBA 2BG9A 2OLTA 4A5XA 2H88A 5KMGP 1ZKEA 2YOEA 3AVRA 2F4VT 1M62A 5LP6E 4EB6E 5F5WA 2XQ4A 3NVOA 1E1HB 3NKZA 4I0UA 1ZOYA 2LM2A 4ZS2A 2ODUA 2I15A 5L3BB 5FY0A 4TV9E 4U2ZA 2CBGA 4Z91A 5LGNB 2I59A 3NWIA 5FVLA 3AE6A 2CBJA 3V5SA 1W0BA 3FXDB 4HFDA 4MBQA 1YXRA 5HEOA 3PTRB 4WW0A 2X67A 4PFPA 2YDRA 4AKIA 1N36T 3VHLA 1XNQT 4CN1A 3ZMVB 2OUTA 4YSYA 2H9RA 2BVMA 4QX8B 2A2FX 3I9WA 5ABFA 4P09A 1MMDA 2WQYA 4JI7T 4PK5A 5L47A 3ABVA 4YTPA 1LRZA 1YQ4A 3ZCIA 3B5MA 2JRKA 5LCYA 5JREA 3EI0A 3N9NA 3CIRA 3OTOT 4JI8T 2LSKA 4HFCA 2KWHA 4JUYA 4UEMA 3PUYF 5IWAT 3EHZA 4IDQA 3PUXF 4QWNB 4CXYA 2K48A 4DBRA 1L0VA 4LMLA 2Q9QD 2HN2A 2FBWA 2N1GA 5CA0E 1US7B 4AKGA 3BQIA 3O1JA 4UIGA 3K3OA 3ZJ2A 2VQFT 1HX1B 1KK7A 3ZC0A 2CB9A 5J2UE 1QUUA 4ILBA 5FXVA 4DR7T 3ZLIA 4AKRB 5JQGE 1XZYA 4YFSA 2JQHA 2VURA 2V6XA 3AEFA 2XQAA 1MMAA 4ILCA 3B57A 4IE0A 4U72A 1AJ3A 3EABA 3RQUA 4U31A 4UF0B 2JPFA 3LDQB 1IBKT 1HNXT 1MNDA 2VL8A 3AE3A 5JDGA 3HI2A 3ZN1B 4IDOA 3O1IA 3P8CD 1WR6A 1HG5A 2UXXB 3DP7A 3X1DA 4DR1T 3P7IA 3PU3A 5CJ5A 2VB6A 3N9QA 3QK6A 4GK0E 3HKDE 5HXCA 5L3EB 1HX8A 3PUZF 4F6RC 3P4SA 3QG0A 2DWGA 4G2AA 2XTLA 2YK0A 4YTMA 4CI1B 4EXTA 3PURA 4DV5T 5ADXL 4E7SA 2WMNA 4PAGA 4JI1T 2WZIA 2IIUA 1IBLT 2M6IA 2YDQA 4YTNA 2CBIA 3HKBE 3UTKA 4UVCB 1D1CA 4DR2T 2D5UA 5LG4A 4ZS3A 5M4YA 3F31A 3L09A 3MJXA 4H9RC 2UXDT 3NRYA 3AAEB 1M7KA 4OX9T 4QXBB 4JI5T 3N9LA 4CN6A 4AKLA 3TLSA 5KDMC 5LXTE 1Z8UA 4ERRA 4U7YA 3QFZA 3DTOA 4HWHA 3CQCB 1T98A 4PJJA 1D0ZA 2V7LA 4LFCT 4HFHA 4LF6T 2KLQA 1UCUA 3EDVA 4JYAT 2Q9QA 5LHHB 5L2LA 3CMLA 4O2AE 2G0UA 4EZHA 3CKDA 1Y01A 2MAWA 5L3GB 2DL1A 1LVKA 5LBQB 2QYWA 5DJQC 4WNKA 4CQIA 4DV0T 2JMKA 5LGUB 2YDSA 5HWYA 4M1PA 4H9PC 3RC3A 2CXLA 2C5JA 2NW9A 2A9UA 2J4GA 2BKNA 3WAKA 3C4WA 3LBXB 3AE4A 4ZP3A 2X51A 2WU2A 2LOSA 4JBWF 4DR5T 5LHGB 4X1KE 5FKYA 4LFAT 2D0UA 3AEGA 4KUMB 3ZSTA 3C98B 1IBMT 2KNGA 4HFVA 5AQOB 5LYJE 4EYYR 2KXPB 4EOZB 3RLFF 2CM0A 4GKKT 2RP4A 5JRCA 2IC6A 2VASA 2JMHA 2JQKA 4WYVA 3B13A 4LFBT 3AE2A 4IE7A 5HYAA 2ZM6T 4OHFA 4HE8A 2J62A 4ZI3D 1MNEA 2M67A 4YJ2E 4QKNA 2X0YA 5JDFA 3ZJ1A 4QH5A 3P4PA 4BJNA 1NEKA 4DMVA 2E8IA 3KINB 4X62T 3BQKA 2CWYA 3AB3B 3SFDA 4X1YE 2LLYA 3UUMA 4KX6A 2YKSA 5AQGB 4YY3T 3P4QA 3UFEA 5HEHA 3OVUA 3RKGA 4A97A 4B3TT 5EK3A 3PUAA 4EIWA 4HWDA 2NW7A 4KMCA 5H6RB 2N2NA 2BKPA 2CE7A 4WBNE 2PFVA 3Q2MA 2E9XC 2NR4A 4E7ZA 2WDRA 3AA1B 3ANWB 4FI5A 2E9XA 4GOUA 3UT5E 4YHJA 3O9XA 2XQ8A 3I0QA 5EZYE 2J47A 3UU4A 4O4IE 2NTXA 4MHCA 2NP9A 2JIWA 3AE7A 2XSAA 3QB5K 1HTJF 3PV0F 3NRXA 2IAKA 5AQLB 3ONXA 2CLYC 2W00A 4X66T
chains in the Genus database with same CATH topology
3MKDA 4BA9A 1UX4A 2P9BA 4P09A 1MMDA 5JR9B 4PK5A 1YKEB 2WMOA 3SOLA 3M65A 1D1AA 3J7Yq 4KP3C 2WAUA 1BR0A 5DQWA 2C0SA 3RRCA 1LRZA 4O8SA 2V7IA 5HXEA 3A5XA 3BK9A 3PE0A 4JLEA 1D1BA 3ZCIA 2JRKA 5LCYA 5JREA 3N9NA 1FMWA 2Y48B 3QUJA 2LSKA 5TAOA 4IE4A 5EK2A 1ZHCA 2KWHA 1B7TA 4UVBB 2XAFB 4AXPA 4AKHA 4JUYA 3JC6D 5FXZA 1HCIA 3AA0B 4UEMA 3KVAA 1D0YA 2ODVA 5FP3A 1SA0E 2ZMAA 2XASB 4QWNB 2W0GA 3U3IA 4CXYA 3Q5WA 2K48A 2DI4A 4CZZB 4H63V 2H7OA 4DBRA 3V5UA 5CB4E 1WLXA 2Q9QD 2CCQA 2YU1A 5FNVE 1QSDA 2N1GA 2LSYA 4Z8XA 4EAHA 5CA0E 1US7B 2HPLA 4AKGA 3BQIA 3CPZA 3ZMUB 5HWXA 2V1DB 3J9X1 2WBLA 2W63A 3O1JA 2VKJA 4CI2B 2X9WA 4UIGA 3K3OA 3RPUA 1HG2A 3ZJ2A 2K5BB 3TKLB 1KK7A 4DBQA 5JDHA 1X79A 2QGSA 2LHRA 3ZYLA 3ZC0A 2CB9A 5J2UE 1QUUA 2J1DG 4I4TE 5FXVA 1VRBA 3F57A 3ZLIA 3C51A 4X1IE 4ZI3C 4L5GA 2VK9A 4ZI2D 4AKRB 5JQGE 4HEAA 3L3PA 4YFSA 3LJCA 4QX7B 1Z0PA 4PK6A 3N2KE 5KX5E 1ZEEA 5JDLA 5C8YE 5GONE 2W61A 3MZKB 3VKGA 5LGTB 1D0XA 2C5IT 1MMAA 2Y6XA 4FJOA 4UXNB 3B57A 3F2EA 3MA9A 2E9XD 2Q9QB 4IDZA 4EYUA 3FBLA 4IE0A 3K3NA 4U72A 4ZOLE 3RC8A 3ESLA 1AJ3A 1V9DA 4PW8A 2LE8A 4L0RA 4UF0B 2JPFA 2X9HA 2XQYA 2V26A 3ZYKA 3K3QC 2VKDA 4GIWA 5FY7A 1ZV4X 3AAAB 3LFMA 4U74A 4P0BA 3SWHA 1U4QA 1MNDA 2VL8A 1WYBA 3ANWA 5FXWA 3CVRA 5JDGA 4UELA 3GWHA 3FXEB 3HI2A 1HS7A 5LJMA 3GN5A 3ZN1B 3CQGB 1FMVA 4ILUA 5J2TE 5FYMA 4NUVA 3O1IA 3P8CD 1WR6A 4UVAB 1HG5A 2UXXB 1MIYA 1FIOA 3DP7A 5LBMA 5JDNA 4PNIA 3VKHA 4C91A 2YU2A 1YD8G 4BAYB 3KVBA 2D2SA 1IJ6A 2JQQA 4O4LE 3P7IA 3PU3A 1Y64B 1HFAA 4B6XA 4PJMA 4ADZA 3BQLA 3WAJA 3SS1A 5HXSA 5FXXA 1S94A 4H9QC 2VB6A 3N9QA 3QK6A 4UV9B 2L8KA 4GK0E 4I55E 3HKDE 4TZ4C 5HXCA 2BDEA 5L3EB 1HX8A 2WM9A 4F6RC 1H7CA 2KINB 3I1AA 5E0OA 2XAGB 5JR9C 2DWGA 3Q5XA 5JH7E 4G2AA 3HKCE 5JR9A 5JDQA 2XTLA 2YK0A 4CI1B 3CX7B 4EXTA 3PURA 3C64A 4H9NC 3W15B 2ZM8A 2N9DA 3NZPA 4XAXB 2DCFA 2VKHA 2XUEA 3E22E 4E7SA 5ADXL 5DABA 4BJMA 2QA7A 5HXRA 3GA8A 2X66A 1WRDA 2WMNA 2ZM0A 3KV4A 4PAGA 5IYZE 5JRCB 2XAHB 3N9PA 3CQXC 2ES0A 2EHOD 2LSIA 4PK4A 3ZMZB 3N9OA 3HKBE 3C4XA 3UTKA 3VU7H 5JDMA 2A3DA 3R6NA 5LNKA 2KMFA 1BR1A 4UVCB 3ZMTB 4MALA 5F3JA 1D1CA 4AI6A 4K0UA 4P0AA 4O2BE 4X20E 2DNXA 2D5UA 5LG4A 2LOPA 3UULA 4ZS3A 5M4YA 3F31A 2CEAA 3L09A 3MJXA 4H9RC 5J1GA 3MACA 3NRYA 3LK42 4IGUA 4XBFB 3AAEB 3I9YA 4GYSA 5A1LA 4TUYE 3AVSA 1YW0A 2BZBA 4QXBB 4ASKA 2BVLA 3KV6A 3PUGA 4J2CA 2LM9A 4MFRA 4DMWA 1FEWA 3HR0A 4H9OC 1KNZA 2IC9A 3N9LA 3KDSE 1IJ5A 4OYKA 3N2OA 3AA7B 5FMNA 3R84B 4AKLA 4YLHA 3JC6C 5KDMC 2MYSA 5LXTE 3N5LA 4IHJE 4ERRA 3PDYA 2ZM2A 3ZC1A 2V7JA 2EHOB 2UXNB 3OYZA 3DTOA 3IF8B 3AA6B 3AAIA 1IAPA 3K8PC 4IIJE 5LHIB 2MTQA 3CQCB 2LSGA 1T98A 4PJJA 4DNDA 1D0ZA 3CWZB 2V7LA 4JEHB 4HTEA 3SRZA 3CX8B 2LHNA 3I0OA 4ISTA 2ACXA 2KLQA 1UCUA 3RYCE 3EDVA 4UV8B 4KBMB 2Q9QA 3RRWA 4CXWA 5LHHB 2X68A 5L2LA 3CMLA 4O2AE 4DVDA 5JVDE 4L9IA 4UF0A 1O3XA 2G0UA 4ISSA 4EZHA 3CKDA 3LK2B 3KBTA 4DO0A 5L3GB 4JEUB 2DHRA 3PMIA 4TN7B 4OK0A 4QXHB 2DLRA 5FY1A 3FBZA 1LVKA 4AQFC 3T8OA 2W62A 5LBQB 2X9XA 2LT3A 3EUHA 4GYRA 5DJQC 4GK5E 4WNKA 4G63A 4H9SE 4CQIA 4AQFA 4ZI2C 1LVFA 2JMKA 3E08A 3EVYA 4AQGA 5LGUB 2CA5A 5HWYA 2IW5B 1MIWA 4NUUA 5L3CB 4M1PA 4QHOA 2NTYA 4H9PC 3RC3A 3FHNA 3OYXA 2CXLA 2C5JA 3QC9A 2PG8A 2NOXA 1YKHB 2NWBA 2H7VC 2RA1A 2E9XB 4WBOA 2NW9A 2KT9A 3CX6B 3DJBA 3WAKA 3ZYMA 2JJ9A 2XAQB 3FB2A 3C4WA 5BMVE 2PJQA 3LBXB 1G8XA 2X51A 2CXDA 2Y8DA 2LOSA 3ETUA 2CWOA 3ZN0B 3OJAA 2C5KT 4TX5A 5LHGB 4XZCA 3KV5A 1VOMA 4X1KE 3RKOA 3ZEFB 2KNDA 1MMNA 1HF8A 4EZ4A 3HA4A 2D0UA 3PU8A 4KUMB 2V7KA 2V7MA 1MMGA 3C98B 5F8PA 2KNGA 2PBIA 2H3RA 3KBUA 2MOZA 3KV9A 4HFVA 2HH7A 1OXZA 5LYJE 4EYYR 2KXPB 4ANJA 5HAXA 4EOZB 2CM0A 1MIVA 4PJLA 1IZNB 1G73A 2CLYB 2RP4A 2SPCA 3U78A 5JRCA 2IC6A 2VASA 5LJNA 2JMHA 3HKEE 3B13A 4V1Av 3RYFE 5H6QB 5AFUL 3ZMSB 2ZLYA 4IE7A 3EDUA 2Z6EA 5LA6E 3PUQA 4HKAA 5LOVE 4I50E 4ZI7E 2LEHA 5HYAA 3C4ZA 3H3AA 4CXXA 2A72A 3IEEA 4HN9A 3LG7A 3N9MA 4OHFA 5IHYA 2DWKA 1BR2A 1NAFA 4HE8A 3ZCJA 3E0ZA 3RX6A 5L3DB 2XAJB 4H63H 3NBXX 4TV8E 2K9AA 3WI3A 3UUNA 3MK7C 4OYJA 2YINA 4ZI3D 1MNEA 1OWAA 2M67A 3OKQA 2YEVC 4HGAA 4OFZA 4YJ2E 5EK4A 4QKNA 1LKXA 5JDFA 3UUXB 3ZJ1A 2K9QA 3ETVA 2MBGA 4BJNA 4DMVA 2E8IA 3KINB 3KFWX 4C90A 2EHOC 5ETWA 3IHRA 3O1HA 3BQKA 4YJ3E 2CWYA 1ZKEA 5KMGP 3AB3B 2EHOA 3AVRA 4X1YE 3UUMA 3N2GE 4QXCB 5LP6E 3OBVE 3S4UA 1WYCA 4EB6E 2Q9QC 1E1HB 1SHZC 2X0LB 4O4JE 4CI3B 4IE6A 2B1EA 3UFEA 4A56A 2WWUA 2L9QA 4ZS2A 2ODUA 2NW8A 5L3BB 5FY0A 4TV9E 3C50A 5EK3A 2LSJA 3PUAA 4EIWA 1CUNA 4MLKA 2CBGA 4ZHQE 2NW7A 5LGNB 2I59A 2XHEB 3LK3B 2K24A 4KMCA 2CMRA 4IE5A 2VWAA 5H6RB 3IBPA 2N2NA 2GK9A 1U5PA 3V5SA 2CE7A 4WBNE 2KZ7B 3FXDB 2PFVA 2RQYA 3Q2MA 2X9YA 2E9XC 4MBQA 2KWIB 4O4HE 3NZQA 3MXZA 3O4XE 4E7ZA 3RYIE 3AA1B 3ANWB 4FI5A 1UX5A 2HPJA 1EZ3A 2E9XA 3PTRB 4GOUA 3UT5E 3ZPOA 4WW0A 1NWMX 3GN5B 3H37A 4YHJA 5DQVA 1BR4A 4PFOA 3O9XA 2X67A 4PFPA 3LBXA 3PUSA 3I0QA 4AKIA 2LJLA 5L3FB 2CXFA 5EZYE 3Q9DA 3VHLA 3D0TA 4O4IE 2NTXA 2WSSV 1S35A 4N78D 2D0TA 3HL6A 4MHCA 2NP9A 3ZMVB 5HXHA 4PJNA 2VKOA 2OA5A 4I43B 2OUTA 1HTJF 2L3LA 5CA1E 3GMIA 3NRXA 2IAKA 2BVMA 4QX8B 2A2FX 3I9WA 3RYHE 3ONXA 3RH3A 2CLYC 2W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWH A;  3UFE A; 
#chains in the Genus database with same CATH topology
 4BA9 A;  3L8R A;  4Q25 A;  3SOL A;  3M65 A;  4YXD A;  5AQV B;  2V7I A;  3PE0 A;  2RPA A;  3QUJ A;  3RF1 A;  4AXP A;  3AA0 B;  3KVA A;  1D0Y A;  2ODV A;  1WR0 A;  4KHZ F;  3JAF A;  1SA0 E;  2LRK A;  2ZMA A;  3U3I A;  3V5U A;  4ILA A;  5AQQ B;  2CCQ A;  2YU1 A;  2XPK A;  1QSD A;  2HPL A;  3CPZ A;  4TNV A;  5FL0 A;  2X9W A;  3RPU A;  1HG2 A;  3AEA A;  2K5B B;  2LHR A;  3ZYL A;  3P50 A;  4I4T E;  5HCJ A;  1N33 T;  3C51 A;  4X1I E;  4ZI3 C;  5KXJ A;  4LF8 T;  2VK9 A;  3FZH B;  4AIS A;  4ZI2 D;  3L3P A;  3S4D A;  3LJC A;  4QX7 B;  5KX5 E;  1ZEE A;  2JQ9 A;  3MZK B;  2D9D A;  2Y6X A;  4FJO A;  3MA9 A;  4IDZ A;  2WCA A;  4PW8 A;  4U33 A;  2LE8 A;  4L0R A;  4GIW A;  2CHO A;  4U74 A;  1HNW T;  2FJA A;  1N32 T;  4F9K A;  2IHR 1;  3UU5 A;  3FXE B;  1HS7 A;  5LJM A;  1FMV A;  3QDE A;  4DUY T;  4NUV A;  1MIY A;  3VKH A;  1YD8 G;  2ACZ A;  2D2S A;  1ZP0 A;  2IZY A;  2JQQ A;  4O4L E;  1Y64 B;  3Q5E A;  1HFA A;  4B6X A;  4PJM A;  3ZT6 A;  3BQL A;  4H9Q C;  2YN6 A;  2L8K A;  1GQE A;  2BS3 A;  3UFG A;  2BDE A;  2BBH A;  5E0O A;  2W4X A;  2XAG B;  1W0A A;  2XQ5 A;  2WU5 A;  5ABH A;  3ACT A;  1OED B;  1L6E A;  5HEJ A;  2IDO B;  3W15 B;  2N9D A;  1UGO A;  5ABF B;  2XM2 A;  2DCF A;  4BJM A;  4ZZB A;  4DV4 T;  5HXR A;  2KYG A;  3GA8 A;  2X66 A;  5IYZ E;  2XAH B;  5BR8 T;  1JNR A;  3R6N A;  2KMF A;  5F3J A;  3AXJ B;  1CHU A;  4AI6 A;  4K0U A;  4P0A A;  5J0Z A;  1J5W A;  2V5C A;  3LK4 2;  4IGU A;  4DR4 T;  2FJD A;  3AVS A;  2BZB A;  5AQN B;  4ASK A;  2CQS A;  3PUG A;  2W66 A;  4DMW A;  1FEW A;  2BKO A;  1KNZ A;  2IC9 A;  3R84 B;  1IJ5 A;  3N2O A;  4K0K T;  3N5L A;  4IHJ E;  3PDY A;  3ZC1 A;  2EHO B;  3AA6 B;  4IIJ E;  2MTQ A;  2LSG A;  4DV1 T;  4DND A;  1N34 T;  3K1S A;  3CWZ B;  3CX8 B;  2ACX A;  5AQI B;  4EED A;  2XQ3 A;  4DVD A;  4L9I A;  4UF0 A;  1O3X A;  5C3J A;  1KF6 A;  3LK2 B;  4IL9 A;  4JEU B;  2DLR A;  5FY1 A;  2LT3 A;  3EUH A;  4GK5 E;  4ZI2 C;  3EVY A;  4AQG A;  2CA5 A;  2LKG A;  5L3C B;  1W09 A;  1SE7 A;  3OYX A;  3QC9 A;  2NOX A;  2RA1 A;  4YT0 A;  4WBO A;  1JNZ A;  3CX6 B;  3ZYM A;  2JJ9 A;  3FB2 A;  3RI5 A;  5BMV E;  3RRS A;  3FZF B;  3ETU A;  1WFD A;  3OJA A;  3UU3 A;  2C5K T;  4TX5 A;  4LF5 T;  4XZC A;  4DV2 T;  2KND A;  1HF8 A;  1UK5 A;  3PU8 A;  2V7M A;  1UUR A;  1MMG A;  5F8P A;  3QNU A;  2BS2 A;  4ANJ A;  5HAX A;  3U78 A;  5LJN A;  2CPT A;  4V1A v;  3TLT A;  3PUQ A;  4I50 E;  3TLW A;  3C4Z A;  2UXB T;  3N9M A;  2DWK A;  1BR2 A;  3ZCJ A;  5L3D B;  4H63 H;  2AXD S;  4TV8 E;  3JCF A;  4OYJ A;  1XWM A;  1OWA A;  4OFZ A;  2E2A A;  1LKX A;  4HWI B;  3ETV A;  3ZKR A;  4C90 A;  3IHR A;  1XNR T;  3UQ4 A;  4YJ3 E;  4B3S T;  3N2G E;  3OBV E;  3ONL C;  1SUM B;  1WYC A;  2Q9Q C;  1SHZ C;  4O4J E;  5ABE A;  4JI6 T;  1XMQ T;  4X5T A;  4CI3 B;  5HEG A;  4A56 A;  2BS4 A;  2WWU A;  2L9Q A;  2NW8 A;  4LF4 T;  3C50 A;  2LSJ A;  4MLK A;  1I94 T;  5FL1 A;  2K24 A;  4IE5 A;  2VWA A;  5HVZ A;  5AQU B;  4IRE A;  2KZ7 B;  2IML A;  2RQY A;  4NXN T;  4O4H E;  3MXZ A;  2HPJ A;  1EZ3 A;  3AE5 A;  3ZPO A;  3GN5 B;  5DQV A;  1T8B A;  1FJG T;  3LBX A;  3PUS A;  5L3F B;  2CXF A;  2CHN A;  3D0T A;  2WSS V;  2V5D A;  3RIU C;  3RGL A;  5HXH A;  4PJN A;  2W2U A;  2OA5 A;  4TWH A;  3RIU A;  4EEB A;  2WZH A;  4I43 B;  5CA1 E;  3GMI A;  4CN4 A;  1XDO A;  3RH3 A;  1OED E;  2P9B A;  5JR9 B;  1KFY A;  1D1A A;  5AQR B;  2C0S A;  3RRC A;  1X9B A;  4O8S A;  3A5X A;  4ZXL A;  2Y48 B;  5AQM B;  5TAO A;  4IE4 A;  1I6Z A;  3JC6 D;  3RHW A;  4KI0 F;  2XAS B;  2W0G A;  3Q5W A;  2DI4 A;  4CZZ B;  4H63 V;  2H7O A;  1WLX A;  5FNV E;  2LSY A;  4EAH A;  3JAE A;  3A8Y C;  3ZMU B;  4HWF A;  2KSR A;  2V1D B;  1WCR A;  4CI2 B;  3TKL B;  3P4R A;  5JDH A;  5LG3 A;  3UU8 A;  4DV3 T;  3QB5 A;  4L5G A;  5JTG A;  5L4H A;  2UUA T;  2XQ6 A;  3N2K E;  5C8Y E;  5GON E;  2W61 A;  5LGT B;  1D0X A;  2C5I T;  4EYU A;  3FBL A;  3K3N A;  3RC8 A;  4DR3 T;  4U3C A;  2X9H A;  2V26 A;  4LF7 T;  2VKD A;  5FY7 A;  3SWH A;  2BBJ A;  5AQJ B;  3ANW A;  4HFI A;  4NPP A;  3CVR A;  4UEL A;  3GWH A;  3CQG B;  4ILU A;  5J2T E;  3FZK B;  1FIO A;  5LMN T;  3Q5D A;  4PNI A;  2WP9 A;  4C91 A;  5IUX A;  4BAY B;  4F8H A;  1IJ6 A;  3EAM A;  2FJE A;  4ADZ A;  4P1N A;  3H3M A;  5HXS A;  2MPK A;  1S94 A;  3ZT5 A;  2I0M A;  1E7P A;  1H7C A;  3I1A A;  2V6Y B;  3P4W A;  3Q5X A;  5JH7 E;  5FVK A;  2OV9 A;  2WY2 A;  3SFE A;  3C64 A;  2ZM8 A;  3VR9 A;  3NZP A;  2VKH A;  2XUE A;  3TLV A;  3KV4 A;  2H89 A;  3N9P A;  3RSY A;  2EHO D;  2LSI A;  1KNR A;  4WZX A;  3C4X A;  5JDM A;  2A3D A;  5LNK A;  1BR1 A;  4O2B E;  2DNX A;  3UUL A;  5J1G A;  2DRN A;  1DU2 A;  4XBF B;  1NEN A;  4Z90 A;  3CK6 A;  2BVL A;  4J2C A;  4NIQ A;  2BG9 B;  4MFR A;  4H9O C;  5FMN A;  3KDS E;  4OYK A;  1XMO T;  4YLH A;  4TNW A;  3JC6 C;  2MYS A;  2ZM2 A;  2UXN B;  3OYZ A;  3IF8 B;  5AQH B;  3LSV A;  2LHN A;  3FZM B;  4IST A;  3RYC E;  3T1H T;  3PUW F;  4CXW A;  2X68 A;  4LMJ A;  4ISS A;  2FJB A;  4DO0 A;  3PMI A;  4QH1 A;  2W62 A;  2X9X A;  4QH4 A;  4G63 A;  4H9S E;  4IL4 A;  1LVF A;  4HFB A;  3E08 A;  3AED A;  3G06 A;  4QHO A;  1KEY A;  3FHN A;  2PG8 A;  2H7V C;  4JI4 T;  4NXM T;  2XAQ B;  3TLU A;  2E5L T;  2CWO A;  4LF9 T;  3UUB A;  4JI2 T;  1OED C;  2R6G F;  1MMN A;  3RIF A;  1OED A;  4EZ4 A;  3ZT7 A;  3AEC A;  4AQY T;  2H3R A;  2MOZ A;  3KV9 A;  3S4C A;  4COF A;  2E5V A;  3S4A A;  2UXC T;  4UR9 A;  1MIV A;  1G73 A;  2WB5 A;  2X0H A;  5AFU L;  2ZLY A;  3EDU A;  4KHP T;  2Z6E A;  5LA6 E;  5LOV E;  4HKA A;  3G36 A;  2LEH A;  3AXJ A;  3H3A A;  3LG7 A;  5IHY A;  2W67 A;  3RX6 A;  3NBX X;  2K9A A;  3OKQ A;  2XM1 A;  2K9Q A;  2MBG A;  3UQ7 A;  3KFW X;  1T7S A;  2EHO C;  5ETW A;  3O1H A;  2EHO A;  3IM4 A;  4QXC B;  3VRA A;  3S4U A;  2EZW A;  1UUS A;  2V8S V;  3UU6 A;  2X0L B;  4IE6 A;  2B1E A;  3T1Y T;  1J1J A;  2QRX A;  3AE8 A;  3QFY A;  1CUN A;  4ZHQ E;  2WDV A;  2XHE B;  3LK3 B;  2CMR A;  3IBP A;  2GK9 A;  1U5P A;  4EV6 A;  1VCT A;  2X9Y A;  2KWI B;  4GKJ T;  3NZQ A;  2IUB A;  3O4X E;  3RYI E;  1UX5 A;  4DR6 T;  1NWM X;  3H37 A;  1BR4 A;  4PFO A;  4ZZC A;  2LJL A;  5AQF B;  4B3M T;  4HFE A;  3Q9D A;  2HN1 A;  1R8I A;  2VVS A;  1S35 A;  4N78 D;  2D0T A;  3M3Z B;  3HL6 A;  2M6B A;  2VKO A;  2B76 A;  4LMK A;  2L3L A;  4U7I A;  3RYH E;  2FUP A;  3MKD A;  1UX4 A;  1YKE B;  2WMO A;  2UUC T;  3J7Y q;  4KP3 C;  2WAU A;  3QOF A;  1BR0 A;  5DQW A;  2I6H A;  3IA3 A;  5HXE A;  3BK9 A;  4JLE A;  1D1B A;  2UUB T;  1FMW A;  5EK2 A;  1ZHC A;  1B7T A;  4U2Y A;  4UVB B;  2XAF B;  4AKH A;  5FXZ A;  1HCI A;  3RIA A;  2XZE A;  3AEE A;  4RTA A;  5FP3 A;  5C2T A;  4IDN A;  5AQP B;  4HWC A;  5CB4 E;  4Z8X A;  5CGM A;  1XDP A;  5HWX A;  1KNP A;  3J9X 1;  2WBL A;  2W63 A;  2VKJ A;  3VR8 A;  2BG9 E;  2K3W A;  5LB7 B;  4DBQ A;  4IDP A;  1X79 A;  2QGS A;  3VRB A;  5HEU A;  4RT4 A;  2J1D G;  2CQT A;  3A7M A;  1VRB A;  3F57 A;  3AFJ A;  4HEA A;  4X64 T;  4YHH T;  5AQK B;  1T72 A;  1Z0P A;  4PK6 A;  4IT4 A;  5AQT B;  5JDL A;  4DV7 T;  4JV5 T;  3VKG A;  4UXN B;  3F2E A;  4JI0 T;  2E9X D;  2Q9Q B;  3S4B A;  4ZOL E;  3ESL A;  1V9D A;  2VVN A;  2XQY A;  3ZYK A;  3K3Q C;  2VL0 A;  1R2A A;  1ZV4 X;  3AAA B;  3LFM A;  3PUV F;  4P0B A;  1U4Q A;  3AE1 A;  1J5E T;  1WYB A;  2LKH A;  5FXW A;  5ABG A;  3GN5 A;  3JAD A;  5FYM A;  5AQS B;  5LBM A;  4UVA B;  5JDN A;  2YU2 A;  3KVB A;  2XJ7 A;  3IM3 A;  4EGW A;  1YQ3 A;  3WAJ A;  3SS1 A;  5FXX A;  4UV9 B;  3PJA A;  2PTF A;  4I55 E;  4TZ4 C;  2WM9 A;  2KIN B;  5JR9 C;  3HKC E;  5JR9 A;  5JDQ A;  3CX7 B;  5L4E A;  2XSB A;  4H9N C;  4XAX B;  3PJA J;  4AIU A;  3E22 E;  5DAB A;  2QA7 A;  1QLB A;  1WRD A;  2ZM0 A;  5JRC B;  1HNZ T;  3CQX C;  2ES0 A;  4PK4 A;  3ZMZ B;  3N9O A;  3VU7 H;  4DV6 T;  3ONJ A;  3ZMT B;  4MAL A;  1W9R A;  4X20 E;  3L39 A;  2LOP A;  2CEA A;  2WWV A;  3MAC A;  4DID B;  3AEB A;  3I9Y A;  4GYS A;  5A1L A;  4TUY E;  1YW0 A;  3KV6 A;  2LM9 A;  2AE9 A;  3HR0 A;  1HR0 T;  3AA7 B;  4YSZ A;  2UU9 T;  2HHH T;  2V7J A;  3OPC A;  4ZEY A;  3AAI A;  1IAP A;  3K8P C;  5LHI B;  3RQW A;  4JEH B;  4JI3 T;  4HTE A;  3SRZ A;  3I0O A;  4UV8 B;  4KBM B;  3RRW A;  3AE9 A;  5JVD E;  4A98 A;  1E2A A;  3FZL B;  3KBT A;  2DHR A;  4TN7 B;  4OK0 A;  4QXH B;  3FBZ A;  4AQF C;  3T8O A;  4GYR A;  4AQF A;  2CRB A;  2IW5 B;  1MIW A;  4NUU A;  2NTY A;  1YKH B;  2NWB A;  4TWF A;  2E9X B;  2LRL A;  2KT9 A;  3DJB A;  4B3R T;  2PJQ A;  1G8X A;  2CXD A;  2Y8D A;  3ZN0 B;  2XQ9 A;  1VCS A;  2XQ7 A;  3KV5 A;  1VOM A;  3RKO A;  2V6Y A;  5LMU T;  3ZEF B;  2VQE T;  3HA4 A;  4X65 T;  2V7K A;  4DUZ T;  2PBI A;  3KBU A;  2HH7 A;  4YSX A;  1OXZ A;  2WDQ A;  4PJL A;  1IZN B;  2CLY B;  2SPC A;  3HKE E;  3RYF E;  5H6Q B;  3ZMS B;  4RIQ A;  4ZI7 E;  4CXX A;  2A72 A;  3IEE A;  4HN9 A;  2XY8 B;  2WS3 A;  3ACS A;  1NAF A;  3E0Z A;  4TWD A;  2XAJ B;  3WI3 A;  3ZSS A;  3UUN A;  3MK7 C;  2YIN A;  2BG9 C;  2YEV C;  4HGA A;  2QVA A;  5HCM A;  5EK4 A;  3UUX B;  5CFB A;  2BG9 A;  2OLT A;  4A5X A;  2H88 A;  5KMG P;  1ZKE A;  2YOE A;  3AVR A;  2F4V T;  1M62 A;  5LP6 E;  4EB6 E;  5F5W A;  2XQ4 A;  3NVO A;  1E1H B;  3NKZ A;  4I0U A;  1ZOY A;  2LM2 A;  4ZS2 A;  2ODU A;  2I15 A;  5L3B B;  5FY0 A;  4TV9 E;  4U2Z A;  2CBG A;  4Z91 A;  5LGN B;  2I59 A;  3NWI A;  5FVL A;  3AE6 A;  2CBJ A;  3V5S A;  1W0B A;  3FXD B;  4HFD A;  4MBQ A;  1YXR A;  5HEO A;  3PTR B;  4WW0 A;  2X67 A;  4PFP A;  2YDR A;  4AKI A;  1N36 T;  3VHL A;  1XNQ T;  4CN1 A;  3ZMV B;  2OUT A;  4YSY A;  2H9R A;  2BVM A;  4QX8 B;  2A2F X;  3I9W A;  5ABF A;  4P09 A;  1MMD A;  2WQY A;  4JI7 T;  4PK5 A;  5L47 A;  3ABV A;  4YTP A;  1LRZ A;  1YQ4 A;  3ZCI A;  3B5M A;  2JRK A;  5LCY A;  5JRE A;  3EI0 A;  3N9N A;  3CIR A;  3OTO T;  4JI8 T;  2LSK A;  4HFC A;  2KWH A;  4JUY A;  4UEM A;  3PUY F;  5IWA T;  3EHZ A;  4IDQ A;  3PUX F;  4QWN B;  4CXY A;  2K48 A;  4DBR A;  1L0V A;  4LML A;  2Q9Q D;  2HN2 A;  2FBW A;  2N1G A;  5CA0 E;  1US7 B;  4AKG A;  3BQI A;  3O1J A;  4UIG A;  3K3O A;  3ZJ2 A;  2VQF T;  1HX1 B;  1KK7 A;  3ZC0 A;  2CB9 A;  5J2U E;  1QUU A;  4ILB A;  5FXV A;  4DR7 T;  3ZLI A;  4AKR B;  5JQG E;  1XZY A;  4YFS A;  2JQH A;  2VUR A;  2V6X A;  3AEF A;  2XQA A;  1MMA A;  4ILC A;  3B57 A;  4IE0 A;  4U72 A;  1AJ3 A;  3EAB A;  3RQU A;  4U31 A;  4UF0 B;  2JPF A;  3LDQ B;  1IBK T;  1HNX T;  1MND A;  2VL8 A;  3AE3 A;  5JDG A;  3HI2 A;  3ZN1 B;  4IDO A;  3O1I A;  3P8C D;  1WR6 A;  1HG5 A;  2UXX B;  3DP7 A;  3X1D A;  4DR1 T;  3P7I A;  3PU3 A;  5CJ5 A;  2VB6 A;  3N9Q A;  3QK6 A;  4GK0 E;  3HKD E;  5HXC A;  5L3E B;  1HX8 A;  3PUZ F;  4F6R C;  3P4S A;  3QG0 A;  2DWG A;  4G2A A;  2XTL A;  2YK0 A;  4YTM A;  4CI1 B;  4EXT A;  3PUR A;  4DV5 T;  5ADX L;  4E7S A;  2WMN A;  4PAG A;  4JI1 T;  2WZI A;  2IIU A;  1IBL T;  2M6I A;  2YDQ A;  4YTN A;  2CBI A;  3HKB E;  3UTK A;  4UVC B;  1D1C A;  4DR2 T;  2D5U A;  5LG4 A;  4ZS3 A;  5M4Y A;  3F31 A;  3L09 A;  3MJX A;  4H9R C;  2UXD T;  3NRY A;  3AAE B;  1M7K A;  4OX9 T;  4QXB B;  4JI5 T;  3N9L A;  4CN6 A;  4AKL A;  3TLS A;  5KDM C;  5LXT E;  1Z8U A;  4ERR A;  4U7Y A;  3QFZ A;  3DTO A;  4HWH A;  3CQC B;  1T98 A;  4PJJ A;  1D0Z A;  2V7L A;  4LFC T;  4HFH A;  4LF6 T;  2KLQ A;  1UCU A;  3EDV A;  4JYA T;  2Q9Q A;  5LHH B;  5L2L A;  3CML A;  4O2A E;  2G0U A;  4EZH A;  3CKD A;  1Y01 A;  2MAW A;  5L3G B;  2DL1 A;  1LVK A;  5LBQ B;  2QYW A;  5DJQ C;  4WNK A;  4CQI A;  4DV0 T;  2JMK A;  5LGU B;  2YDS A;  5HWY A;  4M1P A;  4H9P C;  3RC3 A;  2CXL A;  2C5J A;  2NW9 A;  2A9U A;  2J4G A;  2BKN A;  3WAK A;  3C4W A;  3LBX B;  3AE4 A;  4ZP3 A;  2X51 A;  2WU2 A;  2LOS A;  4JBW F;  4DR5 T;  5LHG B;  4X1K E;  5FKY A;  4LFA T;  2D0U A;  3AEG A;  4KUM B;  3ZST A;  3C98 B;  1IBM T;  2KNG A;  4HFV A;  5AQO B;  5LYJ E;  4EYY R;  2KXP B;  4EOZ B;  3RLF F;  2CM0 A;  4GKK T;  2RP4 A;  5JRC A;  2IC6 A;  2VAS A;  2JMH A;  2JQK A;  4WYV A;  3B13 A;  4LFB T;  3AE2 A;  4IE7 A;  5HYA A;  2ZM6 T;  4OHF A;  4HE8 A;  2J62 A;  4ZI3 D;  1MNE A;  2M67 A;  4YJ2 E;  4QKN A;  2X0Y A;  5JDF A;  3ZJ1 A;  4QH5 A;  3P4P A;  4BJN A;  1NEK A;  4DMV A;  2E8I A;  3KIN B;  4X62 T;  3BQK A;  2CWY A;  3AB3 B;  3SFD A;  4X1Y E;  2LLY A;  3UUM A;  4KX6 A;  2YKS A;  5AQG B;  4YY3 T;  3P4Q A;  3UFE A;  5HEH A;  3OVU A;  3RKG A;  4A97 A;  4B3T T;  5EK3 A;  3PUA A;  4EIW A;  4HWD A;  2NW7 A;  4KMC A;  5H6R B;  2N2N A;  2BKP A;  2CE7 A;  4WBN E;  2PFV A;  3Q2M A;  2E9X C;  2NR4 A;  4E7Z A;  2WDR A;  3AA1 B;  3ANW B;  4FI5 A;  2E9X A;  4GOU A;  3UT5 E;  4YHJ A;  3O9X A;  2XQ8 A;  3I0Q A;  5EZY E;  2J47 A;  3UU4 A;  4O4I E;  2NTX A;  4MHC A;  2NP9 A;  2JIW A;  3AE7 A;  2XSA A;  3QB5 K;  1HTJ F;  3PV0 F;  3NRX A;  2IAK A;  5AQL B;  3ONX A;  2CLY C;  2W00 A;  4X66 T; 
#chains in the Genus database with same CATH homology
 3MKD A;  4BA9 A;  1UX4 A;  2P9B A;  4P09 A;  1MMD A;  5JR9 B;  4PK5 A;  1YKE B;  2WMO A;  3SOL A;  3M65 A;  1D1A A;  3J7Y q;  4KP3 C;  2WAU A;  1BR0 A;  5DQW A;  2C0S A;  3RRC A;  1LRZ A;  4O8S A;  2V7I A;  5HXE A;  3A5X A;  3BK9 A;  3PE0 A;  4JLE A;  1D1B A;  3ZCI A;  2JRK A;  5LCY A;  5JRE A;  3N9N A;  1FMW A;  2Y48 B;  3QUJ A;  2LSK A;  5TAO A;  4IE4 A;  5EK2 A;  1ZHC A;  2KWH A;  1B7T A;  4UVB B;  2XAF B;  4AXP A;  4AKH A;  4JUY A;  3JC6 D;  5FXZ A;  1HCI A;  3AA0 B;  4UEM A;  3KVA A;  1D0Y A;  2ODV A;  5FP3 A;  1SA0 E;  2ZMA A;  2XAS B;  4QWN B;  2W0G A;  3U3I A;  4CXY A;  3Q5W A;  2K48 A;  2DI4 A;  4CZZ B;  4H63 V;  2H7O A;  4DBR A;  3V5U A;  5CB4 E;  1WLX A;  2Q9Q D;  2CCQ A;  2YU1 A;  5FNV E;  1QSD A;  2N1G A;  2LSY A;  4Z8X A;  4EAH A;  5CA0 E;  1US7 B;  2HPL A;  4AKG A;  3BQI A;  3CPZ A;  3ZMU B;  5HWX A;  2V1D B;  3J9X 1;  2WBL A;  2W63 A;  3O1J A;  2VKJ A;  4CI2 B;  2X9W A;  4UIG A;  3K3O A;  3RPU A;  1HG2 A;  3ZJ2 A;  2K5B B;  3TKL B;  1KK7 A;  4DBQ A;  5JDH A;  1X79 A;  2QGS A;  2LHR A;  3ZYL A;  3ZC0 A;  2CB9 A;  5J2U E;  1QUU A;  2J1D G;  4I4T E;  5FXV A;  1VRB A;  3F57 A;  3ZLI A;  3C51 A;  4X1I E;  4ZI3 C;  4L5G A;  2VK9 A;  4ZI2 D;  4AKR B;  5JQG E;  4HEA A;  3L3P A;  4YFS A;  3LJC A;  4QX7 B;  1Z0P A;  4PK6 A;  3N2K E;  5KX5 E;  1ZEE A;  5JDL A;  5C8Y E;  5GON E;  2W61 A;  3MZK B;  3VKG A;  5LGT B;  1D0X A;  2C5I T;  1MMA A;  2Y6X A;  4FJO A;  4UXN B;  3B57 A;  3F2E A;  3MA9 A;  2E9X D;  2Q9Q B;  4IDZ A;  4EYU A;  3FBL A;  4IE0 A;  3K3N A;  4U72 A;  4ZOL E;  3RC8 A;  3ESL A;  1AJ3 A;  1V9D A;  4PW8 A;  2LE8 A;  4L0R A;  4UF0 B;  2JPF A;  2X9H A;  2XQY A;  2V26 A;  3ZYK A;  3K3Q C;  2VKD A;  4GIW A;  5FY7 A;  1ZV4 X;  3AAA B;  3LFM A;  4U74 A;  4P0B A;  3SWH A;  1U4Q A;  1MND A;  2VL8 A;  1WYB A;  3ANW A;  5FXW A;  3CVR A;  5JDG A;  4UEL A;  3GWH A;  3FXE B;  3HI2 A;  1HS7 A;  5LJM A;  3GN5 A;  3ZN1 B;  3CQG B;  1FMV A;  4ILU A;  5J2T E;  5FYM A;  4NUV A;  3O1I A;  3P8C D;  1WR6 A;  4UVA B;  1HG5 A;  2UXX B;  1MIY A;  1FIO A;  3DP7 A;  5LBM A;  5JDN A;  4PNI A;  3VKH A;  4C91 A;  2YU2 A;  1YD8 G;  4BAY B;  3KVB A;  2D2S A;  1IJ6 A;  2JQQ A;  4O4L E;  3P7I A;  3PU3 A;  1Y64 B;  1HFA A;  4B6X A;  4PJM A;  4ADZ A;  3BQL A;  3WAJ A;  3SS1 A;  5HXS A;  5FXX A;  1S94 A;  4H9Q C;  2VB6 A;  3N9Q A;  3QK6 A;  4UV9 B;  2L8K A;  4GK0 E;  4I55 E;  3HKD E;  4TZ4 C;  5HXC A;  2BDE A;  5L3E B;  1HX8 A;  2WM9 A;  4F6R C;  1H7C A;  2KIN B;  3I1A A;  5E0O A;  2XAG B;  5JR9 C;  2DWG A;  3Q5X A;  5JH7 E;  4G2A A;  3HKC E;  5JR9 A;  5JDQ A;  2XTL A;  2YK0 A;  4CI1 B;  3CX7 B;  4EXT A;  3PUR A;  3C64 A;  4H9N C;  3W15 B;  2ZM8 A;  2N9D A;  3NZP A;  4XAX B;  2DCF A;  2VKH A;  2XUE A;  3E22 E;  4E7S A;  5ADX L;  5DAB A;  4BJM A;  2QA7 A;  5HXR A;  3GA8 A;  2X66 A;  1WRD A;  2WMN A;  2ZM0 A;  3KV4 A;  4PAG A;  5IYZ E;  5JRC B;  2XAH B;  3N9P A;  3CQX C;  2ES0 A;  2EHO D;  2LSI A;  4PK4 A;  3ZMZ B;  3N9O A;  3HKB E;  3C4X A;  3UTK A;  3VU7 H;  5JDM A;  2A3D A;  3R6N A;  5LNK A;  2KMF A;  1BR1 A;  4UVC B;  3ZMT B;  4MAL A;  5F3J A;  1D1C A;  4AI6 A;  4K0U A;  4P0A A;  4O2B E;  4X20 E;  2DNX A;  2D5U A;  5LG4 A;  2LOP A;  3UUL A;  4ZS3 A;  5M4Y A;  3F31 A;  2CEA A;  3L09 A;  3MJX A;  4H9R C;  5J1G A;  3MAC A;  3NRY A;  3LK4 2;  4IGU A;  4XBF B;  3AAE B;  3I9Y A;  4GYS A;  5A1L A;  4TUY E;  3AVS A;  1YW0 A;  2BZB A;  4QXB B;  4ASK A;  2BVL A;  3KV6 A;  3PUG A;  4J2C A;  2LM9 A;  4MFR A;  4DMW A;  1FEW A;  3HR0 A;  4H9O C;  1KNZ A;  2IC9 A;  3N9L A;  3KDS E;  1IJ5 A;  4OYK A;  3N2O A;  3AA7 B;  5FMN A;  3R84 B;  4AKL A;  4YLH A;  3JC6 C;  5KDM C;  2MYS A;  5LXT E;  3N5L A;  4IHJ E;  4ERR A;  3PDY A;  2ZM2 A;  3ZC1 A;  2V7J A;  2EHO B;  2UXN B;  3OYZ A;  3DTO A;  3IF8 B;  3AA6 B;  3AAI A;  1IAP A;  3K8P C;  4IIJ E;  5LHI B;  2MTQ A;  3CQC B;  2LSG A;  1T98 A;  4PJJ A;  4DND A;  1D0Z A;  3CWZ B;  2V7L A;  4JEH B;  4HTE A;  3SRZ A;  3CX8 B;  2LHN A;  3I0O A;  4IST A;  2ACX A;  2KLQ A;  1UCU A;  3RYC E;  3EDV A;  4UV8 B;  4KBM B;  2Q9Q A;  3RRW A;  4CXW A;  5LHH B;  2X68 A;  5L2L A;  3CML A;  4O2A E;  4DVD A;  5JVD E;  4L9I A;  4UF0 A;  1O3X A;  2G0U A;  4ISS A;  4EZH A;  3CKD A;  3LK2 B;  3KBT A;  4DO0 A;  5L3G B;  4JEU B;  2DHR A;  3PMI A;  4TN7 B;  4OK0 A;  4QXH B;  2DLR A;  5FY1 A;  3FBZ A;  1LVK A;  4AQF C;  3T8O A;  2W62 A;  5LBQ B;  2X9X A;  2LT3 A;  3EUH A;  4GYR A;  5DJQ C;  4GK5 E;  4WNK A;  4G63 A;  4H9S E;  4CQI A;  4AQF A;  4ZI2 C;  1LVF A;  2JMK A;  3E08 A;  3EVY A;  4AQG A;  5LGU B;  2CA5 A;  5HWY A;  2IW5 B;  1MIW A;  4NUU A;  5L3C B;  4M1P A;  4QHO A;  2NTY A;  4H9P C;  3RC3 A;  3FHN A;  3OYX A;  2CXL A;  2C5J A;  3QC9 A;  2PG8 A;  2NOX A;  1YKH B;  2NWB A;  2H7V C;  2RA1 A;  2E9X B;  4WBO A;  2NW9 A;  2KT9 A;  3CX6 B;  3DJB A;  3WAK A;  3ZYM A;  2JJ9 A;  2XAQ B;  3FB2 A;  3C4W A;  5BMV E;  2PJQ A;  3LBX B;  1G8X A;  2X51 A;  2CXD A;  2Y8D A;  2LOS A;  3ETU A;  2CWO A;  3ZN0 B;  3OJA A;  2C5K T;  4TX5 A;  5LHG B;  4XZC A;  3KV5 A;  1VOM A;  4X1K E;  3RKO A;  3ZEF B;  2KND A;  1MMN A;  1HF8 A;  4EZ4 A;  3HA4 A;  2D0U A;  3PU8 A;  4KUM B;  2V7K A;  2V7M A;  1MMG A;  3C98 B;  5F8P A;  2KNG A;  2PBI A;  2H3R A;  3KBU A;  2MOZ A;  3KV9 A;  4HFV A;  2HH7 A;  1OXZ A;  5LYJ E;  4EYY R;  2KXP B;  4ANJ A;  5HAX A;  4EOZ B;  2CM0 A;  1MIV A;  4PJL A;  1IZN B;  1G73 A;  2CLY B;  2RP4 A;  2SPC A;  3U78 A;  5JRC A;  2IC6 A;  2VAS A;  5LJN A;  2JMH A;  3HKE E;  3B13 A;  4V1A v;  3RYF E;  5H6Q B;  5AFU L;  3ZMS B;  2ZLY A;  4IE7 A;  3EDU A;  2Z6E A;  5LA6 E;  3PUQ A;  4HKA A;  5LOV E;  4I50 E;  4ZI7 E;  2LEH A;  5HYA A;  3C4Z A;  3H3A A;  4CXX A;  2A72 A;  3IEE A;  4HN9 A;  3LG7 A;  3N9M A;  4OHF A;  5IHY A;  2DWK A;  1BR2 A;  1NAF A;  4HE8 A;  3ZCJ A;  3E0Z A;  3RX6 A;  5L3D B;  2XAJ B;  4H63 H;  3NBX X;  4TV8 E;  2K9A A;  3WI3 A;  3UUN A;  3MK7 C;  4OYJ A;  2YIN A;  4ZI3 D;  1MNE A;  1OWA A;  2M67 A;  3OKQ A;  2YEV C;  4HGA A;  4OFZ A;  4YJ2 E;  5EK4 A;  4QKN A;  1LKX A;  5JDF A;  3UUX B;  3ZJ1 A;  2K9Q A;  3ETV A;  2MBG A;  4BJN A;  4DMV A;  2E8I A;  3KIN B;  3KFW X;  4C90 A;  2EHO C;  5ETW A;  3IHR A;  3O1H A;  3BQK A;  4YJ3 E;  2CWY A;  1ZKE A;  5KMG P;  3AB3 B;  2EHO A;  3AVR A;  4X1Y E;  3UUM A;  3N2G E;  4QXC B;  5LP6 E;  3OBV E;  3S4U A;  1WYC A;  4EB6 E;  2Q9Q C;  1E1H B;  1SHZ C;  2X0L B;  4O4J E;  4CI3 B;  4IE6 A;  2B1E A;  3UFE A;  4A56 A;  2WWU A;  2L9Q A;  4ZS2 A;  2ODU A;  2NW8 A;  5L3B B;  5FY0 A;  4TV9 E;  3C50 A;  5EK3 A;  2LSJ A;  3PUA A;  4EIW A;  1CUN A;  4MLK A;  2CBG A;  4ZHQ E;  2NW7 A;  5LGN B;  2I59 A;  2XHE B;  3LK3 B;  2K24 A;  4KMC A;  2CMR A;  4IE5 A;  2VWA A;  5H6R B;  3IBP A;  2N2N A;  2GK9 A;  1U5P A;  3V5S A;  2CE7 A;  4WBN E;  2KZ7 B;  3FXD B;  2PFV A;  2RQY A;  3Q2M A;  2X9Y A;  2E9X C;  4MBQ A;  2KWI B;  4O4H E;  3NZQ A;  3MXZ A;  3O4X E;  4E7Z A;  3RYI E;  3AA1 B;  3ANW B;  4FI5 A;  1UX5 A;  2HPJ A;  1EZ3 A;  2E9X A;  3PTR B;  4GOU A;  3UT5 E;  3ZPO A;  4WW0 A;  1NWM X;  3GN5 B;  3H37 A;  4YHJ A;  5DQV A;  1BR4 A;  4PFO A;  3O9X A;  2X67 A;  4PFP A;  3LBX A;  3PUS A;  3I0Q A;  4AKI A;  2LJL A;  5L3F B;  2CXF A;  5EZY E;  3Q9D A;  3VHL A;  3D0T A;  4O4I E;  2NTX A;  2WSS V;  1S35 A;  4N78 D;  2D0T A;  3HL6 A;  4MHC A;  2NP9 A;  3ZMV B;  5HXH A;  4PJN A;  2VKO A;  2OA5 A;  4I43 B;  2OUT A;  1HTJ F;  2L3L A;  5CA1 E;  3GMI A;  3NRX A;  2IAK A;  2BVM A;  4QX8 B;  2A2F X;  3I9W A;  3RYH E;  3ONX A;  3RH3 A;  2CLY C;  2W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...