1A17A

Tetratricopeptide repeats of protein phosphatase 5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
159
structure length
159
Chain Sequence
PPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 5
publication title The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 159
sequence length 159
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1997-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1a17A00
4XI0A 2LNIA 2FEZA 4U04A 1NA0A 3VTYA 1YA0A 4AY5A 5A7DB 1P5QA 4I2ZA 4XIFA 4GPKA 3LYAA 4N2SA 3QDNA 3S7JA 2P58C 3FWVA 4WNDA 3GZ2A 5ARGA 3ASHA 3K9IA 4G26A 4AY6A 5DBKA 1ELWA 4H7XA 4N3BA 3RU0A 2C0MA 3U4TA 2XGOA 3PE4A 2PQRA 4IN3B 3MKRA 2C0LA 1ZU2A 5KJMA 4AM9A 5BNWA 4JA7A 4GA0A 4I9CA 3KD7A 2L6JA 5KJKA 4N39A 3E4BA 3QWWA 4I1AA 2VGXA 3LKUA 4N5CA 3RKVA 2ONDA 4W9RA 2AVPA 3U3WA 4U0ZA 3S7DA 2PQNA 3GW4A 5CCMA 2UY1B 3ZFWA 2Y4UA 4GA1A 2XCCA 1HXIA 3CVPA 2QFCA 4UI9C 2UWJG 4EQFA 2VYIA 3ZGQA 1OUVA 4GCNA 2VSYA 3TG4A 2HO1A 4JA9A 5BW8C 5D0OD 3KS2A 3CKCA 5KJLA 5EKQD 3UUXA 3LY7A 2DBAA 4BT9A 3URZA 3OXGA 3RO3A 5CHEE 4RG6A 4ME2A 4UQXA 4UQZA 1PC2A 4YVOA 4G23A 2KATA 4BTBA 4UI9J 4HOTA 1IYGA 3MA5A 5G05C 3SZ7A 5KJNA 5JJTA 4JL0A 2HR2A 2NC9A 4BWRA 5DIZA 4I9EA 2YHCA 1KLXA 2XGSA 2VQ2A 4GZ3A 4I2WA 4O6FA 4BTAA 3CK7A 3CVNA 1NA3A 3TG5A 3TGOA 3OXLA 5JJ7A 2XEVA 3LCAA 3AS4A 3MV3B 4F3VA 2IFUA 2HYZA 2OOEA 5M72A 5G05J 3ZHEB 1KT1A 3UQ3A 4N3CA 3VTXA 3RO2A 2FF4A 4HORA 5C1DA 3IEGA 4Y6WA 3EDTB 2WPVA 2BUGA 3KAEA 4KYOB 3R9AB 4G2VA 3Q49B 1ZBPA 2JLBA 1B89A 5LCWC 2VSNA 1IHGA 1QZ2A 5HQ8A 3QOUA 2KCLA 5FZQA 1E96B 4CDRA 4N3AA 2FBNA 2KCVA 3CVQA 3OXFA 4KXKB 4GYYA 4GZ6A 3ZHEA 4APOA 2XGMA 2PZIA 4N2QA 2I6HA 3FFLA 4U07A 5FT9A 5AYWD 3QWVA 3CVLA 4U0SA 4GYWA 3Q15A 3ULQA 1FCHA 2V5FA 5LCWJ 3S7BA 1XNFA 5A6CA 2LSVA 4G24A 2R5SA 2XCBA 3QWPA 3RJVA 2UY1A 4Y6CA 4NRHB 3RIBA 2Y4TA 2YQ8A 2IF4A 3CV0A 4G1TA 3MEKA 3ZPJA 3GYZA 4ABNA 2GW1A 4GCOA 3SF4A 3FP3A 2FO7A 3JYSA 3CK9A 4YNDA 3UPVA 3PE3A 3GZ1A 1TJCA 4NQ0A 4GA2A 4YVQC 3LY8A 4I17A 4WNFA 4U0UA 1HZ4A 2KCKA 2MHKA 2VGYA 2VGXB 3AS8A 3ASFA 4GYOA 4J0UA 3CK8A 3CEQA 3ASDA 1WM5A 3S7FA 5FZRA 3HYMB 2WQHA 3PDNA 4A1SA 2C2LA 3Q5MA 3AS5A 5EX3A 5G04C 2E2EA 1W3BA 4H7YA 4JHRA 4B94A 3CKBA 5FTPA 2J9QA 3O48A 4AIFA 2Q7FA 5FJYA 3BEEA 3Q4AB 4J8DA 4LEUA 3ZN3A 1Y8MA 2LSUA 4XI9A 4RG9A 1ELRA 3QKYA 5JJ6A 5FZSA 1A17A 4WNEA 4HOSA 3ESKA 5HI7A 5D0QD 1WAO1 5ARFA 4J8EA 2XPIA 5G04J 4GZ5A 5BT1A 3LY9A 3Q47B 4UQYA 4CGWA 4J8FA 4G25A 2FI7A 4UI9K 4HOQA 4HOUA 1QQEA 1KT0A 2KC7A 4BT8A 3ASGA 3N71A 3WXXA 5EX0A 4WUYA 3NF1A 4CGVA 4KBQA 1NZNA 5CCLA 4WNGA 3LPZA 2PL2A 1HH8A 3TAXA 3MV2B
chains in the Genus database with same CATH superfamily
2V0PA 4FADA 3AU4A 3TXNA 5AENA 2IO2C 4KVOA 1N54A 1YA0A 1H6OA 4GPKA 3LYAA 4J6IA 2P58C 3HHMA 4WNDA 3CHQA 5LFAA 4LERA 4B93B 3R7RA 2MRIA 2CFZA 3G2WA 5ARGA 3ASHA 3O4ZA 2J07A 1Q2ZA 3RU0A 1TN8A 3U4TA 3DSXA 4JXTA 4JC8A 3E30A 3ZUVB 5BUZA 2PQRA 4IN3B 4O1OA 5BNWA 4GA0A 1HO8A 2J49A 4OAUC 3I4RB 2DIWA 3E4BA 3OTNA 4GMRA 4N5CA 4FJZA 2ONDA 3PRZA 3S7DA 2PQNA 5CCMA 5J08A 2IO3C 2Y4UA 1E90A 4BSXA 2XCCA 5C2YA 3V2OA 4UI9C 3NOCD 2WXHA 4EQFA 5ITZF 4JW1A 4BEPA 4GTPA 4JA9A 1UOHA 3HXDA 2FULA 3Q78A 3KS2A 1BI8B 5KJLA 2Y3AA 3UUXA 3Q9UC 2IJGX 2VSXE 2RD0A 5AIJA 4GU5A 2KM4A 4ME2A 1SQMA 3SBSA 4L23A 1PC2A 2IOSA 4YVOA 3L6AA 3UXGA 4IRUA 4G23A 2KATA 3Q7AA 3EUVA 4AV7A 3SZ7A 1S0PA 5KJNA 4L2LA 3EJNA 4Q94A 3KSLA 4MLPA 4O6FA 3CVNA 4A1GA 3TG5A 2R17C 3VLEA 2E0IA 2WMOA 4A63B 1WG0A 3V2XA 5JJ7A 3FUEA 3AS4A 3LJNA 4ATGA 3F6QA 2QYJA 1Y6IA 2DWZA 4N3CA 2ETAA 4ANWA 1BPOA 4N5QA 5CRUA 3ZEFA 3ASNE 2FF4A 2MYOA 3EHRA 3EDTB 3QNKA 2BKKB 2BUGA 4KYOB 1X5BA 3UIOC 2QYUA 4CRWA 2JLBA 1B89A 1HE8A 3FTVA 3ZYQA 2RFMA 1QZ2A 1IHBA 5AQ7A 3QOUA 1V54E 3C3RA 2KCLA 4U7EB 5LP0A 4CDRA 3C3OA 3FH8A 2OEVA 5BXOA 3ZHEA 4ZHBA 1JWGA 5JA4D 4JHKA 2GRRB 1TNZA 2P9NG 4HLEA 1JPLA 2A5UA 4HRLA 5FT9A 3FTXA 3CVLA 3PUJA 3ZXSA 4GYWA 1BI7B 2V5FA 2WXPA 3Q79A 2AJAA 5LCWJ 1EDUA 1XNFA 3EIJA 2L6BA 5FQ7A 2R5SA 2P9KG 2IF4A 3ZRHA 4GTSA 4Q69A 1E8ZA 3MEKA 3ZPJA 2XPYA 1HX8A 2GW1A 1E8WA 1MX2A 4GCOA 4E85A 4AOFA 1JUQA 3L9TA 5ENQD 5FIOA 3CVWA 5FQ8A 2BTDA 2WMNA 4EZKA 1TJCA 1Z3YA 4GMLA 4IULA 2DCPA 3UI2A 3ML8A 2V5QC 4WNFA 2WXMA 4U0UA 2X3MA 4JEUA 3SD5A 3AG2E 3VLFA 2KXPC 4XEIG 3DRAA 2B6CA 3CK8A 3L22A 2F37A 3OAWA 3RK6A 3ABLE 5AQAA 3MJWA 5HKPA 2WXLA 2C2LA 4LG6A 1N11A 4H7YA 3CKBA 5H7PA 1HF8A 2J9QA 3CQGB 1E7UA 3NOGD 3W9GA 5FJYA 3JUEA 4LUNU 1H2VC 4LNUD 5ENNA 3ZN3A 4L9PA 5G2NA 3TXMA 2OV8A 4HNAD 5CEAA 3EU9A 3B7RL 4KT6B 5FZSA 1A17A 3FEYA 1U2VG 1FT1A 4J8EA 5BT1A 3VLDA 4C0EA 3TWUA 3D9OA 5KBAA 1HFAA 3DPYA 4DUIA 2KC7A 3T5XA 3CSTA 3MX3A 3N71A 2I2OA 3NQPA 4BY6A 2ZIRA 4GZDA 2NYJA 3CLJA 4A3TA 2P9LG 3LPZA 2PL2A 3PEVB 5KNHD 3UM0A 3MV2B 2I9CA 3ZU7B 3RAUA 2FEZA 1NA0A 4WWOA 1GW6A 2AWIA 3FY4A 1P5QA 4RQIA 5CERB 5A23A 4N2SA 2LAIA 4FU3A 1FPPA 1HU3A 3FWVA 3CHMA 3L16A 4EZLA 2EQXA 2XZDG 4O1PA 5B3SE 1BU9A 2J4DA 2OEWA 3SO8A 3DWLG 3GZ2A 3FUHA 1LD7A 4AY6A 3D3MA 4I43A 1ELWA 1E8XA 4N3BA 3BG0B 2XGOA 1H6PA 3ESLA 3MKRA 4DJAA 5KJMA 4I9CA 3PNLB 4BSZB 4LNGA 3KD7A 3SQVA 3IV0A 4EPZA 2ZGDA 2J08A 3ZYMA 2R02A 2J4BA 2Y1LE 3G2TA 2WXKA 4U0ZA 5ENTD 3ZKJA 1OY3D 2UWJG 1INZA 4BERA 4U8HA 4JZYA 1OUVA 4GCNA 2GROB 4K5AB 1IQRA 3C98A 3SFZA 2PNNA 5D0OD 5AN8A 3FUFA 3CKCA 1SA5A 3FULA 3LY7A 4TXRA 4BT9A 4RSYA 3URZA 3KEAA 1H2TC 1MQSA 3RO3A 1DNPA 4UQXA 1N4QA 4UQZA 3TWWA 3RRNB 1ELKA 5HRYA 4BTBA 4FULA 3PNTB 2ETCA 2A5EA 3L17A 4PUCA 5G05C 3DXKG 4EBAA 4HS2A 1UN8A 3FU6A 4JL0A 4DX2A 2NC9A 2ZU6B 2Y0BG 3UT4A 3DBSA 1KLXA 2HE0A 2DZOA 4I2WA 4BTAA 2IEJA 3FTUA 1NA3A 1H6KA 3L82A 3ZVVA 3TGOA 2XZTG 5FWQA 4NACA 1IXVA 2J8SD 3LXUX 4MRUA 1FT2A 3J5PA 2HYZA 2X38A 2WQ6A 2X6HA 1S64A 4XKBA 3UQ3A 4LNBA 3VTXA 4ILGA 3RO2A 4J8YA 2ILRA 4F7AA 3T9KA 4CEMA 4U8VD 4XX5A 4MS6A 5J90A 4DRXE 3SI5A 3MZLB 4I6JA 4DPRA 3NZSA 3HXCA 1OWMA 3SY2A 2VSNA 2GRMA 2YHEA 3TWSA 2P9SG 1E96B 4ANVA 4N3AA 2KCVA 4OVUA 4GZ6A 3ABKE 4WAFA 3APCA 5EYPF 3SNXA 2WXRA 3D9KA 2XGMA 5ENOD 4XE0A 1K1AA 2PZIA 2I6HA 3FFLA 2VTBA 1KPSB 3UKRG 3E33A 4U0SA 1E8YA 3CVYA 4QQIA 4BETA 2PM6A 2YNQA 3NAWA 3X2QE 3ULEG 5AQBA 5BPPA 5A6CA 3QJZA 4G24A 4LSZE 4XKCA 4FHKA 3RJVA 3CGHA 4Y6CA 4NRHB 4ACLA 4AJWA 3CVXA 3EHMA 1MX6A 2L0TB 3RIBA 3CV0A 2YQ8A 5E75A 1OWOA 5KWDA 2LXLA 3B13A 2XHEA 4CT4A 3QC1A 2AW6A 2FO7A 2BEDA 3MYVA 3JYSA 4G8LA 5CRVA 3D9MA 1Z3XA 4YNDA 3UPVA 1A5EA 3PE3A 1SA4A 1BLXB 4NQ0A 4GA2A 3BUAA 4C9BB 4Z68A 5T4YA 1TNOA 2IU1A 5FQ4A 4L1BA 3DSSA 4TXQA 1G3NB 3JQ1A 1HZ4A 2KCKA 3ASFA 1D9SA 3FDHA 3JQ0A 1NI1A 3HVEB 4TUMA 3CEQA 3ASDA 5ANRA 3CHRA 2WVIA 2P9IG 2XS8A 3FUDA 2F8XK 4HRNA 4ACKA 5FZRA 2CHZA 5FQ6A 1PY1A 1K1BA 3IHYA 4HQDA 4GTQA 3Q5MA 1H19A 1W3BA 2EIME 5B1AE 4BX8A 3FUMA 1Z5SC 5EIDA 3TWXA 2BKGA 2AXZA 5FTPA 2Q7FA 3Q4AB 4KVMA 3DPDA 3B7BA 4J8DA 2XRYA 5JMND 2KZTA 2BF0X 1Y8MA 3B7SA 4CCAA 3FTSA 4XI9A 3HXFA 1UW4B 3PH0C 5EN5D 3Q73A 3AG3E 4HOSA 3ESKA 4DI3A 5D0QD 3RRMB 5ARFA 4UWGA 5G04J 4GTMA 3LY9A 3Q47B 5HS0A 4CGWA 2WXNA 1TNUA 3QAQA 5JHBA 5KCMA 4UI9K 4HOQA 3P1UA 4HOUA 4U96D 2XENA 2M63A 3PZ4A 4FLHA 3CHOA 3ASGA 1OXJA 2P9PG 4F1SA 1PAQA 4WUYA 4CGVA 2GGFA 5CCLA 2ZGGA 2GRPB 3FH5A 4CDMA 3FUIA 4XI0A 1JWFA 4U04A 2GRLA 4WWNA 3PZ3A 4YDOA 4AY5A 5A7DB 4I2ZA 3CIAA 4XIFA 1SZAA 3FUJA 3QDNA 3AU5A 2DYSE 3DSVA 1RZ4A 4PDXA 4PS7A 4G26A 5DBKA 4PS8A 4I6EA 3SFYA 3PE4A 2C0LA 4AM9A 3JXIA 3D9PA 4GTOA 2VTBB 5BXUA 2L6JA 5KJKA 4N39A 2X6FA 4J8SA 2WB2A 3QWWA 3CVVA 3PEUB 4U63A 5AARA 2VGXA 5LX8A 3LKUA 4GZCA 3RKVA 1IKND 4KZ0A 1TN7A 4W9RA 3FUKA 2F0YA 2AVPA 3JXJA 1OCRE 3U3WA 1MHQA 1N4RA 3GW4A 4ANUA 3ZFWA 4YDWA 1HXIA 1TJFA 3CVPA 2WXOA 4K5BA 4I1OB 2R05A 1X81A 4TRQA 1HG5A 3ZGQA 2VSYA 1NL4A 3D9JA 2KBXA 1H0AA 3TG4A 2HO1A 4JHJA 3S2AA 3C5RA 5EKQD 2WXIA 2XS1A 1OCCE 3UT8A 1U3CA 1O5MA 3ENEA 2WM9A 2CG3A 4QFVA 3UX4A 4K0RA 3DXMG 3CR3A 4APFA 4UI9J 3HXEA 1IYGA 4HBDA 3MA5A 1Z6TA 2DVWA 3V31A 4FLBA 5JJTA 5CMYA 1MZCA 4ILIA 1YCSB 3LVRE 2I1JA 1OCZE 2V8SE 5ENPD 1D8DA 5CECB 4GAAA 1WY6A 1LF8A 3R9MA 2I1KA 3CK7A 4MBGA 4ATZD 2VJ8A 3IKOB 4DK5A 4U8YD 5CBOA 3MV3B 5AAOA 4F3VA 2IFUA 4JVSA 3APFA 2Y69E 4V3IA 4PS3A 5EYLA 3ZHEB 2DYRE 4UWHA 1KT1A 5T8IA 2IONA 1YYHA 3PZ2A 5D2MC 1H2UA 1O1RA 5BV0A 2KZTB 3UM2A 5C1DA 3IEGA 1HG2A 2WPVA 2ZISA 1N4PA 2EILE 3KAEA 4G2VA 3Q49B 4UWKA 3AG4E 4A55A 5LCWC 2ETBA 4HI8A 3ONKA 5HQ8A 4BFRA 5FZQA 1BD8A 3HIZA 3CVQA 3OXFA 4KXKB 3ML9A 4GYYA 3TWRA 4APOA 3FH7A 2EINE 4N2QA 4U07A 5AYWD 3QWVA 1DC2A 3HG0D 3Q15A 1FCHA 1N0RA 1L5JA 5CMWA 2QC9A 3I4GA 2IY0C 4GTRA 1LTXA 2LSVA 2H6HA 5E76A 3ULYA 2UY1A 2R2LA 2Y4TA 1TYQG 4DLOA 2XQ0A 2LO6A 3GYZA 2CHXA 4ILHB 3V79K 3WG7E 4DX6D 2AXUA 3SHFA 3G2UA 1S70B 3BG1B 4YVQC 3SBTB 1FVHA 3LY8A 4I17A 4OVVA 2NSZA 2WXJA 4JB8P 1OT8A 3LVQE 2EIKE 4OYSA 4KZCA 2VGYA 2VGXB 4JD2G 3C3QA 2XEHA 3B7TA 4GYOA 2L9BA 2R03A 4J0UA 3PREA 4HRMB 3J5QB 3ZIMA 2CG2A 1JCRA 4RLYA 4CZ2D 3S7FA 3MKQA 3ONLA 4A3VA 3AG1E 2WQHA 4LRZA 3DEOA 3PDNA 1VDYA 1HS6A 4JEHA 3QK0A 2XRZA 5EX3A 2E2EA 4L7TA 3UT7A 3KSQA 4G11A 3BEEA 3UM1A 2MOWA 3C72A 3T5VA 4LEUA 3CHPA 2LSUA 4GTVA 4ZFHA 4RG9A 1N0QA 3QKYA 4F53A 4HVBA 3E32A 1QYMA 3CHSA 2WXGA 3T8MA 4D10C 1WAO1 4HXIA 4GZ5A 2LXMA 3CSFA 2IQCA 2WXQA 4J8FA 4G25A 2QY7A 1K3ZD 3BQOA 3AAAC 4M7CA 1N95A 2P2CP 2QZAA 4U95D 1QQEA 3R7QA 1KT0A 2PM7A 4C48B 4BT8A 1DCEA 3IBEA 4I1MA 4DI4A 4FA6A 4HB5A 3NF1A 4J7WA 4GPMA 4PH4B 2GRNB 1NZNA 4DX5D 3U64A 4JPSA 3ASOE 3ZXPA 2XPZA 1KZPA 3IXEA 3TAXA 1XGWA 4WWPA 2LNIA 1OWPA 4P29A 3VTYA 3Q9NC 3E37A 3FHEA 3EU5A 2H6FA 3S7JA 3E34A 3PS6A 1UN9A 3Q75A 3TL5A 4GTTA 1OWNA 1FVFA 3UM3A 4FP7A 3GZSA 3CVUA 3I5PA 3K9IA 3FU0A 3FU5A 5EILA 3PUKA 4H7XA 4F1PA 3NBNB 4UWFA 4KMOA 2C0MA 2B0OE 4L2YA 3UTMA 3L08A 1LD8A 2A4ZA 3ZNGA 1ZU2A 4B89A 3LDZA 4O60A 4YDYA 4I6GA 4JA7A 3ZW3A 3NZUA 2AXVA 1OWLA 3D9NA 5BV1A 4I1AA 5EDSA 5CEDB 2F8YA 1D8EA 1UJJA 4R7LA 2DZNA 3MCXA 3V30A 3LJ3A 2UY1B 4GB9A 4CDNA 4GA1A 2OVFA 3JCKC 2QFCA 2VYIA 5AQ9A 1N4SA 3EIQC 4YDEA 3AJIA 4DX1A 3UIPC 5BW8C 4TXPA 3P2BA 4TUUA 3G2SA 2DBAA 4HI9A 3OXGA 1S63A 2LAHA 2XEEA 5CHEE 4RG6A 2OCCE 5D66A 1SVXA 2X6IA 3UKUG 3CQCB 1TN6A 2X6KA 2GRQB 3SGHA 3ZYKA 3BU8A 4HOTA 4F6RD 1MJ0A 2ZXWE 1UG3A 2RG8A 4FC8A 2HR2A 2YINA 4BWRA 3TWVA 2WXFA 3D9LA 5DIZA 4I9EA 4DX7D 2LUHA 2YHCA 1TNBA 2VQ2A 2XGSA 3DEPA 4GZ3A 1V55E 3ZYLA 2V4HC 1ZB1A 3MKQB 1NFIE 3ABME 3OXLA 1O1SA 2XEVA 3LCAA 5T3RA 3Q7FA 3RRUA 2HM8A 5G55A 5KNGA 2L0IA 2OOEA 4LCTA 5IY5E 5M72A 5G05J 4MKTA 2OVBA 3U66A 4HORA 4Y6WA 4UUCA 1RW2A 3R9AB 1ZBPA 3JUIA 1JCQA 3I3NA 1IHGA 1K8KG 2FO1E 1IQUA 1NP7A 3FUNA 2H6GA 2NXPA 2J09A 4TV3A 5AJDA 3L13A 3L54A 1MX4A 2FBNA 5ANLA 4K03A 4E6HA 4IYPA 2P9UG 5ENSD 4FJYA 1E7VA 2X6JA 3ISMC 4BESA 5CBNA 4AVXA 3TJPA 3ULQA 5FINA 1DCQA 3B95A 3S7BA 4URKA 1OCOE 2XCBA 3QWPA 1TR4A 2R59A 3D9IA 2VSOE 4HFGA 2V4LA 2RFAA 3FTYA 4G1TA 5AJLA 3LEWA 4AXHA 1N52A 2WQ7A 4ABNA 4M3OA 3SF4A 3FP3A 3NB2A 4EHMA 3DSWA 4UWLA 1EF1C 3FTZA 4EBAG 4RVBA 3TWTA 3CK9A 4EZJA 4EECA 5EIBE 4XZ4A 1JCSA 3DSUA 1SW6A 5ENRD 3GZ1A 2IOLA 3T8KA 2VGEA 4AEZC 3PZDA 1EPUA 4AP2A 4B0ZA 1YMPA 4B8AA 2MHKA 3AS8A 1AWCB 4K5CA 1N94A 3RSEG 1EYHA 1WM5A 3TWQA 2JEKA 3QARA 3HYMB 3UINC 4BX9A 3EHNA 4A1SA 1U3DA 3HRAA 3AS5A 5G04C 3MGBA 3FEXA 4JHRA 4ANXA 4FHJA 1O1TA 1UJKA 4B94A 4CYMD 4AIFA 3O48A 1QNFA 3B7UX 4C0MA 5B1BE 3DSTA 3LS8A 4CT0A 3HVEA 4DLQA 2CHWA 2JABA 4B8CB 1ELRA 3U9WA 3PZ1A 5JJ6A 3HXBA 3KEZA 1WDYA 1N9AA 4WNEA 3SFXA 5LOZA 1SZ9A 3IHVA 1AP7A 5HI7A 2H6IA 3W9FA 3G2VA 2XPIA 1QBQA 4UQYA 2CFUA 2FI7A 3FTWA 4GMJA 2RKKA 1TNYA 3D9HA 3EHQA 4X8QA 3WXXA 5JHAA 4G8KA 1MYOA 1DVPA 5EX0A 4OAVB 4NURA 3APDA 4NIKA 4Q96A 3UMVA 4HLLA 4KBQA 3PVLA 3HDXA 1KZOA 2EIJE 4WNGA 3FU3A 3QB2A 1TEZA 1HH8A
chains in the Genus database with same CATH topology
2V0PA 4FADA 4XI0A 4WWPA 2LNIA 1OWPA 2FEZA 3AU4A 3TXNA 5AENA 1JWFA 1NA0A 4P29A 4U04A 3VTYA 4WWOA 4KVOA 2GRLA 4WWNA 1N54A 1GW6A 1YA0A 2AWIA 4AY5A 5A7DB 3FY4A 1P5QA 4I2ZA 3CIAA 4XIFA 3FHEA 4GPKA 5A23A 3LYAA 1SZAA 4N2SA 3FUJA 4J6IA 2LAIA 4FU3A 3QDNA 3S7JA 1HU3A 2P58C 3FWVA 3HHMA 3CHMA 3PS6A 3AU5A 3L16A 4EZLA 4WNDA 1UN9A 2EQXA 3CHQA 5LFAA 4LERA 3TL5A 4PDXA 1OWNA 1FVFA 2J4DA 3R7RA 2MRIA 4FP7A 2CFZA 3G2WA 3GZ2A 3FUHA 3ASHA 5ARGA 3GZSA 3O4ZA 3CVUA 4PS7A 3I5PA 3K9IA 2J07A 3D3MA 3FU0A 4G26A 4AY6A 4I43A 5DBKA 3FU5A 1ELWA 3PUKA 1E8XA 4H7XA 4N3BA 4UWFA 3RU0A 4KMOA 2C0MA 4L2YA 3U4TA 3BG0B 2XGOA 4PS8A 4I6EA 4JXTA 3L08A 3PE4A 3ESLA 4JC8A 2A4ZA 2PQRA 5BUZA 4IN3B 3MKRA 2C0LA 1ZU2A 4B89A 4DJAA 3LDZA 5KJMA 4AM9A 4I6GA 5BNWA 3D9PA 4JA7A 4GA0A 4I9CA 3PNLB 3ZW3A 3KD7A 1HO8A 2J49A 2VTBB 3NZUA 2AXVA 3I4RB 2DIWA 3IV0A 2L6JA 5KJKA 4N39A 1OWLA 2X6FA 4J8SA 2WB2A 3E4BA 3OTNA 3QWWA 3D9NA 3PEUB 4I1AA 4U63A 4EPZA 5BV1A 5EDSA 3CVVA 2VGXA 2J08A 3ZYMA 5LX8A 3LKUA 4GZCA 4N5CA 2J4BA 3RKVA 1UJJA 4R7LA 4FJZA 2ONDA 3PRZA 4KZ0A 4W9RA 3FUKA 3G2TA 3MCXA 2AVPA 2WXKA 3U3WA 4U0ZA 3S7DA 1MHQA 3LJ3A 2PQNA 3GW4A 5CCMA 2UY1B 5J08A 4ANUA 3ZFWA 4GB9A 4CDNA 2Y4UA 1E90A 4GA1A 2OVFA 2XCCA 1HXIA 5C2YA 4BSXA 1TJFA 3JCKC 3CVPA 2WXOA 2QFCA 4UI9C 4I1OB 2UWJG 1INZA 2WXHA 4EQFA 2VYIA 4U8HA 4TRQA 1HG5A 4JZYA 3ZGQA 1OUVA 3EIQC 4GCNA 2VSYA 4JW1A 3D9JA 1H0AA 3TG4A 1IQRA 2HO1A 4JHJA 4JA9A 5BW8C 2FULA 3C98A 3SFZA 3S2AA 5D0OD 3P2BA 3FUFA 3KS2A 3CKCA 5KJLA 5EKQD 2Y3AA 3UUXA 2WXIA 3FULA 2IJGX 3LY7A 3G2SA 4TUUA 2VSXE 2DBAA 4RSYA 4BT9A 3URZA 3OXGA 1H2TC 1MQSA 2RD0A 3RO3A 2LAHA 1DNPA 5CHEE 4RG6A 5AIJA 4GU5A 2KM4A 4ME2A 4UQXA 3UT8A 1U3CA 1SQMA 2X6IA 3ENEA 4UQZA 3SBSA 4L23A 3CQCB 1PC2A 2WM9A 2CG3A 2IOSA 4QFVA 4YVOA 3L6AA 3RRNB 2X6KA 1ELKA 3UX4A 4IRUA 4G23A 2KATA 4BTBA 4FULA 4K0RA 3PNTB 3CR3A 4APFA 3SGHA 3ZYKA 3L17A 4UI9J 4HOTA 1IYGA 3MA5A 4AV7A 4PUCA 5G05C 1Z6TA 4EBAA 4HS2A 4FLBA 1UN8A 3SZ7A 1S0PA 3FU6A 5KJNA 1UG3A 5JJTA 5CMYA 4JL0A 2RG8A 4L2LA 4ILIA 4FC8A 3LVRE 3EJNA 4Q94A 2HR2A 2NC9A 2ZU6B 2YINA 2I1JA 2V8SE 4BWRA 2WXFA 3D9LA 5DIZA 4I9EA 3UT4A 4GAAA 4MLPA 3DBSA 2YHCA 1WY6A 1KLXA 2XGSA 2VQ2A 4GZ3A 4I2WA 1LF8A 4O6FA 4BTAA 2I1KA 3ZYLA 3FTUA 3CK7A 3CVNA 1NA3A 1H6KA 3MKQB 4A1GA 3TG5A 3ZVVA 3TGOA 2R17C 5FWQA 3VLEA 2E0IA 2WMOA 4NACA 3OXLA 2VJ8A 3IKOB 4DK5A 5JJ7A 2XEVA 3LCAA 3FUEA 3AS4A 5T3RA 3MV3B 3LXUX 4F3VA 2IFUA 5G55A 2HM8A 4MRUA 3RRUA 4ATGA 2L0IA 4JVSA 2HYZA 3APFA 2OOEA 2X38A 4LCTA 2X6HA 4V3IA 4PS3A 5M72A 2WQ6A 1Y6IA 5G05J 3ZHEB 4UWHA 4MKTA 1KT1A 4XKBA 3UQ3A 4N3CA 5T8IA 2IONA 2OVBA 4ANWA 3VTXA 1BPOA 4ILGA 3U66A 3RO2A 1H2UA 5BV0A 2KZTB 3ZEFA 2ILRA 2FF4A 4F7AA 4HORA 4CEMA 5C1DA 3IEGA 4Y6WA 3EDTB 3QNKA 1HG2A 2WPVA 4XX5A 2BUGA 4MS6A 5J90A 3KAEA 4KYOB 3R9AB 1X5BA 4G2VA 3Q49B 4UWKA 4CRWA 1ZBPA 3SI5A 3MZLB 4I6JA 4DPRA 3JUIA 2JLBA 3NZSA 1B89A 4A55A 1OWMA 1HE8A 5LCWC 3FTVA 2VSNA 3ZYQA 3I3NA 2GRMA 3ONKA 1IHGA 1QZ2A 1IQUA 5HQ8A 1NP7A 2YHEA 3QOUA 2KCLA 3FUNA 4BFRA 2NXPA 5FZQA 5LP0A 2J09A 4TV3A 1E96B 5AJDA 3HIZA 4ANVA 3L13A 3L54A 4N3AA 4CDRA 2FBNA 2KCVA 3CVQA 3OXFA 4KXKB 3FH8A 4OVUA 3ML9A 4GYYA 4GZ6A 4K03A 5ANLA 4WAFA 3APCA 3ZHEA 4E6HA 4APOA 3SNXA 1JWGA 2WXRA 4JHKA 3D9KA 3FH7A 4HLEA 2XGMA 4IYPA 1JPLA 4FJYA 4XE0A 2A5UA 2PZIA 1E7VA 4N2QA 2I6HA 3FFLA 2X6JA 2VTBA 4U07A 5FT9A 5AYWD 3QWVA 3FTXA 3CVLA 3PUJA 3ZXSA 4AVXA 4U0SA 1E8YA 4GYWA 3Q15A 3TJPA 3ULQA 1FCHA 1L5JA 3CVYA 2V5FA 5CMWA 2WXPA 2PM6A 2YNQA 3I4GA 5LCWJ 1EDUA 3S7BA 1XNFA 3EIJA 5BPPA 4URKA 5FQ7A 5A6CA 3QJZA 2LSVA 4G24A 2R5SA 2XCBA 3QWPA 4XKCA 2R59A 5E76A 4FHKA 3RJVA 2UY1A 3CGHA 2VSOE 3D9IA 4HFGA 4NRHB 4Y6CA 4ACLA 4AJWA 3EHMA 3CVXA 2V4LA 2L0TB 3RIBA 2Y4TA 2YQ8A 2IF4A 3CV0A 3FTYA 5E75A 4G1TA 3ZRHA 4DLOA 4Q69A 5AJLA 1E8ZA 3LEWA 3MEKA 2XQ0A 3ZPJA 4AXHA 2LO6A 1N52A 2XPYA 1OWOA 3GYZA 2WQ7A 2CHXA 4ABNA 1HX8A 3B13A 2XHEA 2GW1A 1E8WA 4ILHB 4GCOA 4M3OA 3SF4A 4CT4A 3FP3A 3QC1A 2AW6A 2FO7A 4E85A 4UWLA 4AOFA 1EF1C 2AXUA 3FTZA 3SHFA 4EBAG 4RVBA 1JUQA 3MYVA 3JYSA 3CK9A 4EZJA 3D9MA 3G2UA 4EECA 3CVWA 4XZ4A 1Z3XA 4YNDA 5FQ8A 3UPVA 3BG1B 3PE3A 2BTDA 2WMNA 4EZKA 3GZ1A 2IOLA 1TJCA 4NQ0A 4GA2A 1Z3YA 4GMLA 4IULA 2DCPA 4YVQC 4C9BB 3SBTB 1FVHA 4AEZC 5T4YA 3PZDA 3ML8A 3LY8A 4I17A 2IU1A 4OVVA 2WXMA 1EPUA 4WNFA 5FQ4A 4L1BA 4AP2A 2NSZA 2WXJA 4U0UA 4B0ZA 3JQ1A 4B8AA 1HZ4A 2X3MA 3LVQE 4OYSA 2KCKA 2MHKA 4JEUA 2VGYA 4KZCA 2VGXB 3AS8A 3SD5A 3ASFA 3B7TA 4GYOA 2L9BA 3FDHA 4J0UA 3JQ0A 3VLFA 3PREA 3HVEB 3CK8A 3CEQA 3ZIMA 3ASDA 5ANRA 1EYHA 2CG2A 3CHRA 3L22A 1WM5A 2WVIA 3OAWA 3RK6A 2JEKA 3QARA 3FUDA 3S7FA 3MKQA 5FZRA 4ACKA 3ONLA 3HYMB 3MJWA 4A3VA 2CHZA 2WQHA 5FQ6A 4LRZA 4BX9A 1PY1A 3IHYA 3PDNA 1VDYA 3EHNA 4A1SA 1U3DA 1HS6A 2C2LA 2WXLA 4JEHA 3QK0A 2XRZA 3Q5MA 3AS5A 5EX3A 5G04C 1H19A 2E2EA 1W3BA 4L7TA 3MGBA 3FEXA 4H7YA 3UT7A 4JHRA 4BX8A 3FUMA 4ANXA 4FHJA 1UJKA 4B94A 3CKBA 2AXZA 5FTPA 1HF8A 2J9QA 3CQGB 3O48A 1E7UA 1QNFA 2Q7FA 4G11A 4AIFA 3B7UX 4LUNU 5FJYA 3BEEA 3Q4AB 4C0MA 1H2VC 4KVMA 3DPDA 4J8DA 2MOWA 2XRYA 3LS8A 2KZTA 5ENNA 3T5VA 4LEUA 3ZN3A 4CT0A 3HVEA 3CHPA 2CHWA 4DLQA 2BF0X 1Y8MA 3B7SA 2LSUA 5G2NA 3FTSA 4CCAA 4XI9A 3TXMA 4RG9A 2OV8A 4B8CB 1ELRA 3U9WA 1UW4B 3PH0C 3B7RL 3QKYA 5JJ6A 4KT6B 5FZSA 1A17A 3KEZA 3FEYA 4WNEA 4F53A 5LOZA 1SZ9A 4HVBA 4HOSA 3IHVA 3ESKA 5HI7A 3CHSA 4DI3A 3G2VA 5D0QD 2WXGA 3T8MA 4D10C 3RRMB 1WAO1 4HXIA 5ARFA 4J8EA 4UWGA 2XPIA 5G04J 4GZ5A 5BT1A 3VLDA 3LY9A 3Q47B 3CSFA 4UQYA 4CGWA 2WXNA 2IQCA 2WXQA 4C0EA 4J8FA 3D9OA 3QAQA 2QY7A 4G25A 5JHBA 2CFUA 2FI7A 3FTWA 5KCMA 4GMJA 4UI9K 1HFAA 4HOQA 3P1UA 4HOUA 1QQEA 3R7QA 1KT0A 2KC7A 2PM7A 3CSTA 3T5XA 4BT8A 3MX3A 2M63A 3IBEA 4FLHA 3CHOA 3ASGA 3N71A 4I1MA 3WXXA 5JHAA 2I2OA 3NQPA 4BY6A 4DI4A 1DVPA 4GZDA 5EX0A 1PAQA 4NURA 4WUYA 4F1SA 3APDA 3NF1A 4FA6A 4CGVA 2GGFA 3CLJA 4Q96A 3UMVA 4PH4B 4KBQA 1NZNA 4A3TA 5CCLA 3PVLA 3HDXA 3U64A 4JPSA 4WNGA 3FH5A 2XPZA 3LPZA 3FU3A 3QB2A 3FUIA 4CDMA 2PL2A 1HH8A 3PEVB 3TAXA 1TEZA 3MV2B 2I9CA 1XGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI0 A;  2LNI A;  2FEZ A;  4U04 A;  1NA0 A;  3VTY A;  1YA0 A;  4AY5 A;  5A7D B;  1P5Q A;  4I2Z A;  4XIF A;  4GPK A;  3LYA A;  4N2S A;  3QDN A;  3S7J A;  2P58 C;  3FWV A;  4WND A;  3GZ2 A;  5ARG A;  3ASH A;  3K9I A;  4G26 A;  4AY6 A;  5DBK A;  1ELW A;  4H7X A;  4N3B A;  3RU0 A;  2C0M A;  3U4T A;  2XGO A;  3PE4 A;  2PQR A;  4IN3 B;  3MKR A;  2C0L A;  1ZU2 A;  5KJM A;  4AM9 A;  5BNW A;  4JA7 A;  4GA0 A;  4I9C A;  3KD7 A;  2L6J A;  5KJK A;  4N39 A;  3E4B A;  3QWW A;  4I1A A;  2VGX A;  3LKU A;  4N5C A;  3RKV A;  2OND A;  4W9R A;  2AVP A;  3U3W A;  4U0Z A;  3S7D A;  2PQN A;  3GW4 A;  5CCM A;  2UY1 B;  3ZFW A;  2Y4U A;  4GA1 A;  2XCC A;  1HXI A;  3CVP A;  2QFC A;  4UI9 C;  2UWJ G;  4EQF A;  2VYI A;  3ZGQ A;  1OUV A;  4GCN A;  2VSY A;  3TG4 A;  2HO1 A;  4JA9 A;  5BW8 C;  5D0O D;  3KS2 A;  3CKC A;  5KJL A;  5EKQ D;  3UUX A;  3LY7 A;  2DBA A;  4BT9 A;  3URZ A;  3OXG A;  3RO3 A;  5CHE E;  4RG6 A;  4ME2 A;  4UQX A;  4UQZ A;  1PC2 A;  4YVO A;  4G23 A;  2KAT A;  4BTB A;  4UI9 J;  4HOT A;  1IYG A;  3MA5 A;  5G05 C;  3SZ7 A;  5KJN A;  5JJT A;  4JL0 A;  2HR2 A;  2NC9 A;  4BWR A;  5DIZ A;  4I9E A;  2YHC A;  1KLX A;  2XGS A;  2VQ2 A;  4GZ3 A;  4I2W A;  4O6F A;  4BTA A;  3CK7 A;  3CVN A;  1NA3 A;  3TG5 A;  3TGO A;  3OXL A;  5JJ7 A;  2XEV A;  3LCA A;  3AS4 A;  3MV3 B;  4F3V A;  2IFU A;  2HYZ A;  2OOE A;  5M72 A;  5G05 J;  3ZHE B;  1KT1 A;  3UQ3 A;  4N3C A;  3VTX A;  3RO2 A;  2FF4 A;  4HOR A;  5C1D A;  3IEG A;  4Y6W A;  3EDT B;  2WPV A;  2BUG A;  3KAE A;  4KYO B;  3R9A B;  4G2V A;  3Q49 B;  1ZBP A;  2JLB A;  1B89 A;  5LCW C;  2VSN A;  1IHG A;  1QZ2 A;  5HQ8 A;  3QOU A;  2KCL A;  5FZQ A;  1E96 B;  4CDR A;  4N3A A;  2FBN A;  2KCV A;  3CVQ A;  3OXF A;  4KXK B;  4GYY A;  4GZ6 A;  3ZHE A;  4APO A;  2XGM A;  2PZI A;  4N2Q A;  2I6H A;  3FFL A;  4U07 A;  5FT9 A;  5AYW D;  3QWV A;  3CVL A;  4U0S A;  4GYW A;  3Q15 A;  3ULQ A;  1FCH A;  2V5F A;  5LCW J;  3S7B A;  1XNF A;  5A6C A;  2LSV A;  4G24 A;  2R5S A;  2XCB A;  3QWP A;  3RJV A;  2UY1 A;  4Y6C A;  4NRH B;  3RIB A;  2Y4T A;  2YQ8 A;  2IF4 A;  3CV0 A;  4G1T A;  3MEK A;  3ZPJ A;  3GYZ A;  4ABN A;  2GW1 A;  4GCO A;  3SF4 A;  3FP3 A;  2FO7 A;  3JYS A;  3CK9 A;  4YND A;  3UPV A;  3PE3 A;  3GZ1 A;  1TJC A;  4NQ0 A;  4GA2 A;  4YVQ C;  3LY8 A;  4I17 A;  4WNF A;  4U0U A;  1HZ4 A;  2KCK A;  2MHK A;  2VGY A;  2VGX B;  3AS8 A;  3ASF A;  4GYO A;  4J0U A;  3CK8 A;  3CEQ A;  3ASD A;  1WM5 A;  3S7F A;  5FZR A;  3HYM B;  2WQH A;  3PDN A;  4A1S A;  2C2L A;  3Q5M A;  3AS5 A;  5EX3 A;  5G04 C;  2E2E A;  1W3B A;  4H7Y A;  4JHR A;  4B94 A;  3CKB A;  5FTP A;  2J9Q A;  3O48 A;  4AIF A;  2Q7F A;  5FJY A;  3BEE A;  3Q4A B;  4J8D A;  4LEU A;  3ZN3 A;  1Y8M A;  2LSU A;  4XI9 A;  4RG9 A;  1ELR A;  3QKY A;  5JJ6 A;  5FZS A;  1A17 A;  4WNE A;  4HOS A;  3ESK A;  5HI7 A;  5D0Q D;  1WAO 1;  5ARF A;  4J8E A;  2XPI A;  5G04 J;  4GZ5 A;  5BT1 A;  3LY9 A;  3Q47 B;  4UQY A;  4CGW A;  4J8F A;  4G25 A;  2FI7 A;  4UI9 K;  4HOQ A;  4HOU A;  1QQE A;  1KT0 A;  2KC7 A;  4BT8 A;  3ASG A;  3N71 A;  3WXX A;  5EX0 A;  4WUY A;  3NF1 A;  4CGV A;  4KBQ A;  1NZN A;  5CCL A;  4WNG A;  3LPZ A;  2PL2 A;  1HH8 A;  3TAX A;  3MV2 B; 
#chains in the Genus database with same CATH topology
 2V0P A;  4FAD A;  3AU4 A;  3TXN A;  5AEN A;  2IO2 C;  4KVO A;  1N54 A;  1YA0 A;  1H6O A;  4GPK A;  3LYA A;  4J6I A;  2P58 C;  3HHM A;  4WND A;  3CHQ A;  5LFA A;  4LER A;  4B93 B;  3R7R A;  2MRI A;  2CFZ A;  3G2W A;  5ARG A;  3ASH A;  3O4Z A;  2J07 A;  1Q2Z A;  3RU0 A;  1TN8 A;  3U4T A;  3DSX A;  4JXT A;  4JC8 A;  3E30 A;  3ZUV B;  5BUZ A;  2PQR A;  4IN3 B;  4O1O A;  5BNW A;  4GA0 A;  1HO8 A;  2J49 A;  4OAU C;  3I4R B;  2DIW A;  3E4B A;  3OTN A;  4GMR A;  4N5C A;  4FJZ A;  2OND A;  3PRZ A;  3S7D A;  2PQN A;  5CCM A;  5J08 A;  2IO3 C;  2Y4U A;  1E90 A;  4BSX A;  2XCC A;  5C2Y A;  3V2O A;  4UI9 C;  3NOC D;  2WXH A;  4EQF A;  5ITZ F;  4JW1 A;  4BEP A;  4GTP A;  4JA9 A;  1UOH A;  3HXD A;  2FUL A;  3Q78 A;  3KS2 A;  1BI8 B;  5KJL A;  2Y3A A;  3UUX A;  3Q9U C;  2IJG X;  2VSX E;  2RD0 A;  5AIJ A;  4GU5 A;  2KM4 A;  4ME2 A;  1SQM A;  3SBS A;  4L23 A;  1PC2 A;  2IOS A;  4YVO A;  3L6A A;  3UXG A;  4IRU A;  4G23 A;  2KAT A;  3Q7A A;  3EUV A;  4AV7 A;  3SZ7 A;  1S0P A;  5KJN A;  4L2L A;  3EJN A;  4Q94 A;  3KSL A;  4MLP A;  4O6F A;  3CVN A;  4A1G A;  3TG5 A;  2R17 C;  3VLE A;  2E0I A;  2WMO A;  4A63 B;  1WG0 A;  3V2X A;  5JJ7 A;  3FUE A;  3AS4 A;  3LJN A;  4ATG A;  3F6Q A;  2QYJ A;  1Y6I A;  2DWZ A;  4N3C A;  2ETA A;  4ANW A;  1BPO A;  4N5Q A;  5CRU A;  3ZEF A;  3ASN E;  2FF4 A;  2MYO A;  3EHR A;  3EDT B;  3QNK A;  2BKK B;  2BUG A;  4KYO B;  1X5B A;  3UIO C;  2QYU A;  4CRW A;  2JLB A;  1B89 A;  1HE8 A;  3FTV A;  3ZYQ A;  2RFM A;  1QZ2 A;  1IHB A;  5AQ7 A;  3QOU A;  1V54 E;  3C3R A;  2KCL A;  4U7E B;  5LP0 A;  4CDR A;  3C3O A;  3FH8 A;  2OEV A;  5BXO A;  3ZHE A;  4ZHB A;  1JWG A;  5JA4 D;  4JHK A;  2GRR B;  1TNZ A;  2P9N G;  4HLE A;  1JPL A;  2A5U A;  4HRL A;  5FT9 A;  3FTX A;  3CVL A;  3PUJ A;  3ZXS A;  4GYW A;  1BI7 B;  2V5F A;  2WXP A;  3Q79 A;  2AJA A;  5LCW J;  1EDU A;  1XNF A;  3EIJ A;  2L6B A;  5FQ7 A;  2R5S A;  2P9K G;  2IF4 A;  3ZRH A;  4GTS A;  4Q69 A;  1E8Z A;  3MEK A;  3ZPJ A;  2XPY A;  1HX8 A;  2GW1 A;  1E8W A;  1MX2 A;  4GCO A;  4E85 A;  4AOF A;  1JUQ A;  3L9T A;  5ENQ D;  5FIO A;  3CVW A;  5FQ8 A;  2BTD A;  2WMN A;  4EZK A;  1TJC A;  1Z3Y A;  4GML A;  4IUL A;  2DCP A;  3UI2 A;  3ML8 A;  2V5Q C;  4WNF A;  2WXM A;  4U0U A;  2X3M A;  4JEU A;  3SD5 A;  3AG2 E;  3VLF A;  2KXP C;  4XEI G;  3DRA A;  2B6C A;  3CK8 A;  3L22 A;  2F37 A;  3OAW A;  3RK6 A;  3ABL E;  5AQA A;  3MJW A;  5HKP A;  2WXL A;  2C2L A;  4LG6 A;  1N11 A;  4H7Y A;  3CKB A;  5H7P A;  1HF8 A;  2J9Q A;  3CQG B;  1E7U A;  3NOG D;  3W9G A;  5FJY A;  3JUE A;  4LUN U;  1H2V C;  4LNU D;  5ENN A;  3ZN3 A;  4L9P A;  5G2N A;  3TXM A;  2OV8 A;  4HNA D;  5CEA A;  3EU9 A;  3B7R L;  4KT6 B;  5FZS A;  1A17 A;  3FEY A;  1U2V G;  1FT1 A;  4J8E A;  5BT1 A;  3VLD A;  4C0E A;  3TWU A;  3D9O A;  5KBA A;  1HFA A;  3DPY A;  4DUI A;  2KC7 A;  3T5X A;  3CST A;  3MX3 A;  3N71 A;  2I2O A;  3NQP A;  4BY6 A;  2ZIR A;  4GZD A;  2NYJ A;  3CLJ A;  4A3T A;  2P9L G;  3LPZ A;  2PL2 A;  3PEV B;  5KNH D;  3UM0 A;  3MV2 B;  2I9C A;  3ZU7 B;  3RAU A;  2FEZ A;  1NA0 A;  4WWO A;  1GW6 A;  2AWI A;  3FY4 A;  1P5Q A;  4RQI A;  5CER B;  5A23 A;  4N2S A;  2LAI A;  4FU3 A;  1FPP A;  1HU3 A;  3FWV A;  3CHM A;  3L16 A;  4EZL A;  2EQX A;  2XZD G;  4O1P A;  5B3S E;  1BU9 A;  2J4D A;  2OEW A;  3SO8 A;  3DWL G;  3GZ2 A;  3FUH A;  1LD7 A;  4AY6 A;  3D3M A;  4I43 A;  1ELW A;  1E8X A;  4N3B A;  3BG0 B;  2XGO A;  1H6P A;  3ESL A;  3MKR A;  4DJA A;  5KJM A;  4I9C A;  3PNL B;  4BSZ B;  4LNG A;  3KD7 A;  3SQV A;  3IV0 A;  4EPZ A;  2ZGD A;  2J08 A;  3ZYM A;  2R02 A;  2J4B A;  2Y1L E;  3G2T A;  2WXK A;  4U0Z A;  5ENT D;  3ZKJ A;  1OY3 D;  2UWJ G;  1INZ A;  4BER A;  4U8H A;  4JZY A;  1OUV A;  4GCN A;  2GRO B;  4K5A B;  1IQR A;  3C98 A;  3SFZ A;  2PNN A;  5D0O D;  5AN8 A;  3FUF A;  3CKC A;  1SA5 A;  3FUL A;  3LY7 A;  4TXR A;  4BT9 A;  4RSY A;  3URZ A;  3KEA A;  1H2T C;  1MQS A;  3RO3 A;  1DNP A;  4UQX A;  1N4Q A;  4UQZ A;  3TWW A;  3RRN B;  1ELK A;  5HRY A;  4BTB A;  4FUL A;  3PNT B;  2ETC A;  2A5E A;  3L17 A;  4PUC A;  5G05 C;  3DXK G;  4EBA A;  4HS2 A;  1UN8 A;  3FU6 A;  4JL0 A;  4DX2 A;  2NC9 A;  2ZU6 B;  2Y0B G;  3UT4 A;  3DBS A;  1KLX A;  2HE0 A;  2DZO A;  4I2W A;  4BTA A;  2IEJ A;  3FTU A;  1NA3 A;  1H6K A;  3L82 A;  3ZVV A;  3TGO A;  2XZT G;  5FWQ A;  4NAC A;  1IXV A;  2J8S D;  3LXU X;  4MRU A;  1FT2 A;  3J5P A;  2HYZ A;  2X38 A;  2WQ6 A;  2X6H A;  1S64 A;  4XKB A;  3UQ3 A;  4LNB A;  3VTX A;  4ILG A;  3RO2 A;  4J8Y A;  2ILR A;  4F7A A;  3T9K A;  4CEM A;  4U8V D;  4XX5 A;  4MS6 A;  5J90 A;  4DRX E;  3SI5 A;  3MZL B;  4I6J A;  4DPR A;  3NZS A;  3HXC A;  1OWM A;  3SY2 A;  2VSN A;  2GRM A;  2YHE A;  3TWS A;  2P9S G;  1E96 B;  4ANV A;  4N3A A;  2KCV A;  4OVU A;  4GZ6 A;  3ABK E;  4WAF A;  3APC A;  5EYP F;  3SNX A;  2WXR A;  3D9K A;  2XGM A;  5ENO D;  4XE0 A;  1K1A A;  2PZI A;  2I6H A;  3FFL A;  2VTB A;  1KPS B;  3UKR G;  3E33 A;  4U0S A;  1E8Y A;  3CVY A;  4QQI A;  4BET A;  2PM6 A;  2YNQ A;  3NAW A;  3X2Q E;  3ULE G;  5AQB A;  5BPP A;  5A6C A;  3QJZ A;  4G24 A;  4LSZ E;  4XKC A;  4FHK A;  3RJV A;  3CGH A;  4Y6C A;  4NRH B;  4ACL A;  4AJW A;  3CVX A;  3EHM A;  1MX6 A;  2L0T B;  3RIB A;  3CV0 A;  2YQ8 A;  5E75 A;  1OWO A;  5KWD A;  2LXL A;  3B13 A;  2XHE A;  4CT4 A;  3QC1 A;  2AW6 A;  2FO7 A;  2BED A;  3MYV A;  3JYS A;  4G8L A;  5CRV A;  3D9M A;  1Z3X A;  4YND A;  3UPV A;  1A5E A;  3PE3 A;  1SA4 A;  1BLX B;  4NQ0 A;  4GA2 A;  3BUA A;  4C9B B;  4Z68 A;  5T4Y A;  1TNO A;  2IU1 A;  5FQ4 A;  4L1B A;  3DSS A;  4TXQ A;  1G3N B;  3JQ1 A;  1HZ4 A;  2KCK A;  3ASF A;  1D9S A;  3FDH A;  3JQ0 A;  1NI1 A;  3HVE B;  4TUM A;  3CEQ A;  3ASD A;  5ANR A;  3CHR A;  2WVI A;  2P9I G;  2XS8 A;  3FUD A;  2F8X K;  4HRN A;  4ACK A;  5FZR A;  2CHZ A;  5FQ6 A;  1PY1 A;  1K1B A;  3IHY A;  4HQD A;  4GTQ A;  3Q5M A;  1H19 A;  1W3B A;  2EIM E;  5B1A E;  4BX8 A;  3FUM A;  1Z5S C;  5EID A;  3TWX A;  2BKG A;  2AXZ A;  5FTP A;  2Q7F A;  3Q4A B;  4KVM A;  3DPD A;  3B7B A;  4J8D A;  2XRY A;  5JMN D;  2KZT A;  2BF0 X;  1Y8M A;  3B7S A;  4CCA A;  3FTS A;  4XI9 A;  3HXF A;  1UW4 B;  3PH0 C;  5EN5 D;  3Q73 A;  3AG3 E;  4HOS A;  3ESK A;  4DI3 A;  5D0Q D;  3RRM B;  5ARF A;  4UWG A;  5G04 J;  4GTM A;  3LY9 A;  3Q47 B;  5HS0 A;  4CGW A;  2WXN A;  1TNU A;  3QAQ A;  5JHB A;  5KCM A;  4UI9 K;  4HOQ A;  3P1U A;  4HOU A;  4U96 D;  2XEN A;  2M63 A;  3PZ4 A;  4FLH A;  3CHO A;  3ASG A;  1OXJ A;  2P9P G;  4F1S A;  1PAQ A;  4WUY A;  4CGV A;  2GGF A;  5CCL A;  2ZGG A;  2GRP B;  3FH5 A;  4CDM A;  3FUI A;  4XI0 A;  1JWF A;  4U04 A;  2GRL A;  4WWN A;  3PZ3 A;  4YDO A;  4AY5 A;  5A7D B;  4I2Z A;  3CIA A;  4XIF A;  1SZA A;  3FUJ A;  3QDN A;  3AU5 A;  2DYS E;  3DSV A;  1RZ4 A;  4PDX A;  4PS7 A;  4G26 A;  5DBK A;  4PS8 A;  4I6E A;  3SFY A;  3PE4 A;  2C0L A;  4AM9 A;  3JXI A;  3D9P A;  4GTO A;  2VTB B;  5BXU A;  2L6J A;  5KJK A;  4N39 A;  2X6F A;  4J8S A;  2WB2 A;  3QWW A;  3CVV A;  3PEU B;  4U63 A;  5AAR A;  2VGX A;  5LX8 A;  3LKU A;  4GZC A;  3RKV A;  1IKN D;  4KZ0 A;  1TN7 A;  4W9R A;  3FUK A;  2F0Y A;  2AVP A;  3JXJ A;  1OCR E;  3U3W A;  1MHQ A;  1N4R A;  3GW4 A;  4ANU A;  3ZFW A;  4YDW A;  1HXI A;  1TJF A;  3CVP A;  2WXO A;  4K5B A;  4I1O B;  2R05 A;  1X81 A;  4TRQ A;  1HG5 A;  3ZGQ A;  2VSY A;  1NL4 A;  3D9J A;  2KBX A;  1H0A A;  3TG4 A;  2HO1 A;  4JHJ A;  3S2A A;  3C5R A;  5EKQ D;  2WXI A;  2XS1 A;  1OCC E;  3UT8 A;  1U3C A;  1O5M A;  3ENE A;  2WM9 A;  2CG3 A;  4QFV A;  3UX4 A;  4K0R A;  3DXM G;  3CR3 A;  4APF A;  4UI9 J;  3HXE A;  1IYG A;  4HBD A;  3MA5 A;  1Z6T A;  2DVW A;  3V31 A;  4FLB A;  5JJT A;  5CMY A;  1MZC A;  4ILI A;  1YCS B;  3LVR E;  2I1J A;  1OCZ E;  2V8S E;  5ENP D;  1D8D A;  5CEC B;  4GAA A;  1WY6 A;  1LF8 A;  3R9M A;  2I1K A;  3CK7 A;  4MBG A;  4ATZ D;  2VJ8 A;  3IKO B;  4DK5 A;  4U8Y D;  5CBO A;  3MV3 B;  5AAO A;  4F3V A;  2IFU A;  4JVS A;  3APF A;  2Y69 E;  4V3I A;  4PS3 A;  5EYL A;  3ZHE B;  2DYR E;  4UWH A;  1KT1 A;  5T8I A;  2ION A;  1YYH A;  3PZ2 A;  5D2M C;  1H2U A;  1O1R A;  5BV0 A;  2KZT B;  3UM2 A;  5C1D A;  3IEG A;  1HG2 A;  2WPV A;  2ZIS A;  1N4P A;  2EIL E;  3KAE A;  4G2V A;  3Q49 B;  4UWK A;  3AG4 E;  4A55 A;  5LCW C;  2ETB A;  4HI8 A;  3ONK A;  5HQ8 A;  4BFR A;  5FZQ A;  1BD8 A;  3HIZ A;  3CVQ A;  3OXF A;  4KXK B;  3ML9 A;  4GYY A;  3TWR A;  4APO A;  3FH7 A;  2EIN E;  4N2Q A;  4U07 A;  5AYW D;  3QWV A;  1DC2 A;  3HG0 D;  3Q15 A;  1FCH A;  1N0R A;  1L5J A;  5CMW A;  2QC9 A;  3I4G A;  2IY0 C;  4GTR A;  1LTX A;  2LSV A;  2H6H A;  5E76 A;  3ULY A;  2UY1 A;  2R2L A;  2Y4T A;  1TYQ G;  4DLO A;  2XQ0 A;  2LO6 A;  3GYZ A;  2CHX A;  4ILH B;  3V79 K;  3WG7 E;  4DX6 D;  2AXU A;  3SHF A;  3G2U A;  1S70 B;  3BG1 B;  4YVQ C;  3SBT B;  1FVH A;  3LY8 A;  4I17 A;  4OVV A;  2NSZ A;  2WXJ A;  4JB8 P;  1OT8 A;  3LVQ E;  2EIK E;  4OYS A;  4KZC A;  2VGY A;  2VGX B;  4JD2 G;  3C3Q A;  2XEH A;  3B7T A;  4GYO A;  2L9B A;  2R03 A;  4J0U A;  3PRE A;  4HRM B;  3J5Q B;  3ZIM A;  2CG2 A;  1JCR A;  4RLY A;  4CZ2 D;  3S7F A;  3MKQ A;  3ONL A;  4A3V A;  3AG1 E;  2WQH A;  4LRZ A;  3DEO A;  3PDN A;  1VDY A;  1HS6 A;  4JEH A;  3QK0 A;  2XRZ A;  5EX3 A;  2E2E A;  4L7T A;  3UT7 A;  3KSQ A;  4G11 A;  3BEE A;  3UM1 A;  2MOW A;  3C72 A;  3T5V A;  4LEU A;  3CHP A;  2LSU A;  4GTV A;  4ZFH A;  4RG9 A;  1N0Q A;  3QKY A;  4F53 A;  4HVB A;  3E32 A;  1QYM A;  3CHS A;  2WXG A;  3T8M A;  4D10 C;  1WAO 1;  4HXI A;  4GZ5 A;  2LXM A;  3CSF A;  2IQC A;  2WXQ A;  4J8F A;  4G25 A;  2QY7 A;  1K3Z D;  3BQO A;  3AAA C;  4M7C A;  1N95 A;  2P2C P;  2QZA A;  4U95 D;  1QQE A;  3R7Q A;  1KT0 A;  2PM7 A;  4C48 B;  4BT8 A;  1DCE A;  3IBE A;  4I1M A;  4DI4 A;  4FA6 A;  4HB5 A;  3NF1 A;  4J7W A;  4GPM A;  4PH4 B;  2GRN B;  1NZN A;  4DX5 D;  3U64 A;  4JPS A;  3ASO E;  3ZXP A;  2XPZ A;  1KZP A;  3IXE A;  3TAX A;  1XGW A;  4WWP A;  2LNI A;  1OWP A;  4P29 A;  3VTY A;  3Q9N C;  3E37 A;  3FHE A;  3EU5 A;  2H6F A;  3S7J A;  3E34 A;  3PS6 A;  1UN9 A;  3Q75 A;  3TL5 A;  4GTT A;  1OWN A;  1FVF A;  3UM3 A;  4FP7 A;  3GZS A;  3CVU A;  3I5P A;  3K9I A;  3FU0 A;  3FU5 A;  5EIL A;  3PUK A;  4H7X A;  4F1P A;  3NBN B;  4UWF A;  4KMO A;  2C0M A;  2B0O E;  4L2Y A;  3UTM A;  3L08 A;  1LD8 A;  2A4Z A;  3ZNG A;  1ZU2 A;  4B89 A;  3LDZ A;  4O60 A;  4YDY A;  4I6G A;  4JA7 A;  3ZW3 A;  3NZU A;  2AXV A;  1OWL A;  3D9N A;  5BV1 A;  4I1A A;  5EDS A;  5CED B;  2F8Y A;  1D8E A;  1UJJ A;  4R7L A;  2DZN A;  3MCX A;  3V30 A;  3LJ3 A;  2UY1 B;  4GB9 A;  4CDN A;  4GA1 A;  2OVF A;  3JCK C;  2QFC A;  2VYI A;  5AQ9 A;  1N4S A;  3EIQ C;  4YDE A;  3AJI A;  4DX1 A;  3UIP C;  5BW8 C;  4TXP A;  3P2B A;  4TUU A;  3G2S A;  2DBA A;  4HI9 A;  3OXG A;  1S63 A;  2LAH A;  2XEE A;  5CHE E;  4RG6 A;  2OCC E;  5D66 A;  1SVX A;  2X6I A;  3UKU G;  3CQC B;  1TN6 A;  2X6K A;  2GRQ B;  3SGH A;  3ZYK A;  3BU8 A;  4HOT A;  4F6R D;  1MJ0 A;  2ZXW E;  1UG3 A;  2RG8 A;  4FC8 A;  2HR2 A;  2YIN A;  4BWR A;  3TWV A;  2WXF A;  3D9L A;  5DIZ A;  4I9E A;  4DX7 D;  2LUH A;  2YHC A;  1TNB A;  2VQ2 A;  2XGS A;  3DEP A;  4GZ3 A;  1V55 E;  3ZYL A;  2V4H C;  1ZB1 A;  3MKQ B;  1NFI E;  3ABM E;  3OXL A;  1O1S A;  2XEV A;  3LCA A;  5T3R A;  3Q7F A;  3RRU A;  2HM8 A;  5G55 A;  5KNG A;  2L0I A;  2OOE A;  4LCT A;  5IY5 E;  5M72 A;  5G05 J;  4MKT A;  2OVB A;  3U66 A;  4HOR A;  4Y6W A;  4UUC A;  1RW2 A;  3R9A B;  1ZBP A;  3JUI A;  1JCQ A;  3I3N A;  1IHG A;  1K8K G;  2FO1 E;  1IQU A;  1NP7 A;  3FUN A;  2H6G A;  2NXP A;  2J09 A;  4TV3 A;  5AJD A;  3L13 A;  3L54 A;  1MX4 A;  2FBN A;  5ANL A;  4K03 A;  4E6H A;  4IYP A;  2P9U G;  5ENS D;  4FJY A;  1E7V A;  2X6J A;  3ISM C;  4BES A;  5CBN A;  4AVX A;  3TJP A;  3ULQ A;  5FIN A;  1DCQ A;  3B95 A;  3S7B A;  4URK A;  1OCO E;  2XCB A;  3QWP A;  1TR4 A;  2R59 A;  3D9I A;  2VSO E;  4HFG A;  2V4L A;  2RFA A;  3FTY A;  4G1T A;  5AJL A;  3LEW A;  4AXH A;  1N52 A;  2WQ7 A;  4ABN A;  4M3O A;  3SF4 A;  3FP3 A;  3NB2 A;  4EHM A;  3DSW A;  4UWL A;  1EF1 C;  3FTZ A;  4EBA G;  4RVB A;  3TWT A;  3CK9 A;  4EZJ A;  4EEC A;  5EIB E;  4XZ4 A;  1JCS A;  3DSU A;  1SW6 A;  5ENR D;  3GZ1 A;  2IOL A;  3T8K A;  2VGE A;  4AEZ C;  3PZD A;  1EPU A;  4AP2 A;  4B0Z A;  1YMP A;  4B8A A;  2MHK A;  3AS8 A;  1AWC B;  4K5C A;  1N94 A;  3RSE G;  1EYH A;  1WM5 A;  3TWQ A;  2JEK A;  3QAR A;  3HYM B;  3UIN C;  4BX9 A;  3EHN A;  4A1S A;  1U3D A;  3HRA A;  3AS5 A;  5G04 C;  3MGB A;  3FEX A;  4JHR A;  4ANX A;  4FHJ A;  1O1T A;  1UJK A;  4B94 A;  4CYM D;  4AIF A;  3O48 A;  1QNF A;  3B7U X;  4C0M A;  5B1B E;  3DST A;  3LS8 A;  4CT0 A;  3HVE A;  4DLQ A;  2CHW A;  2JAB A;  4B8C B;  1ELR A;  3U9W A;  3PZ1 A;  5JJ6 A;  3HXB A;  3KEZ A;  1WDY A;  1N9A A;  4WNE A;  3SFX A;  5LOZ A;  1SZ9 A;  3IHV A;  1AP7 A;  5HI7 A;  2H6I A;  3W9F A;  3G2V A;  2XPI A;  1QBQ A;  4UQY A;  2CFU A;  2FI7 A;  3FTW A;  4GMJ A;  2RKK A;  1TNY A;  3D9H A;  3EHQ A;  4X8Q A;  3WXX A;  5JHA A;  4G8K A;  1MYO A;  1DVP A;  5EX0 A;  4OAV B;  4NUR A;  3APD A;  4NIK A;  4Q96 A;  3UMV A;  4HLL A;  4KBQ A;  3PVL A;  3HDX A;  1KZO A;  2EIJ E;  4WNG A;  3FU3 A;  3QB2 A;  1TEZ A;  1HH8 A; 
#chains in the Genus database with same CATH homology
 2V0P A;  4FAD A;  4XI0 A;  4WWP A;  2LNI A;  1OWP A;  2FEZ A;  3AU4 A;  3TXN A;  5AEN A;  1JWF A;  1NA0 A;  4P29 A;  4U04 A;  3VTY A;  4WWO A;  4KVO A;  2GRL A;  4WWN A;  1N54 A;  1GW6 A;  1YA0 A;  2AWI A;  4AY5 A;  5A7D B;  3FY4 A;  1P5Q A;  4I2Z A;  3CIA A;  4XIF A;  3FHE A;  4GPK A;  5A23 A;  3LYA A;  1SZA A;  4N2S A;  3FUJ A;  4J6I A;  2LAI A;  4FU3 A;  3QDN A;  3S7J A;  1HU3 A;  2P58 C;  3FWV A;  3HHM A;  3CHM A;  3PS6 A;  3AU5 A;  3L16 A;  4EZL A;  4WND A;  1UN9 A;  2EQX A;  3CHQ A;  5LFA A;  4LER A;  3TL5 A;  4PDX A;  1OWN A;  1FVF A;  2J4D A;  3R7R A;  2MRI A;  4FP7 A;  2CFZ A;  3G2W A;  3GZ2 A;  3FUH A;  3ASH A;  5ARG A;  3GZS A;  3O4Z A;  3CVU A;  4PS7 A;  3I5P A;  3K9I A;  2J07 A;  3D3M A;  3FU0 A;  4G26 A;  4AY6 A;  4I43 A;  5DBK A;  3FU5 A;  1ELW A;  3PUK A;  1E8X A;  4H7X A;  4N3B A;  4UWF A;  3RU0 A;  4KMO A;  2C0M A;  4L2Y A;  3U4T A;  3BG0 B;  2XGO A;  4PS8 A;  4I6E A;  4JXT A;  3L08 A;  3PE4 A;  3ESL A;  4JC8 A;  2A4Z A;  2PQR A;  5BUZ A;  4IN3 B;  3MKR A;  2C0L A;  1ZU2 A;  4B89 A;  4DJA A;  3LDZ A;  5KJM A;  4AM9 A;  4I6G A;  5BNW A;  3D9P A;  4JA7 A;  4GA0 A;  4I9C A;  3PNL B;  3ZW3 A;  3KD7 A;  1HO8 A;  2J49 A;  2VTB B;  3NZU A;  2AXV A;  3I4R B;  2DIW A;  3IV0 A;  2L6J A;  5KJK A;  4N39 A;  1OWL A;  2X6F A;  4J8S A;  2WB2 A;  3E4B A;  3OTN A;  3QWW A;  3D9N A;  3PEU B;  4I1A A;  4U63 A;  4EPZ A;  5BV1 A;  5EDS A;  3CVV A;  2VGX A;  2J08 A;  3ZYM A;  5LX8 A;  3LKU A;  4GZC A;  4N5C A;  2J4B A;  3RKV A;  1UJJ A;  4R7L A;  4FJZ A;  2OND A;  3PRZ A;  4KZ0 A;  4W9R A;  3FUK A;  3G2T A;  3MCX A;  2AVP A;  2WXK A;  3U3W A;  4U0Z A;  3S7D A;  1MHQ A;  3LJ3 A;  2PQN A;  3GW4 A;  5CCM A;  2UY1 B;  5J08 A;  4ANU A;  3ZFW A;  4GB9 A;  4CDN A;  2Y4U A;  1E90 A;  4GA1 A;  2OVF A;  2XCC A;  1HXI A;  5C2Y A;  4BSX A;  1TJF A;  3JCK C;  3CVP A;  2WXO A;  2QFC A;  4UI9 C;  4I1O B;  2UWJ G;  1INZ A;  2WXH A;  4EQF A;  2VYI A;  4U8H A;  4TRQ A;  1HG5 A;  4JZY A;  3ZGQ A;  1OUV A;  3EIQ C;  4GCN A;  2VSY A;  4JW1 A;  3D9J A;  1H0A A;  3TG4 A;  1IQR A;  2HO1 A;  4JHJ A;  4JA9 A;  5BW8 C;  2FUL A;  3C98 A;  3SFZ A;  3S2A A;  5D0O D;  3P2B A;  3FUF A;  3KS2 A;  3CKC A;  5KJL A;  5EKQ D;  2Y3A A;  3UUX A;  2WXI A;  3FUL A;  2IJG X;  3LY7 A;  3G2S A;  4TUU A;  2VSX E;  2DBA A;  4RSY A;  4BT9 A;  3URZ A;  3OXG A;  1H2T C;  1MQS A;  2RD0 A;  3RO3 A;  2LAH A;  1DNP A;  5CHE E;  4RG6 A;  5AIJ A;  4GU5 A;  2KM4 A;  4ME2 A;  4UQX A;  3UT8 A;  1U3C A;  1SQM A;  2X6I A;  3ENE A;  4UQZ A;  3SBS A;  4L23 A;  3CQC B;  1PC2 A;  2WM9 A;  2CG3 A;  2IOS A;  4QFV A;  4YVO A;  3L6A A;  3RRN B;  2X6K A;  1ELK A;  3UX4 A;  4IRU A;  4G23 A;  2KAT A;  4BTB A;  4FUL A;  4K0R A;  3PNT B;  3CR3 A;  4APF A;  3SGH A;  3ZYK A;  3L17 A;  4UI9 J;  4HOT A;  1IYG A;  3MA5 A;  4AV7 A;  4PUC A;  5G05 C;  1Z6T A;  4EBA A;  4HS2 A;  4FLB A;  1UN8 A;  3SZ7 A;  1S0P A;  3FU6 A;  5KJN A;  1UG3 A;  5JJT A;  5CMY A;  4JL0 A;  2RG8 A;  4L2L A;  4ILI A;  4FC8 A;  3LVR E;  3EJN A;  4Q94 A;  2HR2 A;  2NC9 A;  2ZU6 B;  2YIN A;  2I1J A;  2V8S E;  4BWR A;  2WXF A;  3D9L A;  5DIZ A;  4I9E A;  3UT4 A;  4GAA A;  4MLP A;  3DBS A;  2YHC A;  1WY6 A;  1KLX A;  2XGS A;  2VQ2 A;  4GZ3 A;  4I2W A;  1LF8 A;  4O6F A;  4BTA A;  2I1K A;  3ZYL A;  3FTU A;  3CK7 A;  3CVN A;  1NA3 A;  1H6K A;  3MKQ B;  4A1G A;  3TG5 A;  3ZVV A;  3TGO A;  2R17 C;  5FWQ A;  3VLE A;  2E0I A;  2WMO A;  4NAC A;  3OXL A;  2VJ8 A;  3IKO B;  4DK5 A;  5JJ7 A;  2XEV A;  3LCA A;  3FUE A;  3AS4 A;  5T3R A;  3MV3 B;  3LXU X;  4F3V A;  2IFU A;  5G55 A;  2HM8 A;  4MRU A;  3RRU A;  4ATG A;  2L0I A;  4JVS A;  2HYZ A;  3APF A;  2OOE A;  2X38 A;  4LCT A;  2X6H A;  4V3I A;  4PS3 A;  5M72 A;  2WQ6 A;  1Y6I A;  5G05 J;  3ZHE B;  4UWH A;  4MKT A;  1KT1 A;  4XKB A;  3UQ3 A;  4N3C A;  5T8I A;  2ION A;  2OVB A;  4ANW A;  3VTX A;  1BPO A;  4ILG A;  3U66 A;  3RO2 A;  1H2U A;  5BV0 A;  2KZT B;  3ZEF A;  2ILR A;  2FF4 A;  4F7A A;  4HOR A;  4CEM A;  5C1D A;  3IEG A;  4Y6W A;  3EDT B;  3QNK A;  1HG2 A;  2WPV A;  4XX5 A;  2BUG A;  4MS6 A;  5J90 A;  3KAE A;  4KYO B;  3R9A B;  1X5B A;  4G2V A;  3Q49 B;  4UWK A;  4CRW A;  1ZBP A;  3SI5 A;  3MZL B;  4I6J A;  4DPR A;  3JUI A;  2JLB A;  3NZS A;  1B89 A;  4A55 A;  1OWM A;  1HE8 A;  5LCW C;  3FTV A;  2VSN A;  3ZYQ A;  3I3N A;  2GRM A;  3ONK A;  1IHG A;  1QZ2 A;  1IQU A;  5HQ8 A;  1NP7 A;  2YHE A;  3QOU A;  2KCL A;  3FUN A;  4BFR A;  2NXP A;  5FZQ A;  5LP0 A;  2J09 A;  4TV3 A;  1E96 B;  5AJD A;  3HIZ A;  4ANV A;  3L13 A;  3L54 A;  4N3A A;  4CDR A;  2FBN A;  2KCV A;  3CVQ A;  3OXF A;  4KXK B;  3FH8 A;  4OVU A;  3ML9 A;  4GYY A;  4GZ6 A;  4K03 A;  5ANL A;  4WAF A;  3APC A;  3ZHE A;  4E6H A;  4APO A;  3SNX A;  1JWG A;  2WXR A;  4JHK A;  3D9K A;  3FH7 A;  4HLE A;  2XGM A;  4IYP A;  1JPL A;  4FJY A;  4XE0 A;  2A5U A;  2PZI A;  1E7V A;  4N2Q A;  2I6H A;  3FFL A;  2X6J A;  2VTB A;  4U07 A;  5FT9 A;  5AYW D;  3QWV A;  3FTX A;  3CVL A;  3PUJ A;  3ZXS A;  4AVX A;  4U0S A;  1E8Y A;  4GYW A;  3Q15 A;  3TJP A;  3ULQ A;  1FCH A;  1L5J A;  3CVY A;  2V5F A;  5CMW A;  2WXP A;  2PM6 A;  2YNQ A;  3I4G A;  5LCW J;  1EDU A;  3S7B A;  1XNF A;  3EIJ A;  5BPP A;  4URK A;  5FQ7 A;  5A6C A;  3QJZ A;  2LSV A;  4G24 A;  2R5S A;  2XCB A;  3QWP A;  4XKC A;  2R59 A;  5E76 A;  4FHK A;  3RJV A;  2UY1 A;  3CGH A;  2VSO E;  3D9I A;  4HFG A;  4NRH B;  4Y6C A;  4ACL A;  4AJW A;  3EHM A;  3CVX A;  2V4L A;  2L0T B;  3RIB A;  2Y4T A;  2YQ8 A;  2IF4 A;  3CV0 A;  3FTY A;  5E75 A;  4G1T A;  3ZRH A;  4DLO A;  4Q69 A;  5AJL A;  1E8Z A;  3LEW A;  3MEK A;  2XQ0 A;  3ZPJ A;  4AXH A;  2LO6 A;  1N52 A;  2XPY A;  1OWO A;  3GYZ A;  2WQ7 A;  2CHX A;  4ABN A;  1HX8 A;  3B13 A;  2XHE A;  2GW1 A;  1E8W A;  4ILH B;  4GCO A;  4M3O A;  3SF4 A;  4CT4 A;  3FP3 A;  3QC1 A;  2AW6 A;  2FO7 A;  4E85 A;  4UWL A;  4AOF A;  1EF1 C;  2AXU A;  3FTZ A;  3SHF A;  4EBA G;  4RVB A;  1JUQ A;  3MYV A;  3JYS A;  3CK9 A;  4EZJ A;  3D9M A;  3G2U A;  4EEC A;  3CVW A;  4XZ4 A;  1Z3X A;  4YND A;  5FQ8 A;  3UPV A;  3BG1 B;  3PE3 A;  2BTD A;  2WMN A;  4EZK A;  3GZ1 A;  2IOL A;  1TJC A;  4NQ0 A;  4GA2 A;  1Z3Y A;  4GML A;  4IUL A;  2DCP A;  4YVQ C;  4C9B B;  3SBT B;  1FVH A;  4AEZ C;  5T4Y A;  3PZD A;  3ML8 A;  3LY8 A;  4I17 A;  2IU1 A;  4OVV A;  2WXM A;  1EPU A;  4WNF A;  5FQ4 A;  4L1B A;  4AP2 A;  2NSZ A;  2WXJ A;  4U0U A;  4B0Z A;  3JQ1 A;  4B8A A;  1HZ4 A;  2X3M A;  3LVQ E;  4OYS A;  2KCK A;  2MHK A;  4JEU A;  2VGY A;  4KZC A;  2VGX B;  3AS8 A;  3SD5 A;  3ASF A;  3B7T A;  4GYO A;  2L9B A;  3FDH A;  4J0U A;  3JQ0 A;  3VLF A;  3PRE A;  3HVE B;  3CK8 A;  3CEQ A;  3ZIM A;  3ASD A;  5ANR A;  1EYH A;  2CG2 A;  3CHR A;  3L22 A;  1WM5 A;  2WVI A;  3OAW A;  3RK6 A;  2JEK A;  3QAR A;  3FUD A;  3S7F A;  3MKQ A;  5FZR A;  4ACK A;  3ONL A;  3HYM B;  3MJW A;  4A3V A;  2CHZ A;  2WQH A;  5FQ6 A;  4LRZ A;  4BX9 A;  1PY1 A;  3IHY A;  3PDN A;  1VDY A;  3EHN A;  4A1S A;  1U3D A;  1HS6 A;  2C2L A;  2WXL A;  4JEH A;  3QK0 A;  2XRZ A;  3Q5M A;  3AS5 A;  5EX3 A;  5G04 C;  1H19 A;  2E2E A;  1W3B A;  4L7T A;  3MGB A;  3FEX A;  4H7Y A;  3UT7 A;  4JHR A;  4BX8 A;  3FUM A;  4ANX A;  4FHJ A;  1UJK A;  4B94 A;  3CKB A;  2AXZ A;  5FTP A;  1HF8 A;  2J9Q A;  3CQG B;  3O48 A;  1E7U A;  1QNF A;  2Q7F A;  4G11 A;  4AIF A;  3B7U X;  4LUN U;  5FJY A;  3BEE A;  3Q4A B;  4C0M A;  1H2V C;  4KVM A;  3DPD A;  4J8D A;  2MOW A;  2XRY A;  3LS8 A;  2KZT A;  5ENN A;  3T5V A;  4LEU A;  3ZN3 A;  4CT0 A;  3HVE A;  3CHP A;  2CHW A;  4DLQ A;  2BF0 X;  1Y8M A;  3B7S A;  2LSU A;  5G2N A;  3FTS A;  4CCA A;  4XI9 A;  3TXM A;  4RG9 A;  2OV8 A;  4B8C B;  1ELR A;  3U9W A;  1UW4 B;  3PH0 C;  3B7R L;  3QKY A;  5JJ6 A;  4KT6 B;  5FZS A;  1A17 A;  3KEZ A;  3FEY A;  4WNE A;  4F53 A;  5LOZ A;  1SZ9 A;  4HVB A;  4HOS A;  3IHV A;  3ESK A;  5HI7 A;  3CHS A;  4DI3 A;  3G2V A;  5D0Q D;  2WXG A;  3T8M A;  4D10 C;  3RRM B;  1WAO 1;  4HXI A;  5ARF A;  4J8E A;  4UWG A;  2XPI A;  5G04 J;  4GZ5 A;  5BT1 A;  3VLD A;  3LY9 A;  3Q47 B;  3CSF A;  4UQY A;  4CGW A;  2WXN A;  2IQC A;  2WXQ A;  4C0E A;  4J8F A;  3D9O A;  3QAQ A;  2QY7 A;  4G25 A;  5JHB A;  2CFU A;  2FI7 A;  3FTW A;  5KCM A;  4GMJ A;  4UI9 K;  1HFA A;  4HOQ A;  3P1U A;  4HOU A;  1QQE A;  3R7Q A;  1KT0 A;  2KC7 A;  2PM7 A;  3CST A;  3T5X A;  4BT8 A;  3MX3 A;  2M63 A;  3IBE A;  4FLH A;  3CHO A;  3ASG A;  3N71 A;  4I1M A;  3WXX A;  5JHA A;  2I2O A;  3NQP A;  4BY6 A;  4DI4 A;  1DVP A;  4GZD A;  5EX0 A;  1PAQ A;  4NUR A;  4WUY A;  4F1S A;  3APD A;  3NF1 A;  4FA6 A;  4CGV A;  2GGF A;  3CLJ A;  4Q96 A;  3UMV A;  4PH4 B;  4KBQ A;  1NZN A;  4A3T A;  5CCL A;  3PVL A;  3HDX A;  3U64 A;  4JPS A;  4WNG A;  3FH5 A;  2XPZ A;  3LPZ A;  3FU3 A;  3QB2 A;  3FUI A;  4CDM A;  2PL2 A;  1HH8 A;  3PEV B;  3TAX A;  1TEZ A;  3MV2 B;  2I9C A;  1XGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...