1A17A

Tetratricopeptide repeats of protein phosphatase 5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
159
structure length
159
Chain Sequence
PPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 5
total genus 65
structure length 159
sequence length 159
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1997-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1a17A00
1W3BA 2NC9A 4BTAA 4B94A 5EX3A 2LNIA 1IYGA 2FF4A 5DIZA 3ASGA 4N5CA 5FZRA 3LPZA 3ULQA 3S7FA 3ZHEA 1HH8A 4YVQC 2PL2A 2PQRA 3R9AB 2C2LA 4ABNA 4N3CA 1ZBPA 2LSVA 3BEEA 4N2SA 2FI7A 1WM5A 2VSYA 5FZSA 4U04A 3S7JA 1E96B 2KCKA 2XCCA 4NQ0A 4XIFA 3GW4A 4N2QA 5G05C 4GPKA 2BUGA 2QFCA 2J9QA 2UY1B 4I17A 4G23A 4KYOB 4U07A 4UI9J 3CV0A 2I6HA 4G2VA 4I2WA 5M72A 1NA0A 4IN3B 1YA0A 3AS4A 4I2ZA 4CGWA 1IHGA 5BT1A 3TG4A 3U3WA 4J8EA 3CEQA 3PE3A 4UQZA 4H7YA 2WQHA 4WNGA 5EKQD 4G24A 4G26A 4GYWA 4KXKB 2PZIA 4NRHB 3VTXA 2E2EA 1HXIA 2HYZA 2VSNA 5DBKA 3VTYA 3TG5A 4HORA 3GYZA 5JJTA 2HO1A 4G1TA 3OXGA 2Q7FA 3Q15A 5D0QD 3Q4AB 3QWWA 5FT9A 2XGOA 5BNWA 4GZ5A 4RG6A 4UI9C 2VQ2A 3FP3A 4KBQA 3ZFWA 2P58C 3QDNA 5EX0A 2KC7A 1NA3A 4W9RA 2XGSA 3FFLA 2VYIA 3Q49B 4BT9A 5LCWC 3UPVA 4HOQA 4Y6WA 2MHKA 3PE4A 4GCOA 4EQFA 3Q47B 4F3VA 4I9EA 5KJKA 4UQXA 2XEVA 3OXFA 5CCMA 2LSUA 1KT1A 3QWVA 5HI7A 4N39A 1KT0A 5G04J 5JJ6A 3KAEA 1FCHA 3LY8A 4U0SA 4WNDA 4GZ3A 1WAO1 4G25A 5FZQA 4HOTA 1KLXA 3CKCA 3MEKA 4RG9A 3E4BA 4ME2A 3CK8A 4JHRA 4WNEA 4YVOA 1P5QA 1Y8MA 5BW8C 5KJLA 2YQ8A 2XPIA 3HYMB 4CGVA 3SF4A 2XCBA 4UQYA 3AS8A 3K9IA 5KJMA 2PQNA 4N3AA 4U0ZA 1TJCA 3ZN3A 4XI9A 4AIFA 4LEUA 3CVNA 2Y4TA 3CK9A 1ZU2A 3MKRA 4N3BA 4AM9A 5JJ7A 5LCWJ 3RKVA 5A7DB 2KATA 3LY9A 4JL0A 4A1SA 5C1DA 3N71A 4GZ6A 3ZPJA 1QZ2A 5A6CA 4GYYA 3QWPA 5CCLA 1XNFA 3ZHEB 3IEGA 4O6FA 5G04C 4GA2A 5KJNA 2VGXA 3WXXA 4WUYA 2C0LA 5D0OD 3GZ2A 4AY5A 3RO2A 3S7BA 1HZ4A 1PC2A 2GW1A 2WPVA 3KD7A 3CK7A 3EDTB 3PDNA 3SZ7A 5AYWD 2UWJG 5FJYA 2L6JA 3ESKA 2DBAA 4I1AA 2IF4A 4Y6CA 2IFUA 2FO7A 2JLBA 2R5SA 2FBNA 3AS5A 4JA9A 1NZNA 3TAXA 3UQ3A 2KCVA 3LCAA 3LKUA 2YHCA 4BWRA 2VGXB 3UUXA 2AVPA 2VGYA 3ASDA 3U4TA 4APOA 4GYOA 3RIBA 4XI0A 1ELRA 2Y4UA 3QKYA 4J8FA 3ZGQA 5CHEE 3ASFA 4HOSA 3CKBA 3O48A 4BT8A 2ONDA 3RJVA 2UY1A 5ARGA 3CVQA 1A17A 2XGMA 3CVPA 3CVLA 4GA1A 2FEZA 3NF1A 1OUVA 3GZ1A 3OXLA 1B89A 5FTPA 4U0UA 3S7DA 4HOUA 3MV3B 5HQ8A 3FWVA 4YNDA 2OOEA 3RO3A 3URZA 4WNFA 4GA0A 4J0UA 4CDRA 3TGOA 5G05J 3LY7A 1QQEA 3JYSA 3ASHA 4I9CA 4J8DA 4BTBA 3QOUA 2HR2A 3MA5A 4H7XA 2C0MA 3KS2A 3LYAA 4JA7A 3MV2B 3Q5MA 1ELWA 4UI9K 5ARFA 4AY6A 3RU0A 4GCNA 2V5FA 2KCLA
chains in the Genus database with same CATH superfamily
5EN5D 1H2VC 2C2LA 4E6HA 5EIDA 2XCCA 4I2ZA 1DCEA 1YA0A 4EECA 4PS3A 1SQMA 4H7YA 4ACKA 1FVFA 4EZLA 4NRHB 5CMYA 3FU0A 1FT2A 4KVOA 4O1OA 1OCOE 4I6EA 4YDYA 5T4YA 3FUHA 1H19A 2KXPC 3ZRHA 3HG0D 2R05A 2KC7A 3APFA 4N39A 2XZDG 3LVRE 4XEIG 4HFGA 3CGHA 3D9OA 5FINA 3Q78A 1ZU2A 2XPZA 2RG8A 1INZA 5A7DB 3HXBA 2P9NG 4GYYA 2GRRB 4HRMB 2XRYA 3ENEA 2IF4A 2IEJA 4Q69A 4JW1A 3X2QE 3LKUA 1DC2A 2DWZA 3TWWA 1N4RA 1HX8A 2PM7A 4X8QA 1LD7A 1A17A 3NF1A 2M63A 1UJKA 2OV8A 3HDXA 4DI3A 5ENPD 4F53A 2DIWA 4WNFA 4IRUA 3LY7A 4E85A 3MA5A 3ULQA 3AU5A 5JA4D 3R9AB 3BG1B 4GTVA 2KZTA 1U2VG 1FT1A 4I1OB 3CV0A 4UWGA 5AQBA 4CDNA 4KZ0A 4KZCA 2I9CA 4KXKB 2VSNA 2RD0A 3FTVA 2Q7FA 1K3ZD 2XGOA 5KBAA 2ZISA 1X81A 3ZXSA 1IKND 4MLPA 3SY2A 5HI7A 3I4RB 3PNLB 1XGWA 4GTPA 5T3RA 2XPIA 3FHEA 3AS8A 4EZKA 2PQNA 3IKOB 1TJCA 3UTMA 4L2YA 4AM9A 1IQUA 3R9MA 2XS1A 1N54A 3FY4A 3NOGD 3HVEA 2XQ0A 2J07A 3FUKA 3FUDA 2EIKE 1UN8A 3T9KA 3TWTA 4XX5A 5ENNA 5CRVA 1ELRA 3PZ1A 4I43A 2RKKA 5CHEE 1TN8A 2ONDA 2R59A 1JWGA 3DRAA 2CFUA 1OY3D 3ULEG 2DVWA 2GGFA 2J09A 4DX6D 3KS2A 4K03A 3FTUA 3NQPA 3EJNA 2LSVA 1UJJA 3J5QB 4NQ0A 3BG0B 4UI9J 1RZ4A 2AXVA 1N11A 1YMPA 4G2VA 5B3SE 4OAUC 3CVVA 4UI9C 2YINA 2X3MA 3TL5A 3ZYLA 4UWFA 5KJKA 4UQXA 4LG6A 5B1AE 4AP2A 2DZOA 2LXMA 3DPYA 3CK8A 4PS7A 2EILE 4WWPA 1OXJA 4MRUA 3SFYA 3FH5A 2Y4TA 3OAWA 2NXPA 5CEAA 4GZ6A 1JCRA 5KJNA 4DX5D 5AYWD 3B7BA 3PVLA 3RRMB 2DBAA 3JCKC 4WWNA 4GYOA 4J8SA 5KNGA 4U8YD 1E8YA 4FC8A 2A5EA 3UT8A 2YNQA 3NBNB 5BPPA 4K0RA 1ELWA 4XZ4A 1SA5A 2KCLA 3LJNA 1N94A 2FF4A 4M3OA 1HG2A 2WMNA 4YVQC 2IY0C 3HIZA 4N2SA 1WM5A 1MYOA 5H7PA 2WXRA 4U07A 1EYHA 2JEKA 3AJIA 3I3NA 2J4DA 3VTXA 3ULYA 2ILRA 4RQIA 1NI1A 2J08A 1S70B 1HFAA 1IQRA 2NSZA 3SNXA 2VSOE 5CCMA 3NAWA 3KAEA 1WAO1 2Y1LE 4M7CA 5CRUA 1TJFA 3ZYMA 4TRQA 3FULA 3CVNA 4JL0A 3N71A 1LF8A 4DX1A 2J4BA 1LD8A 3V30A 5LX8A 5M72A 3ABLE 1HO8A 4BWRA 3ZU7B 4EZJA 1S64A 4KVMA 3FH8A 1K1BA 1BLXB 1SZ9A 4LERA 4G11A 2IU1A 2OVBA 4GA0A 4JB8P 4PH4B 4DI4A 4ZHBA 3FU3A 4UI9K 3B7TA 4LRZA 4QQIA 2LNIA 2RFAA 3S7FA 2PL2A 1FVHA 3MJWA 2FI7A 4N2QA 3UKRG 4K5BA 3UT4A 1E7VA 2LAHA 4GTTA 4IN3B 2F8YA 5ENRD 3DBSA 4MKTA 3TWQA 1BI8B 3PE4A 3Q47B 4NIKA 3QWVA 1KT0A 3TWXA 2WXQA 4A1GA 5EIBE 4HOTA 3MEKA 4RG9A 4ME2A 3SF4A 4U96D 4LEUA 2AW6A 3KSLA 3CK9A 3Q79A 3CVWA 3SFZA 3NOCD 3CSTA 3IV0A 5G04C 3ESLA 2VGXA 5D0OD 5IY5E 4B8CB 2H6HA 4FHKA 1NZNA 5ENTD 3DSUA 3DSVA 5JMND 3QK0A 3QKYA 2R02A 3IBEA 3Q73A 1OWLA 3AG1E 3ZYQA 2X6KA 1TNYA 4UWHA 4CDRA 3CQGB 5LP0A 2GRNB 4FJZA 1SVXA 4H7XA 3RK6A 2RFMA 3MZLB 3SO8A 5EX3A 5DIZA 4P29A 2F37A 5EDSA 3FH7A 2J9QA 1Z3YA 1FPPA 1IHGA 3U3WA 3LDZA 2WMOA 1H0AA 3Q9UC 4BETA 2ETAA 4G26A 2IO3C 2HYZA 5AAOA 5D2MC 2HO1A 5ANRA 4CEMA 2VQ2A 1TEZA 1G3NB 4EBAA 4CZ2D 2AWIA 3UM0A 3V79K 3C98A 2VSXE 1O1SA 4C9BB 3SHFA 2KZTB 1ZB1A 1UW4B 2KATA 2Y69E 3ZUVB 1KPSB 4XKBA 5J90A 1D8DA 1WY6A 4TXQA 1JWFA 4B89A 3SZ7A 3KD7A 4OVVA 4PUCA 2IO2C 5KCMA 2KCVA 2X6HA 5LFAA 3CHRA 4CYMD 3ONKA 4ILHB 3RJVA 5ARGA 4GA1A 3OXLA 1H6OA 4UUCA 4DK5A 3RO3A 1O1RA 3JYSA 2J49A 2HR2A 2LAIA 3LYAA 4JA7A 5ARFA 3RU0A 2V4LA 4I17A 3BU8A 2NC9A 3D9IA 4YDOA 5FZRA 2OVFA 1ZBPA 3UINC 3UXGA 3EU9A 4U04A 5EILA 3GW4A 2UY1B 4G23A 4LNUD 4AOFA 3CEQA 2LXLA 1H6PA 4G24A 2KBXA 2CG3A 3FTWA 4GTRA 1DVPA 4LUNU 3SFXA 3FU6A 3UPVA 3R7QA 4GCOA 3PRZA 3PH0C 1N0QA 3T8KA 2ZU6B 3T5XA 4EBAG 1Q2ZA 5T8IA 4DLQA 3C72A 3EHMA 2Y3AA 2F8XK 3AG4E 3PS6A 3LY9A 1OT8A 2ZIRA 3LXUX 3QWPA 3OTNA 4A55A 1Z5SC 2E0IA 4FU3A 4EHMA 2BKKB 2H6GA 4U63A 3ESKA 1SZAA 2WXHA 2WXIA 1DNPA 2WM9A 1YYHA 4IYPA 4U7EB 3VLEA 4XI0A 5B1BE 2L9BA 4XE0A 3ZEFA 2B0OE 4URKA 2EIME 3D9HA 4CRWA 2H6FA 3QB2A 2OOEA 2BF0X 3L17A 5G05J 4J8DA 2IOLA 4O1PA 4BTBA 1L5JA 4GCNA 1W3BA 3D3MA 3CVYA 4TXRA 1TNBA 2PQRA 4N3CA 3JUIA 3HVEB 5G05C 2WVIA 4CGWA 2ZGDA 3AG3E 4UQZA 2IONA 2XEEA 4UWKA 2V0PA 5ENOD 5AQAA 4WAFA 3HXFA 3DEOA 3L22A 3DSTA 3QWWA 3QDNA 4GB9A 3DXKG 2XEVA 4GPMA 2MYOA 2LSUA 5JJ6A 4DLOA 5EYPF 3CKCA 3TWUA 1ELKA 5ENQD 1P5QA 2V4HC 3ZIMA 4UQYA 3JUEA 5AQ7A 3EHNA 4XI9A 3HRAA 3MKRA 5AQ9A 5JJ7A 2XHEA 2V5QC 3ZPJA 3U64A 4ILGA 3J5PA 4U8VD 3WXXA 4ATGA 3GZ2A 1PC2A 2WXLA 1U3DA 4BERA 4BSZB 3PEUB 3FUEA 2YHEA 1IHBA 1D9SA 3PUJA 2VGYA 4ANWA 3ASFA 3CKBA 4GAAA 3D9NA 3MKQA 1HS6A 4HI8A 3WG7E 3S7DA 1PAQA 3SD5A 4BEPA 4GZCA 2V5FA 4HS2A 4B94A 1N95A 1TNOA 3NZUA 4GTSA 1MX6A 3NB2A 2QFCA 4KYOB 4I2WA 3G2TA 3MYVA 3FTXA 5BT1A 3PREA 3B7RL 3ASNE 3KEAA 2PZIA 1HXIA 2BKGA 3QARA 1MQSA 5BV1A 4W9RA 2VTBA 2VYIA 4HOQA 4I9EA 1KT1A 2VTBB 3FUFA 3EIJA 2XEHA 1JUQA 3ABKE 4YDEA 5BUZA 3CHMA 5BW8C 5ANLA 4CGVA 3L08A 1OWMA 3C3RA 3HHMA 5FQ8A 1VDYA 2OEVA 4GTMA 4HVBA 3RKVA 4B0ZA 3R7RA 4CDMA 3ML9A 4G8LA 2OCCE 4QFVA 4BSXA 4D10C 3L54A 4I1AA 2NYJA 4YDWA 1MHQA 5FIOA 1QYMA 1HG5A 3DEPA 3SGHA 3CHPA 3E33A 3B7UX 3SI5A 4RVBA 1EDUA 3CVQA 2XGMA 3DPDA 4UWLA 3SBTB 3F6QA 3TXNA 4AV7A 4K5CA 1A5EA 1X5BA 2WXNA 4N5QA 5KNHD 2GRLA 1WG0A 3PZ2A 4FP7A 3ZVVA 5G55A 2R03A 4C0MA 4AEZC 2LUHA 5FZSA 3UKUG 3G2SA 2FO1E 4Y6WA 4JVSA 2ETCA 4CT4A 4A3TA 1NA0A 4JXTA 4J8EA 5G2NA 4JPSA 1JCSA 4HORA 3TG5A 3D9MA 3CVUA 4FADA 2XS8A 3Q4AB 3EHQA 4GTOA 3FP3A 4KBQA 5LOZA 5EX0A 2XGSA 4BT9A 3ISMC 3L6AA 2BTDA 3O4ZA 3E4BA 4BY6A 4J6IA 4YVOA 3V31A 4ILIA 5D66A 4JHKA 4U0ZA 3ZYKA 4HXIA 3JXJA 1SW6A 2I2OA 5CMWA 5CCLA 3IEGA 5JHAA 1MX4A 3CK7A 5FJYA 3DWLG 4MBGA 2XPYA 2X6JA 2IFUA 4TV3A 3AS5A 4JA9A 3TAXA 2XRZA 2X6FA 4BESA 4J8FA 5KWDA 3C3OA 4B93B 4HOSA 1OWPA 2P9KG 4LNBA 5FTPA 4U0UA 5CEDB 3V2XA 1TR4A 3RRNB 3FEYA 5AJLA 3MV2B 4JC8A 4K5AB 4ZFHA 3FTYA 3B13A 2VGEA 3DSWA 2I6HA 2I1JA 3BQOA 4R7LA 1BI7B 3ZW3A 4WNGA 3MGBA 3APCA 3ZKJA 2P2CP 3L16A 3RSEG 3ZFWA 4EPZA 2WXKA 2P58C 1HF8A 3W9FA 3FEXA 2MHKA 4NACA 3ABME 2WQ7A 3OXFA 3LVQE 2I1KA 4Q94A 2XZTG 4WNEA 3CLJA 2HM8A 4N3AA 3D9KA 4ANVA 2WXGA 2AXZA 1UG3A 4GA2A 4WUYA 3Q7AA 3S7BA 2WPVA 4V3IA 3C3QA 4ATZD 5AENA 3ASDA 2FULA 3RIBA 4ACLA 2QZAA 1QBQA 2GRQB 2Y4UA 4FJYA 1TN6A 2J8SD 1MJ0A 3I4GA 4NURA 4DX7D 4CT0A 3FWVA 4O60A 4YNDA 2LO6A 1S0PA 4LNGA 4I9CA 3S2AA 3Q5MA 4KT6B 2L0TB 3FTSA 3Q15A 4C0EA 4GMLA 4U8HA 5AN8A 1HH8A 3APDA 2P9UG 1OCZE 3EUVA 1E8XA 3CIAA 2VSYA 1TYQG 3G2VA 4XIFA 2DZNA 4L9PA 3T5VA 1D8EA 5HKPA 2XENA 3QJZA 2E2EA 3GYZA 3OXGA 3FU5A 4FULA 2P9IG 5D0QD 1AP7A 3Q9NC 4GZ5A 3HXCA 1NA3A 1NP7A 3Q49B 2CHZA 1OCRE 3UMVA 3JXIA 4U0SA 3PNTB 5AIJA 4JHRA 2YQ8A 1O1TA 3CHOA 2XCBA 2DYRE 1O5MA 1HE8A 3AAAC 4A1SA 3UIOC 5J08A 1N4QA 2C0LA 4WWOA 4J7WA 1OCCE 2EQXA 4RSYA 4TXPA 4JD2G 3AU4A 2QY7A 3ZGQA 1K8KG 4CCAA 4TUUA 3V2OA 3CVPA 3GZ1A 4OYSA 3MV3B 5HQ8A 3KEZA 4J0UA 3W9GA 4GTQA 3ASHA 2P9SG 3QNKA 3QAQA 3PUKA 1V54E 3PZ4A 5FQ7A 3UT7A 2V8SE 4ABNA 3BEEA 1UOHA 2ZGGA 1OWOA 2B6CA 3TJPA 3E37A 4I6JA 2CFZA 2WQHA 3Q75A 3U66A 1MZCA 1Y6IA 5CERB 1Z6TA 3SQVA 4DRXE 5BNWA 2P9PG 5LCWC 1E90A 2WQ6A 4EQFA 3EU5A 1FCHA 4WNDA 3L13A 5FZQA 4G25A 2MRIA 4A63B 4HRLA 4GU5A 5JHBA 3ZXPA 2VJ8A 5KJMA 2L6BA 4XKCA 2BEDA 4N3BA 5LCWJ 4LCTA 2ETBA 5A6CA 2QC9A 5C2YA 1V55E 1XNFA 3HXEA 5FQ6A 3U9WA 3FUMA 1E7UA 2IOSA 3DXMG 2WXJA 2OEWA 3CR3A 4APFA 3HXDA 1H6KA 2FO7A 4FLHA 3LJ3A 4A3VA 2X6IA 3MCXA 4ANUA 3G2WA 2R2LA 5ITZF 3CHSA 4PS8A 1UN9A 1KZPA 2A5UA 4GMJA 2WXMA 3IHYA 1QQEA 3QOUA 4HLLA 1SA4A 4AY6A 4KMOA 2UY1A 3EIQC 3Q7FA 1IYGA 4U95D 1BU9A 4J8YA 1E96B 5E76A 1H2UA 3FUJA 3D9JA 1LTXA 3TG4A 1EF1C 1HU3A 1U3CA 4HNAD 4MS6A 5EKQD 1TNUA 3T8MA 3VTYA 4DX2A 3BUAA 4OVUA 4L23A 4L2LA 4G1TA 3RRUA 5FT9A 3MX3A 2WXFA 4DUIA 1N4PA 4RLYA 1E8ZA 2WXOA 4F3VA 3D9LA 3QC1A 3SBSA 4HB5A 1IXVA 3LY8A 2PM6A 1YCSB 2Y0BG 2GRPB 4IULA 5KJLA 2EIJE 1N9AA 2DYSE 3K9IA 4GMRA 3CHQA 3IHVA 4PDXA 5CECB 1PY1A 3ZHEB 1EPUA 4LSZE 3RO2A 2GW1A 3EDTB 4BFRA 2L6JA 3DSXA 1AWCB 4Y6CA 4Q96A 4B8AA 3IXEA 2HE0A 1NFIE 4BX8A 2AVPA 3RAUA 4APOA 1OWNA 5A23A 2QYUA 5ENSD 1JCQA 4ANXA 4BT8A 2KM4A 3CVLA 2FEZA 4BX9A 1B89A 4HOUA 4OAVB 3TGOA 2CHWA 3GZSA 2F0YA 4Z68A 3G2UA 1N4SA 3ASGA 3DSSA 4N5CA 3LPZA 3VLFA 5BXOA 1MX2A 4FLBA 4JZYA 3S7JA 3D9PA 4GPKA 1WDYA 3FDHA 5FQ4A 4I1MA 4I6GA 1Z3XA 4GYWA 3UM1A 4TUMA 3EHRA 5BXUA 3UIPC 3E32A 4DPRA 3FFLA 3NZSA 5G04J 5EYLA 4F6RD 1KLXA 3CVXA 3TWVA 1Y8MA 3PEVB 3HYMB 3L9TA 4AIFA 5C1DA 4HBDA 5CBOA 3L82A 4O6FA 3TWSA 3ZNGA 3AG2E 3LS8A 2UWJG 4GZDA 2R5SA 2FBNA 3LEWA 2PNNA 3KSQA 3UQ3A 2YHCA 2VGXB 1DCQA 3ONLA 3U4TA 3JQ0A 2A4ZA 3MKQB 1QNFA 3O48A 1BD8A 4DJAA 4L1BA 1OUVA 2P9LG 3VLDA 2WB2A 4C48B 4BTAA 2IQCA 4HI9A 4JEUA 2MOWA 3E34A 2JABA 3ZHEA 3ASOE 1N52A 3B7SA 2GROB 3TXMA 2KCKA 2BUGA 4FA6A 3AS4A 5FWQA 3PE3A 2AXUA 5HS0A 1S63A 2CG2A 5DBKA 3TWRA 3CSFA 5JJTA 4AJWA 3FUIA 4L7TA 4FHJA 4RG6A 3P1UA 3UM3A 3UX4A 4JEHA 2R17C 5E75A 3UM2A 1RW2A 4HQDA 2DCPA 5HRYA 4GZ3A 3E30A 5BV0A 4AVXA 4HLEA 3ZN3A 3PZDA 4HRNA 1K1AA 1TNZA 2WXPA 2QYJA 2L0IA 1QZ2A 3JQ1A 4JHJA 5CBNA 5AJDA 4AY5A 2X38A 1HZ4A 1NL4A 3B95A 3PDNA 1N0RA 1E8WA 3UI2A 2JLBA 1GW6A 2GRMA 4F1SA 3LCAA 1KZOA 3UUXA 1JPLA 2AJAA 2CHXA 2H6IA 2ZXWE 3P2BA 4G8KA 3CQCB 2IJGX 3C5RA 4F1PA 1BPOA 3ML8A 4F7AA 4AXHA 3URZA 1H2TC 3I5PA 3FUNA 5AARA 2EINE 1TN7A 2C0MA 3FTZA 3PZ3A
chains in the Genus database with same CATH topology
4HS2A 5FQ7A 4B94A 2LNIA 3NZUA 3UT7A 2V8SE 3S7FA 1H2VC 2PL2A 1FVHA 2C2LA 4ABNA 3MJWA 3BEEA 4E6HA 2FI7A 1OWOA 2XCCA 4N2QA 3UT4A 2QFCA 1E7VA 4KYOB 4I2WA 3G2TA 2LAHA 4IN3B 1YA0A 4I2ZA 3MYVA 4I6JA 3FTXA 3TJPA 5BT1A 4EECA 3PREA 4PS3A 1SQMA 2CFZA 4H7YA 2WQHA 4ACKA 1FVFA 3B7RL 4EZLA 3U66A 4NRHB 2PZIA 5CMYA 3FU0A 1HXIA 1Y6IA 4KVOA 1Z6TA 3QARA 4I6EA 5T4YA 3FUHA 3DBSA 1H19A 4MKTA 3ZRHA 5BNWA 1MQSA 5BV1A 2KC7A 4W9RA 5LCWC 2VTBA 2VYIA 3APFA 1E90A 4HOQA 2WQ6A 3PE4A 4EQFA 3Q47B 4I9EA 1KT1A 3QWVA 2VTBB 4N39A 1KT0A 1FCHA 3EIJA 3FUFA 3L13A 3LVRE 2WXQA 1JUQA 4G25A 4WNDA 2MRIA 5FZQA 4A1GA 5BUZA 4HOTA 3MEKA 4RG9A 4HFGA 3CHMA 3CGHA 4ME2A 5BW8C 5ANLA 4CGVA 4GU5A 3SF4A 5JHBA 2VJ8A 3L08A 1OWMA 5KJMA 3HHMA 3D9OA 5FQ8A 4XKCA 1VDYA 2AW6A 4LEUA 3CK9A 4N3BA 1ZU2A 2XPZA 4HVBA 2RG8A 5LCWJ 4LCTA 3RKVA 5A7DB 1INZA 4B0ZA 3SFZA 3R7RA 5A6CA 3CSTA 5C2YA 4GYYA 3IV0A 1XNFA 4CDMA 5FQ6A 3ML9A 3ESLA 5G04C 3U9WA 2VGXA 3FUMA 2XRYA 5D0OD 4QFVA 1E7UA 2IOSA 4BSXA 4B8CB 4D10C 3ENEA 2WXJA 3CR3A 3L54A 4APFA 4I1AA 2IF4A 1H6KA 4FHKA 2FO7A 4Q69A 4FLHA 3LJ3A 4JW1A 4A3VA 1NZNA 2X6IA 3LKUA 1MHQA 3MCXA 4ANUA 3QK0A 3QKYA 3CVWA 1HG5A 3SGHA 1HX8A 3G2WA 3CHPA 3IBEA 2PM7A 1OWLA 3B7UX 3ZYQA 3SI5A 4RVBA 1EDUA 3CVQA 1A17A 2XGMA 3DPDA 3CHSA 3NF1A 4PS8A 2M63A 1UJKA 2X6KA 4UWLA 3SBTB 2OV8A 3HDXA 4DI3A 4UWHA 4F53A 2DIWA 1UN9A 4CDRA 3CQGB 2A5UA 4IRUA 4WNFA 4GMJA 2WXMA 4FJZA 3IHYA 1QQEA 3LY7A 4AV7A 3QOUA 4H7XA 3MA5A 4E85A 3RK6A 1X5BA 2WXNA 3MZLB 4AY6A 2GRLA 4KMOA 2UY1A 3EIQC 1IYGA 5EX3A 5DIZA 3AU5A 3ULQA 4FP7A 4P29A 3ZVVA 5G55A 3R9AB 4C0MA 4AEZC 3BG1B 5FZSA 1E96B 5EDSA 5E76A 2KZTA 3G2SA 4Y6WA 1H2UA 2J9QA 1Z3YA 3FH7A 4JVSA 3FUJA 3CV0A 3D9JA 4I1OB 4UWGA 4A3TA 4CT4A 1NA0A 4JXTA 4CDNA 1IHGA 3TG4A 1EF1C 3LDZA 2WMOA 1H0AA 4J8EA 1HU3A 4KZ0A 5G2NA 3U3WA 1U3CA 4KZCA 2I9CA 4MS6A 5EKQD 4G26A 4JPSA 3T8MA 4KXKB 3VTYA 2HYZA 2VSNA 4HORA 4OVUA 3TG5A 3D9MA 3CVUA 4L23A 2RD0A 4FADA 4L2LA 2HO1A 4G1TA 3FTVA 2Q7FA 3RRUA 3Q4AB 5FT9A 5ANRA 2XGOA 3MX3A 4CEMA 2WXFA 3ZXSA 2VQ2A 3FP3A 4KBQA 5LOZA 1TEZA 5EX0A 4EBAA 2XGSA 4BT9A 1E8ZA 3L6AA 2AWIA 2BTDA 2WXOA 4MLPA 4F3VA 3D9LA 5HI7A 3C98A 3QC1A 3SBSA 3O4ZA 3LY8A 2PM6A 2VSXE 3I4RB 3PNLB 1XGWA 3E4BA 4IULA 4BY6A 4J6IA 4YVOA 5KJLA 5T3RA 4ILIA 2XPIA 3FHEA 4JHKA 3AS8A 3K9IA 4EZKA 2PQNA 3IKOB 3CHQA 1TJCA 3IHVA 4U0ZA 4C9BB 4PDXA 3SHFA 3ZYKA 2KZTB 4HXIA 4L2YA 1PY1A 4AM9A 1UW4B 2KATA 2I2OA 5CMWA 5CCLA 3ZHEB 3IEGA 1EPUA 4XKBA 1IQUA 5J90A 1WY6A 5JHAA 1JWFA 1N54A 3FY4A 3RO2A 4B89A 2GW1A 3SZ7A 3KD7A 3CK7A 3EDTB 3HVEA 2XQ0A 4OVVA 2J07A 5FJYA 4BFRA 2L6JA 4PUCA 2XPYA 3FUKA 3FUDA 4Q96A 4Y6CA 2X6JA 2IFUA 4TV3A 4B8AA 1UN8A 5KCMA 3AS5A 4JA9A 3TAXA 5LP0A 2KCVA 2X6HA 4XX5A 4BX8A 5LFAA 2XRZA 2X6FA 2AVPA 4APOA 3CHRA 5ENNA 1OWNA 5A23A 1ELRA 4J8FA 4I43A 5CHEE 3ONKA 4HOSA 4ANXA 4BT8A 2ONDA 4ILHB 3RJVA 1OWPA 5ARGA 2R59A 1JWGA 2KM4A 2CFUA 3CVLA 5FTPA 4GA1A 2FEZA 3OXLA 4BX9A 1B89A 4U0UA 4HOUA 4DK5A 3RO3A 2GGFA 3TGOA 2CHWA 3GZSA 2J09A 3RRNB 3FEYA 5AJLA 3JYSA 2J49A 2HR2A 2LAIA 3KS2A 3LYAA 4K03A 3G2UA 4JA7A 3MV2B 5ARFA 3RU0A 2V4LA 4I17A 4JC8A 3FTUA 2NC9A 3NQPA 3D9IA 5FZRA 3ASGA 3FTYA 4N5CA 2OVFA 3LPZA 3VLFA 3B13A 3EJNA 1ZBPA 2LSVA 1UJJA 4FLBA 4JZYA 3S7JA 4U04A 3D9PA 4NQ0A 3GW4A 3BG0B 2UY1B 4UI9J 4GPKA 2AXVA 3FDHA 4G23A 5FQ4A 4G2VA 2I6HA 2I1JA 4AOFA 3CEQA 4I1MA 4I6GA 4R7LA 1Z3XA 3ZW3A 4WNGA 4G24A 4GYWA 2CG3A 3FTWA 1DVPA 3CVVA 3MGBA 4LUNU 3APCA 3L16A 4UI9C 3ZFWA 4EPZA 2WXKA 3FU6A 2P58C 2YINA 1HF8A 4DPRA 3UPVA 3FFLA 3NZSA 2X3MA 3TL5A 3ZYLA 3R7QA 3FEXA 4UWFA 2MHKA 4GCOA 4NACA 5KJKA 3PRZA 2WQ7A 4UQXA 3OXFA 4AP2A 3LVQE 3PH0C 5G04J 2I1KA 4Q94A 2ZU6B 1KLXA 3T5XA 3CVXA 4WNEA 3CK8A 4PS7A 4EBAG 1Y8MA 5T8IA 4DLQA 3PEVB 3HYMB 3EHMA 2Y3AA 4WWPA 3CLJA 4MRUA 2HM8A 4N3AA 4AIFA 3D9KA 3FH5A 4ANVA 2Y4TA 2WXGA 3OAWA 5C1DA 3PS6A 3LY9A 2NXPA 2AXZA 4GZ6A 1UG3A 3LXUX 3QWPA 4O6FA 3OTNA 4GA2A 5KJNA 4WUYA 4A55A 2E0IA 4FU3A 3S7BA 2WPVA 4V3IA 5AYWD 3LS8A 2UWJG 4GZDA 3PVLA 4U63A 3RRMB 3ESKA 1SZAA 2DBAA 2WXHA 2WXIA 1DNPA 2R5SA 3JCKC 2FBNA 2WM9A 3LEWA 5AENA 4WWNA 3UQ3A 2YHCA 2VGXB 4IYPA 3ASDA 3ONLA 3U4TA 2FULA 4GYOA 3RIBA 3VLEA 4J8SA 4XI0A 4ACLA 3JQ0A 2A4ZA 1E8YA 2L9BA 2Y4UA 4FJYA 4XE0A 3MKQB 4FC8A 3ZEFA 1QNFA 4URKA 3O48A 3UT8A 3I4GA 4NURA 4CRWA 2YNQA 4CT0A 4DJAA 4L1BA 1OUVA 3QB2A 3FWVA 4YNDA 2OOEA 2BF0X 2LO6A 5BPPA 3L17A 5G05J 1S0PA 4J8DA 4I9CA 3S2AA 2IOLA 3VLDA 4BTBA 1L5JA 4K0RA 2WB2A 3Q5MA 1ELWA 4KT6B 4XZ4A 2L0TB 4GCNA 2KCLA 3FTSA 3Q15A 1W3BA 4BTAA 4C0EA 3D3MA 3CVYA 4GMLA 2FF4A 2IQCA 4U8HA 4M3OA 1HG2A 2MOWA 2WMNA 1HH8A 4JEUA 4YVQC 3ZHEA 2PQRA 3APDA 4N3CA 1N52A 3B7SA 3JUIA 1E8XA 3CIAA 3HIZA 4N2SA 2VSYA 1WM5A 3HVEB 3TXMA 2KCKA 3G2VA 4XIFA 5G05C 2BUGA 2WXRA 4U07A 2WVIA 1EYHA 2JEKA 4FA6A 3AS4A 4CGWA 3T5VA 5FWQA 3PE3A 4UQZA 2IONA 4UWKA 2V0PA 3I3NA 2AXUA 2J4DA 3QJZA 2CG2A 3VTXA 2E2EA 5DBKA 3GYZA 3CSFA 5JJTA 4WAFA 2ILRA 3FUIA 3OXGA 4AJWA 3FU5A 4FULA 3L22A 4L7TA 5D0QD 3QWWA 4FHJA 4GZ5A 3P1UA 4RG6A 2J08A 3UX4A 3QDNA 4JEHA 1NA3A 1NP7A 2R17C 3Q49B 1HFAA 5E75A 1IQRA 4GB9A 2NSZA 3SNXA 2CHZA 2VSOE 2XEVA 2DCPA 5CCMA 2LSUA 5JJ6A 3KAEA 4U0SA 3UMVA 4DLOA 4GZ3A 1WAO1 3PNTB 5AIJA 3CKCA 5BV0A 1TJFA 1ELKA 4JHRA 1P5QA 4AVXA 3ZYMA 2YQ8A 3CHOA 2XCBA 3ZIMA 4TRQA 4UQYA 4HLEA 3FULA 3ZN3A 3PZDA 3EHNA 4XI9A 3CVNA 1HE8A 3MKRA 5JJ7A 4A1SA 2WXPA 4JL0A 3N71A 2XHEA 2L0IA 3ZPJA 1QZ2A 3JQ1A 1LF8A 4JHJA 5J08A 3U64A 4ILGA 3WXXA 2C0LA 5AJDA 4ATGA 2J4BA 3GZ2A 4AY5A 2X38A 1HZ4A 1PC2A 2WXLA 3PDNA 1U3DA 4WWOA 1E8WA 3PEUB 5LX8A 2EQXA 2JLBA 1GW6A 2GRMA 4F1SA 5M72A 3FUEA 2YHEA 1HO8A 3LCAA 4RSYA 4BWRA 2CHXA 1JPLA 3UUXA 3PUJA 4EZJA 2VGYA 3AU4A 2QY7A 3P2BA 4ANWA 3ZGQA 4KVMA 3CQCB 4CCAA 3ASFA 3FH8A 3CKBA 2IJGX 4GAAA 3TXNA 3D9NA 4TUUA 1BPOA 3MKQA 1SZ9A 3CVPA 3ML8A 1HS6A 4F7AA 3GZ1A 4LERA 3S7DA 1PAQA 4OYSA 3MV3B 5HQ8A 4G11A 4AXHA 2IU1A 1H2TC 2OVBA 3I5PA 3KEZA 4GA0A 3FUNA 4J0UA 3SD5A 3URZA 3ASHA 4PH4B 4DI4A 2C0MA 3QNKA 3FTZA 3QAQA 3FU3A 4GZCA 3PUKA 4UI9K 2V5FA 3B7TA 4LRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3B A;  2NC9 A;  4BTA A;  4B94 A;  5EX3 A;  2LNI A;  1IYG A;  2FF4 A;  5DIZ A;  3ASG A;  4N5C A;  5FZR A;  3LPZ A;  3ULQ A;  3S7F A;  3ZHE A;  1HH8 A;  4YVQ C;  2PL2 A;  2PQR A;  3R9A B;  2C2L A;  4ABN A;  4N3C A;  1ZBP A;  2LSV A;  3BEE A;  4N2S A;  2FI7 A;  1WM5 A;  2VSY A;  5FZS A;  4U04 A;  3S7J A;  1E96 B;  2KCK A;  2XCC A;  4NQ0 A;  4XIF A;  3GW4 A;  4N2Q A;  5G05 C;  4GPK A;  2BUG A;  2QFC A;  2J9Q A;  2UY1 B;  4I17 A;  4G23 A;  4KYO B;  4U07 A;  4UI9 J;  3CV0 A;  2I6H A;  4G2V A;  4I2W A;  5M72 A;  1NA0 A;  4IN3 B;  1YA0 A;  3AS4 A;  4I2Z A;  4CGW A;  1IHG A;  5BT1 A;  3TG4 A;  3U3W A;  4J8E A;  3CEQ A;  3PE3 A;  4UQZ A;  4H7Y A;  2WQH A;  4WNG A;  5EKQ D;  4G24 A;  4G26 A;  4GYW A;  4KXK B;  2PZI A;  4NRH B;  3VTX A;  2E2E A;  1HXI A;  2HYZ A;  2VSN A;  5DBK A;  3VTY A;  3TG5 A;  4HOR A;  3GYZ A;  5JJT A;  2HO1 A;  4G1T A;  3OXG A;  2Q7F A;  3Q15 A;  5D0Q D;  3Q4A B;  3QWW A;  5FT9 A;  2XGO A;  5BNW A;  4GZ5 A;  4RG6 A;  4UI9 C;  2VQ2 A;  3FP3 A;  4KBQ A;  3ZFW A;  2P58 C;  3QDN A;  5EX0 A;  2KC7 A;  1NA3 A;  4W9R A;  2XGS A;  3FFL A;  2VYI A;  3Q49 B;  4BT9 A;  5LCW C;  3UPV A;  4HOQ A;  4Y6W A;  2MHK A;  3PE4 A;  4GCO A;  4EQF A;  3Q47 B;  4F3V A;  4I9E A;  5KJK A;  4UQX A;  2XEV A;  3OXF A;  5CCM A;  2LSU A;  1KT1 A;  3QWV A;  5HI7 A;  4N39 A;  1KT0 A;  5G04 J;  5JJ6 A;  3KAE A;  1FCH A;  3LY8 A;  4U0S A;  4WND A;  4GZ3 A;  1WAO 1;  4G25 A;  5FZQ A;  4HOT A;  1KLX A;  3CKC A;  3MEK A;  4RG9 A;  3E4B A;  4ME2 A;  3CK8 A;  4JHR A;  4WNE A;  4YVO A;  1P5Q A;  1Y8M A;  5BW8 C;  5KJL A;  2YQ8 A;  2XPI A;  3HYM B;  4CGV A;  3SF4 A;  2XCB A;  4UQY A;  3AS8 A;  3K9I A;  5KJM A;  2PQN A;  4N3A A;  4U0Z A;  1TJC A;  3ZN3 A;  4XI9 A;  4AIF A;  4LEU A;  3CVN A;  2Y4T A;  3CK9 A;  1ZU2 A;  3MKR A;  4N3B A;  4AM9 A;  5JJ7 A;  5LCW J;  3RKV A;  5A7D B;  2KAT A;  3LY9 A;  4JL0 A;  4A1S A;  5C1D A;  3N71 A;  4GZ6 A;  3ZPJ A;  1QZ2 A;  5A6C A;  4GYY A;  3QWP A;  5CCL A;  1XNF A;  3ZHE B;  3IEG A;  4O6F A;  5G04 C;  4GA2 A;  5KJN A;  2VGX A;  3WXX A;  4WUY A;  2C0L A;  5D0O D;  3GZ2 A;  4AY5 A;  3RO2 A;  3S7B A;  1HZ4 A;  1PC2 A;  2GW1 A;  2WPV A;  3KD7 A;  3CK7 A;  3EDT B;  3PDN A;  3SZ7 A;  5AYW D;  2UWJ G;  5FJY A;  2L6J A;  3ESK A;  2DBA A;  4I1A A;  2IF4 A;  4Y6C A;  2IFU A;  2FO7 A;  2JLB A;  2R5S A;  2FBN A;  3AS5 A;  4JA9 A;  1NZN A;  3TAX A;  3UQ3 A;  2KCV A;  3LCA A;  3LKU A;  2YHC A;  4BWR A;  2VGX B;  3UUX A;  2AVP A;  2VGY A;  3ASD A;  3U4T A;  4APO A;  4GYO A;  3RIB A;  4XI0 A;  1ELR A;  2Y4U A;  3QKY A;  4J8F A;  3ZGQ A;  5CHE E;  3ASF A;  4HOS A;  3CKB A;  3O48 A;  4BT8 A;  2OND A;  3RJV A;  2UY1 A;  5ARG A;  3CVQ A;  1A17 A;  2XGM A;  3CVP A;  3CVL A;  4GA1 A;  2FEZ A;  3NF1 A;  1OUV A;  3GZ1 A;  3OXL A;  1B89 A;  5FTP A;  4U0U A;  3S7D A;  4HOU A;  3MV3 B;  5HQ8 A;  3FWV A;  4YND A;  2OOE A;  3RO3 A;  3URZ A;  4WNF A;  4GA0 A;  4J0U A;  4CDR A;  3TGO A;  5G05 J;  3LY7 A;  1QQE A;  3JYS A;  3ASH A;  4I9C A;  4J8D A;  4BTB A;  3QOU A;  2HR2 A;  3MA5 A;  4H7X A;  2C0M A;  3KS2 A;  3LYA A;  4JA7 A;  3MV2 B;  3Q5M A;  1ELW A;  4UI9 K;  5ARF A;  4AY6 A;  3RU0 A;  4GCN A;  2V5F A;  2KCL A; 
#chains in the Genus database with same CATH topology
 5EN5 D;  1H2V C;  2C2L A;  4E6H A;  5EID A;  2XCC A;  4I2Z A;  1DCE A;  1YA0 A;  4EEC A;  4PS3 A;  1SQM A;  4H7Y A;  4ACK A;  1FVF A;  4EZL A;  4NRH B;  5CMY A;  3FU0 A;  1FT2 A;  4KVO A;  4O1O A;  1OCO E;  4I6E A;  4YDY A;  5T4Y A;  3FUH A;  1H19 A;  2KXP C;  3ZRH A;  3HG0 D;  2R05 A;  2KC7 A;  3APF A;  4N39 A;  2XZD G;  3LVR E;  4XEI G;  4HFG A;  3CGH A;  3D9O A;  5FIN A;  3Q78 A;  1ZU2 A;  2XPZ A;  2RG8 A;  1INZ A;  5A7D B;  3HXB A;  2P9N G;  4GYY A;  2GRR B;  4HRM B;  2XRY A;  3ENE A;  2IF4 A;  2IEJ A;  4Q69 A;  4JW1 A;  3X2Q E;  3LKU A;  1DC2 A;  2DWZ A;  3TWW A;  1N4R A;  1HX8 A;  2PM7 A;  4X8Q A;  1LD7 A;  1A17 A;  3NF1 A;  2M63 A;  1UJK A;  2OV8 A;  3HDX A;  4DI3 A;  5ENP D;  4F53 A;  2DIW A;  4WNF A;  4IRU A;  3LY7 A;  4E85 A;  3MA5 A;  3ULQ A;  3AU5 A;  5JA4 D;  3R9A B;  3BG1 B;  4GTV A;  2KZT A;  1U2V G;  1FT1 A;  4I1O B;  3CV0 A;  4UWG A;  5AQB A;  4CDN A;  4KZ0 A;  4KZC A;  2I9C A;  4KXK B;  2VSN A;  2RD0 A;  3FTV A;  2Q7F A;  1K3Z D;  2XGO A;  5KBA A;  2ZIS A;  1X81 A;  3ZXS A;  1IKN D;  4MLP A;  3SY2 A;  5HI7 A;  3I4R B;  3PNL B;  1XGW A;  4GTP A;  5T3R A;  2XPI A;  3FHE A;  3AS8 A;  4EZK A;  2PQN A;  3IKO B;  1TJC A;  3UTM A;  4L2Y A;  4AM9 A;  1IQU A;  3R9M A;  2XS1 A;  1N54 A;  3FY4 A;  3NOG D;  3HVE A;  2XQ0 A;  2J07 A;  3FUK A;  3FUD A;  2EIK E;  1UN8 A;  3T9K A;  3TWT A;  4XX5 A;  5ENN A;  5CRV A;  1ELR A;  3PZ1 A;  4I43 A;  2RKK A;  5CHE E;  1TN8 A;  2OND A;  2R59 A;  1JWG A;  3DRA A;  2CFU A;  1OY3 D;  3ULE G;  2DVW A;  2GGF A;  2J09 A;  4DX6 D;  3KS2 A;  4K03 A;  3FTU A;  3NQP A;  3EJN A;  2LSV A;  1UJJ A;  3J5Q B;  4NQ0 A;  3BG0 B;  4UI9 J;  1RZ4 A;  2AXV A;  1N11 A;  1YMP A;  4G2V A;  5B3S E;  4OAU C;  3CVV A;  4UI9 C;  2YIN A;  2X3M A;  3TL5 A;  3ZYL A;  4UWF A;  5KJK A;  4UQX A;  4LG6 A;  5B1A E;  4AP2 A;  2DZO A;  2LXM A;  3DPY A;  3CK8 A;  4PS7 A;  2EIL E;  4WWP A;  1OXJ A;  4MRU A;  3SFY A;  3FH5 A;  2Y4T A;  3OAW A;  2NXP A;  5CEA A;  4GZ6 A;  1JCR A;  5KJN A;  4DX5 D;  5AYW D;  3B7B A;  3PVL A;  3RRM B;  2DBA A;  3JCK C;  4WWN A;  4GYO A;  4J8S A;  5KNG A;  4U8Y D;  1E8Y A;  4FC8 A;  2A5E A;  3UT8 A;  2YNQ A;  3NBN B;  5BPP A;  4K0R A;  1ELW A;  4XZ4 A;  1SA5 A;  2KCL A;  3LJN A;  1N94 A;  2FF4 A;  4M3O A;  1HG2 A;  2WMN A;  4YVQ C;  2IY0 C;  3HIZ A;  4N2S A;  1WM5 A;  1MYO A;  5H7P A;  2WXR A;  4U07 A;  1EYH A;  2JEK A;  3AJI A;  3I3N A;  2J4D A;  3VTX A;  3ULY A;  2ILR A;  4RQI A;  1NI1 A;  2J08 A;  1S70 B;  1HFA A;  1IQR A;  2NSZ A;  3SNX A;  2VSO E;  5CCM A;  3NAW A;  3KAE A;  1WAO 1;  2Y1L E;  4M7C A;  5CRU A;  1TJF A;  3ZYM A;  4TRQ A;  3FUL A;  3CVN A;  4JL0 A;  3N71 A;  1LF8 A;  4DX1 A;  2J4B A;  1LD8 A;  3V30 A;  5LX8 A;  5M72 A;  3ABL E;  1HO8 A;  4BWR A;  3ZU7 B;  4EZJ A;  1S64 A;  4KVM A;  3FH8 A;  1K1B A;  1BLX B;  1SZ9 A;  4LER A;  4G11 A;  2IU1 A;  2OVB A;  4GA0 A;  4JB8 P;  4PH4 B;  4DI4 A;  4ZHB A;  3FU3 A;  4UI9 K;  3B7T A;  4LRZ A;  4QQI A;  2LNI A;  2RFA A;  3S7F A;  2PL2 A;  1FVH A;  3MJW A;  2FI7 A;  4N2Q A;  3UKR G;  4K5B A;  3UT4 A;  1E7V A;  2LAH A;  4GTT A;  4IN3 B;  2F8Y A;  5ENR D;  3DBS A;  4MKT A;  3TWQ A;  1BI8 B;  3PE4 A;  3Q47 B;  4NIK A;  3QWV A;  1KT0 A;  3TWX A;  2WXQ A;  4A1G A;  5EIB E;  4HOT A;  3MEK A;  4RG9 A;  4ME2 A;  3SF4 A;  4U96 D;  4LEU A;  2AW6 A;  3KSL A;  3CK9 A;  3Q79 A;  3CVW A;  3SFZ A;  3NOC D;  3CST A;  3IV0 A;  5G04 C;  3ESL A;  2VGX A;  5D0O D;  5IY5 E;  4B8C B;  2H6H A;  4FHK A;  1NZN A;  5ENT D;  3DSU A;  3DSV A;  5JMN D;  3QK0 A;  3QKY A;  2R02 A;  3IBE A;  3Q73 A;  1OWL A;  3AG1 E;  3ZYQ A;  2X6K A;  1TNY A;  4UWH A;  4CDR A;  3CQG B;  5LP0 A;  2GRN B;  4FJZ A;  1SVX A;  4H7X A;  3RK6 A;  2RFM A;  3MZL B;  3SO8 A;  5EX3 A;  5DIZ A;  4P29 A;  2F37 A;  5EDS A;  3FH7 A;  2J9Q A;  1Z3Y A;  1FPP A;  1IHG A;  3U3W A;  3LDZ A;  2WMO A;  1H0A A;  3Q9U C;  4BET A;  2ETA A;  4G26 A;  2IO3 C;  2HYZ A;  5AAO A;  5D2M C;  2HO1 A;  5ANR A;  4CEM A;  2VQ2 A;  1TEZ A;  1G3N B;  4EBA A;  4CZ2 D;  2AWI A;  3UM0 A;  3V79 K;  3C98 A;  2VSX E;  1O1S A;  4C9B B;  3SHF A;  2KZT B;  1ZB1 A;  1UW4 B;  2KAT A;  2Y69 E;  3ZUV B;  1KPS B;  4XKB A;  5J90 A;  1D8D A;  1WY6 A;  4TXQ A;  1JWF A;  4B89 A;  3SZ7 A;  3KD7 A;  4OVV A;  4PUC A;  2IO2 C;  5KCM A;  2KCV A;  2X6H A;  5LFA A;  3CHR A;  4CYM D;  3ONK A;  4ILH B;  3RJV A;  5ARG A;  4GA1 A;  3OXL A;  1H6O A;  4UUC A;  4DK5 A;  3RO3 A;  1O1R A;  3JYS A;  2J49 A;  2HR2 A;  2LAI A;  3LYA A;  4JA7 A;  5ARF A;  3RU0 A;  2V4L A;  4I17 A;  3BU8 A;  2NC9 A;  3D9I A;  4YDO A;  5FZR A;  2OVF A;  1ZBP A;  3UIN C;  3UXG A;  3EU9 A;  4U04 A;  5EIL A;  3GW4 A;  2UY1 B;  4G23 A;  4LNU D;  4AOF A;  3CEQ A;  2LXL A;  1H6P A;  4G24 A;  2KBX A;  2CG3 A;  3FTW A;  4GTR A;  1DVP A;  4LUN U;  3SFX A;  3FU6 A;  3UPV A;  3R7Q A;  4GCO A;  3PRZ A;  3PH0 C;  1N0Q A;  3T8K A;  2ZU6 B;  3T5X A;  4EBA G;  1Q2Z A;  5T8I A;  4DLQ A;  3C72 A;  3EHM A;  2Y3A A;  2F8X K;  3AG4 E;  3PS6 A;  3LY9 A;  1OT8 A;  2ZIR A;  3LXU X;  3QWP A;  3OTN A;  4A55 A;  1Z5S C;  2E0I A;  4FU3 A;  4EHM A;  2BKK B;  2H6G A;  4U63 A;  3ESK A;  1SZA A;  2WXH A;  2WXI A;  1DNP A;  2WM9 A;  1YYH A;  4IYP A;  4U7E B;  3VLE A;  4XI0 A;  5B1B E;  2L9B A;  4XE0 A;  3ZEF A;  2B0O E;  4URK A;  2EIM E;  3D9H A;  4CRW A;  2H6F A;  3QB2 A;  2OOE A;  2BF0 X;  3L17 A;  5G05 J;  4J8D A;  2IOL A;  4O1P A;  4BTB A;  1L5J A;  4GCN A;  1W3B A;  3D3M A;  3CVY A;  4TXR A;  1TNB A;  2PQR A;  4N3C A;  3JUI A;  3HVE B;  5G05 C;  2WVI A;  4CGW A;  2ZGD A;  3AG3 E;  4UQZ A;  2ION A;  2XEE A;  4UWK A;  2V0P A;  5ENO D;  5AQA A;  4WAF A;  3HXF A;  3DEO A;  3L22 A;  3DST A;  3QWW A;  3QDN A;  4GB9 A;  3DXK G;  2XEV A;  4GPM A;  2MYO A;  2LSU A;  5JJ6 A;  4DLO A;  5EYP F;  3CKC A;  3TWU A;  1ELK A;  5ENQ D;  1P5Q A;  2V4H C;  3ZIM A;  4UQY A;  3JUE A;  5AQ7 A;  3EHN A;  4XI9 A;  3HRA A;  3MKR A;  5AQ9 A;  5JJ7 A;  2XHE A;  2V5Q C;  3ZPJ A;  3U64 A;  4ILG A;  3J5P A;  4U8V D;  3WXX A;  4ATG A;  3GZ2 A;  1PC2 A;  2WXL A;  1U3D A;  4BER A;  4BSZ B;  3PEU B;  3FUE A;  2YHE A;  1IHB A;  1D9S A;  3PUJ A;  2VGY A;  4ANW A;  3ASF A;  3CKB A;  4GAA A;  3D9N A;  3MKQ A;  1HS6 A;  4HI8 A;  3WG7 E;  3S7D A;  1PAQ A;  3SD5 A;  4BEP A;  4GZC A;  2V5F A;  4HS2 A;  4B94 A;  1N95 A;  1TNO A;  3NZU A;  4GTS A;  1MX6 A;  3NB2 A;  2QFC A;  4KYO B;  4I2W A;  3G2T A;  3MYV A;  3FTX A;  5BT1 A;  3PRE A;  3B7R L;  3ASN E;  3KEA A;  2PZI A;  1HXI A;  2BKG A;  3QAR A;  1MQS A;  5BV1 A;  4W9R A;  2VTB A;  2VYI A;  4HOQ A;  4I9E A;  1KT1 A;  2VTB B;  3FUF A;  3EIJ A;  2XEH A;  1JUQ A;  3ABK E;  4YDE A;  5BUZ A;  3CHM A;  5BW8 C;  5ANL A;  4CGV A;  3L08 A;  1OWM A;  3C3R A;  3HHM A;  5FQ8 A;  1VDY A;  2OEV A;  4GTM A;  4HVB A;  3RKV A;  4B0Z A;  3R7R A;  4CDM A;  3ML9 A;  4G8L A;  2OCC E;  4QFV A;  4BSX A;  4D10 C;  3L54 A;  4I1A A;  2NYJ A;  4YDW A;  1MHQ A;  5FIO A;  1QYM A;  1HG5 A;  3DEP A;  3SGH A;  3CHP A;  3E33 A;  3B7U X;  3SI5 A;  4RVB A;  1EDU A;  3CVQ A;  2XGM A;  3DPD A;  4UWL A;  3SBT B;  3F6Q A;  3TXN A;  4AV7 A;  4K5C A;  1A5E A;  1X5B A;  2WXN A;  4N5Q A;  5KNH D;  2GRL A;  1WG0 A;  3PZ2 A;  4FP7 A;  3ZVV A;  5G55 A;  2R03 A;  4C0M A;  4AEZ C;  2LUH A;  5FZS A;  3UKU G;  3G2S A;  2FO1 E;  4Y6W A;  4JVS A;  2ETC A;  4CT4 A;  4A3T A;  1NA0 A;  4JXT A;  4J8E A;  5G2N A;  4JPS A;  1JCS A;  4HOR A;  3TG5 A;  3D9M A;  3CVU A;  4FAD A;  2XS8 A;  3Q4A B;  3EHQ A;  4GTO A;  3FP3 A;  4KBQ A;  5LOZ A;  5EX0 A;  2XGS A;  4BT9 A;  3ISM C;  3L6A A;  2BTD A;  3O4Z A;  3E4B A;  4BY6 A;  4J6I A;  4YVO A;  3V31 A;  4ILI A;  5D66 A;  4JHK A;  4U0Z A;  3ZYK A;  4HXI A;  3JXJ A;  1SW6 A;  2I2O A;  5CMW A;  5CCL A;  3IEG A;  5JHA A;  1MX4 A;  3CK7 A;  5FJY A;  3DWL G;  4MBG A;  2XPY A;  2X6J A;  2IFU A;  4TV3 A;  3AS5 A;  4JA9 A;  3TAX A;  2XRZ A;  2X6F A;  4BES A;  4J8F A;  5KWD A;  3C3O A;  4B93 B;  4HOS A;  1OWP A;  2P9K G;  4LNB A;  5FTP A;  4U0U A;  5CED B;  3V2X A;  1TR4 A;  3RRN B;  3FEY A;  5AJL A;  3MV2 B;  4JC8 A;  4K5A B;  4ZFH A;  3FTY A;  3B13 A;  2VGE A;  3DSW A;  2I6H A;  2I1J A;  3BQO A;  4R7L A;  1BI7 B;  3ZW3 A;  4WNG A;  3MGB A;  3APC A;  3ZKJ A;  2P2C P;  3L16 A;  3RSE G;  3ZFW A;  4EPZ A;  2WXK A;  2P58 C;  1HF8 A;  3W9F A;  3FEX A;  2MHK A;  4NAC A;  3ABM E;  2WQ7 A;  3OXF A;  3LVQ E;  2I1K A;  4Q94 A;  2XZT G;  4WNE A;  3CLJ A;  2HM8 A;  4N3A A;  3D9K A;  4ANV A;  2WXG A;  2AXZ A;  1UG3 A;  4GA2 A;  4WUY A;  3Q7A A;  3S7B A;  2WPV A;  4V3I A;  3C3Q A;  4ATZ D;  5AEN A;  3ASD A;  2FUL A;  3RIB A;  4ACL A;  2QZA A;  1QBQ A;  2GRQ B;  2Y4U A;  4FJY A;  1TN6 A;  2J8S D;  1MJ0 A;  3I4G A;  4NUR A;  4DX7 D;  4CT0 A;  3FWV A;  4O60 A;  4YND A;  2LO6 A;  1S0P A;  4LNG A;  4I9C A;  3S2A A;  3Q5M A;  4KT6 B;  2L0T B;  3FTS A;  3Q15 A;  4C0E A;  4GML A;  4U8H A;  5AN8 A;  1HH8 A;  3APD A;  2P9U G;  1OCZ E;  3EUV A;  1E8X A;  3CIA A;  2VSY A;  1TYQ G;  3G2V A;  4XIF A;  2DZN A;  4L9P A;  3T5V A;  1D8E A;  5HKP A;  2XEN A;  3QJZ A;  2E2E A;  3GYZ A;  3OXG A;  3FU5 A;  4FUL A;  2P9I G;  5D0Q D;  1AP7 A;  3Q9N C;  4GZ5 A;  3HXC A;  1NA3 A;  1NP7 A;  3Q49 B;  2CHZ A;  1OCR E;  3UMV A;  3JXI A;  4U0S A;  3PNT B;  5AIJ A;  4JHR A;  2YQ8 A;  1O1T A;  3CHO A;  2XCB A;  2DYR E;  1O5M A;  1HE8 A;  3AAA C;  4A1S A;  3UIO C;  5J08 A;  1N4Q A;  2C0L A;  4WWO A;  4J7W A;  1OCC E;  2EQX A;  4RSY A;  4TXP A;  4JD2 G;  3AU4 A;  2QY7 A;  3ZGQ A;  1K8K G;  4CCA A;  4TUU A;  3V2O A;  3CVP A;  3GZ1 A;  4OYS A;  3MV3 B;  5HQ8 A;  3KEZ A;  4J0U A;  3W9G A;  4GTQ A;  3ASH A;  2P9S G;  3QNK A;  3QAQ A;  3PUK A;  1V54 E;  3PZ4 A;  5FQ7 A;  3UT7 A;  2V8S E;  4ABN A;  3BEE A;  1UOH A;  2ZGG A;  1OWO A;  2B6C A;  3TJP A;  3E37 A;  4I6J A;  2CFZ A;  2WQH A;  3Q75 A;  3U66 A;  1MZC A;  1Y6I A;  5CER B;  1Z6T A;  3SQV A;  4DRX E;  5BNW A;  2P9P G;  5LCW C;  1E90 A;  2WQ6 A;  4EQF A;  3EU5 A;  1FCH A;  4WND A;  3L13 A;  5FZQ A;  4G25 A;  2MRI A;  4A63 B;  4HRL A;  4GU5 A;  5JHB A;  3ZXP A;  2VJ8 A;  5KJM A;  2L6B A;  4XKC A;  2BED A;  4N3B A;  5LCW J;  4LCT A;  2ETB A;  5A6C A;  2QC9 A;  5C2Y A;  1V55 E;  1XNF A;  3HXE A;  5FQ6 A;  3U9W A;  3FUM A;  1E7U A;  2IOS A;  3DXM G;  2WXJ A;  2OEW A;  3CR3 A;  4APF A;  3HXD A;  1H6K A;  2FO7 A;  4FLH A;  3LJ3 A;  4A3V A;  2X6I A;  3MCX A;  4ANU A;  3G2W A;  2R2L A;  5ITZ F;  3CHS A;  4PS8 A;  1UN9 A;  1KZP A;  2A5U A;  4GMJ A;  2WXM A;  3IHY A;  1QQE A;  3QOU A;  4HLL A;  1SA4 A;  4AY6 A;  4KMO A;  2UY1 A;  3EIQ C;  3Q7F A;  1IYG A;  4U95 D;  1BU9 A;  4J8Y A;  1E96 B;  5E76 A;  1H2U A;  3FUJ A;  3D9J A;  1LTX A;  3TG4 A;  1EF1 C;  1HU3 A;  1U3C A;  4HNA D;  4MS6 A;  5EKQ D;  1TNU A;  3T8M A;  3VTY A;  4DX2 A;  3BUA A;  4OVU A;  4L23 A;  4L2L A;  4G1T A;  3RRU A;  5FT9 A;  3MX3 A;  2WXF A;  4DUI A;  1N4P A;  4RLY A;  1E8Z A;  2WXO A;  4F3V A;  3D9L A;  3QC1 A;  3SBS A;  4HB5 A;  1IXV A;  3LY8 A;  2PM6 A;  1YCS B;  2Y0B G;  2GRP B;  4IUL A;  5KJL A;  2EIJ E;  1N9A A;  2DYS E;  3K9I A;  4GMR A;  3CHQ A;  3IHV A;  4PDX A;  5CEC B;  1PY1 A;  3ZHE B;  1EPU A;  4LSZ E;  3RO2 A;  2GW1 A;  3EDT B;  4BFR A;  2L6J A;  3DSX A;  1AWC B;  4Y6C A;  4Q96 A;  4B8A A;  3IXE A;  2HE0 A;  1NFI E;  4BX8 A;  2AVP A;  3RAU A;  4APO A;  1OWN A;  5A23 A;  2QYU A;  5ENS D;  1JCQ A;  4ANX A;  4BT8 A;  2KM4 A;  3CVL A;  2FEZ A;  4BX9 A;  1B89 A;  4HOU A;  4OAV B;  3TGO A;  2CHW A;  3GZS A;  2F0Y A;  4Z68 A;  3G2U A;  1N4S A;  3ASG A;  3DSS A;  4N5C A;  3LPZ A;  3VLF A;  5BXO A;  1MX2 A;  4FLB A;  4JZY A;  3S7J A;  3D9P A;  4GPK A;  1WDY A;  3FDH A;  5FQ4 A;  4I1M A;  4I6G A;  1Z3X A;  4GYW A;  3UM1 A;  4TUM A;  3EHR A;  5BXU A;  3UIP C;  3E32 A;  4DPR A;  3FFL A;  3NZS A;  5G04 J;  5EYL A;  4F6R D;  1KLX A;  3CVX A;  3TWV A;  1Y8M A;  3PEV B;  3HYM B;  3L9T A;  4AIF A;  5C1D A;  4HBD A;  5CBO A;  3L82 A;  4O6F A;  3TWS A;  3ZNG A;  3AG2 E;  3LS8 A;  2UWJ G;  4GZD A;  2R5S A;  2FBN A;  3LEW A;  2PNN A;  3KSQ A;  3UQ3 A;  2YHC A;  2VGX B;  1DCQ A;  3ONL A;  3U4T A;  3JQ0 A;  2A4Z A;  3MKQ B;  1QNF A;  3O48 A;  1BD8 A;  4DJA A;  4L1B A;  1OUV A;  2P9L G;  3VLD A;  2WB2 A;  4C48 B;  4BTA A;  2IQC A;  4HI9 A;  4JEU A;  2MOW A;  3E34 A;  2JAB A;  3ZHE A;  3ASO E;  1N52 A;  3B7S A;  2GRO B;  3TXM A;  2KCK A;  2BUG A;  4FA6 A;  3AS4 A;  5FWQ A;  3PE3 A;  2AXU A;  5HS0 A;  1S63 A;  2CG2 A;  5DBK A;  3TWR A;  3CSF A;  5JJT A;  4AJW A;  3FUI A;  4L7T A;  4FHJ A;  4RG6 A;  3P1U A;  3UM3 A;  3UX4 A;  4JEH A;  2R17 C;  5E75 A;  3UM2 A;  1RW2 A;  4HQD A;  2DCP A;  5HRY A;  4GZ3 A;  3E30 A;  5BV0 A;  4AVX A;  4HLE A;  3ZN3 A;  3PZD A;  4HRN A;  1K1A A;  1TNZ A;  2WXP A;  2QYJ A;  2L0I A;  1QZ2 A;  3JQ1 A;  4JHJ A;  5CBN A;  5AJD A;  4AY5 A;  2X38 A;  1HZ4 A;  1NL4 A;  3B95 A;  3PDN A;  1N0R A;  1E8W A;  3UI2 A;  2JLB A;  1GW6 A;  2GRM A;  4F1S A;  3LCA A;  1KZO A;  3UUX A;  1JPL A;  2AJA A;  2CHX A;  2H6I A;  2ZXW E;  3P2B A;  4G8K A;  3CQC B;  2IJG X;  3C5R A;  4F1P A;  1BPO A;  3ML8 A;  4F7A A;  4AXH A;  3URZ A;  1H2T C;  3I5P A;  3FUN A;  5AAR A;  2EIN E;  1TN7 A;  2C0M A;  3FTZ A;  3PZ3 A; 
#chains in the Genus database with same CATH homology
 4HS2 A;  5FQ7 A;  4B94 A;  2LNI A;  3NZU A;  3UT7 A;  2V8S E;  3S7F A;  1H2V C;  2PL2 A;  1FVH A;  2C2L A;  4ABN A;  3MJW A;  3BEE A;  4E6H A;  2FI7 A;  1OWO A;  2XCC A;  4N2Q A;  3UT4 A;  2QFC A;  1E7V A;  4KYO B;  4I2W A;  3G2T A;  2LAH A;  4IN3 B;  1YA0 A;  4I2Z A;  3MYV A;  4I6J A;  3FTX A;  3TJP A;  5BT1 A;  4EEC A;  3PRE A;  4PS3 A;  1SQM A;  2CFZ A;  4H7Y A;  2WQH A;  4ACK A;  1FVF A;  3B7R L;  4EZL A;  3U66 A;  4NRH B;  2PZI A;  5CMY A;  3FU0 A;  1HXI A;  1Y6I A;  4KVO A;  1Z6T A;  3QAR A;  4I6E A;  5T4Y A;  3FUH A;  3DBS A;  1H19 A;  4MKT A;  3ZRH A;  5BNW A;  1MQS A;  5BV1 A;  2KC7 A;  4W9R A;  5LCW C;  2VTB A;  2VYI A;  3APF A;  1E90 A;  4HOQ A;  2WQ6 A;  3PE4 A;  4EQF A;  3Q47 B;  4I9E A;  1KT1 A;  3QWV A;  2VTB B;  4N39 A;  1KT0 A;  1FCH A;  3EIJ A;  3FUF A;  3L13 A;  3LVR E;  2WXQ A;  1JUQ A;  4G25 A;  4WND A;  2MRI A;  5FZQ A;  4A1G A;  5BUZ A;  4HOT A;  3MEK A;  4RG9 A;  4HFG A;  3CHM A;  3CGH A;  4ME2 A;  5BW8 C;  5ANL A;  4CGV A;  4GU5 A;  3SF4 A;  5JHB A;  2VJ8 A;  3L08 A;  1OWM A;  5KJM A;  3HHM A;  3D9O A;  5FQ8 A;  4XKC A;  1VDY A;  2AW6 A;  4LEU A;  3CK9 A;  4N3B A;  1ZU2 A;  2XPZ A;  4HVB A;  2RG8 A;  5LCW J;  4LCT A;  3RKV A;  5A7D B;  1INZ A;  4B0Z A;  3SFZ A;  3R7R A;  5A6C A;  3CST A;  5C2Y A;  4GYY A;  3IV0 A;  1XNF A;  4CDM A;  5FQ6 A;  3ML9 A;  3ESL A;  5G04 C;  3U9W A;  2VGX A;  3FUM A;  2XRY A;  5D0O D;  4QFV A;  1E7U A;  2IOS A;  4BSX A;  4B8C B;  4D10 C;  3ENE A;  2WXJ A;  3CR3 A;  3L54 A;  4APF A;  4I1A A;  2IF4 A;  1H6K A;  4FHK A;  2FO7 A;  4Q69 A;  4FLH A;  3LJ3 A;  4JW1 A;  4A3V A;  1NZN A;  2X6I A;  3LKU A;  1MHQ A;  3MCX A;  4ANU A;  3QK0 A;  3QKY A;  3CVW A;  1HG5 A;  3SGH A;  1HX8 A;  3G2W A;  3CHP A;  3IBE A;  2PM7 A;  1OWL A;  3B7U X;  3ZYQ A;  3SI5 A;  4RVB A;  1EDU A;  3CVQ A;  1A17 A;  2XGM A;  3DPD A;  3CHS A;  3NF1 A;  4PS8 A;  2M63 A;  1UJK A;  2X6K A;  4UWL A;  3SBT B;  2OV8 A;  3HDX A;  4DI3 A;  4UWH A;  4F53 A;  2DIW A;  1UN9 A;  4CDR A;  3CQG B;  2A5U A;  4IRU A;  4WNF A;  4GMJ A;  2WXM A;  4FJZ A;  3IHY A;  1QQE A;  3LY7 A;  4AV7 A;  3QOU A;  4H7X A;  3MA5 A;  4E85 A;  3RK6 A;  1X5B A;  2WXN A;  3MZL B;  4AY6 A;  2GRL A;  4KMO A;  2UY1 A;  3EIQ C;  1IYG A;  5EX3 A;  5DIZ A;  3AU5 A;  3ULQ A;  4FP7 A;  4P29 A;  3ZVV A;  5G55 A;  3R9A B;  4C0M A;  4AEZ C;  3BG1 B;  5FZS A;  1E96 B;  5EDS A;  5E76 A;  2KZT A;  3G2S A;  4Y6W A;  1H2U A;  2J9Q A;  1Z3Y A;  3FH7 A;  4JVS A;  3FUJ A;  3CV0 A;  3D9J A;  4I1O B;  4UWG A;  4A3T A;  4CT4 A;  1NA0 A;  4JXT A;  4CDN A;  1IHG A;  3TG4 A;  1EF1 C;  3LDZ A;  2WMO A;  1H0A A;  4J8E A;  1HU3 A;  4KZ0 A;  5G2N A;  3U3W A;  1U3C A;  4KZC A;  2I9C A;  4MS6 A;  5EKQ D;  4G26 A;  4JPS A;  3T8M A;  4KXK B;  3VTY A;  2HYZ A;  2VSN A;  4HOR A;  4OVU A;  3TG5 A;  3D9M A;  3CVU A;  4L23 A;  2RD0 A;  4FAD A;  4L2L A;  2HO1 A;  4G1T A;  3FTV A;  2Q7F A;  3RRU A;  3Q4A B;  5FT9 A;  5ANR A;  2XGO A;  3MX3 A;  4CEM A;  2WXF A;  3ZXS A;  2VQ2 A;  3FP3 A;  4KBQ A;  5LOZ A;  1TEZ A;  5EX0 A;  4EBA A;  2XGS A;  4BT9 A;  1E8Z A;  3L6A A;  2AWI A;  2BTD A;  2WXO A;  4MLP A;  4F3V A;  3D9L A;  5HI7 A;  3C98 A;  3QC1 A;  3SBS A;  3O4Z A;  3LY8 A;  2PM6 A;  2VSX E;  3I4R B;  3PNL B;  1XGW A;  3E4B A;  4IUL A;  4BY6 A;  4J6I A;  4YVO A;  5KJL A;  5T3R A;  4ILI A;  2XPI A;  3FHE A;  4JHK A;  3AS8 A;  3K9I A;  4EZK A;  2PQN A;  3IKO B;  3CHQ A;  1TJC A;  3IHV A;  4U0Z A;  4C9B B;  4PDX A;  3SHF A;  3ZYK A;  2KZT B;  4HXI A;  4L2Y A;  1PY1 A;  4AM9 A;  1UW4 B;  2KAT A;  2I2O A;  5CMW A;  5CCL A;  3ZHE B;  3IEG A;  1EPU A;  4XKB A;  1IQU A;  5J90 A;  1WY6 A;  5JHA A;  1JWF A;  1N54 A;  3FY4 A;  3RO2 A;  4B89 A;  2GW1 A;  3SZ7 A;  3KD7 A;  3CK7 A;  3EDT B;  3HVE A;  2XQ0 A;  4OVV A;  2J07 A;  5FJY A;  4BFR A;  2L6J A;  4PUC A;  2XPY A;  3FUK A;  3FUD A;  4Q96 A;  4Y6C A;  2X6J A;  2IFU A;  4TV3 A;  4B8A A;  1UN8 A;  5KCM A;  3AS5 A;  4JA9 A;  3TAX A;  5LP0 A;  2KCV A;  2X6H A;  4XX5 A;  4BX8 A;  5LFA A;  2XRZ A;  2X6F A;  2AVP A;  4APO A;  3CHR A;  5ENN A;  1OWN A;  5A23 A;  1ELR A;  4J8F A;  4I43 A;  5CHE E;  3ONK A;  4HOS A;  4ANX A;  4BT8 A;  2OND A;  4ILH B;  3RJV A;  1OWP A;  5ARG A;  2R59 A;  1JWG A;  2KM4 A;  2CFU A;  3CVL A;  5FTP A;  4GA1 A;  2FEZ A;  3OXL A;  4BX9 A;  1B89 A;  4U0U A;  4HOU A;  4DK5 A;  3RO3 A;  2GGF A;  3TGO A;  2CHW A;  3GZS A;  2J09 A;  3RRN B;  3FEY A;  5AJL A;  3JYS A;  2J49 A;  2HR2 A;  2LAI A;  3KS2 A;  3LYA A;  4K03 A;  3G2U A;  4JA7 A;  3MV2 B;  5ARF A;  3RU0 A;  2V4L A;  4I17 A;  4JC8 A;  3FTU A;  2NC9 A;  3NQP A;  3D9I A;  5FZR A;  3ASG A;  3FTY A;  4N5C A;  2OVF A;  3LPZ A;  3VLF A;  3B13 A;  3EJN A;  1ZBP A;  2LSV A;  1UJJ A;  4FLB A;  4JZY A;  3S7J A;  4U04 A;  3D9P A;  4NQ0 A;  3GW4 A;  3BG0 B;  2UY1 B;  4UI9 J;  4GPK A;  2AXV A;  3FDH A;  4G23 A;  5FQ4 A;  4G2V A;  2I6H A;  2I1J A;  4AOF A;  3CEQ A;  4I1M A;  4I6G A;  4R7L A;  1Z3X A;  3ZW3 A;  4WNG A;  4G24 A;  4GYW A;  2CG3 A;  3FTW A;  1DVP A;  3CVV A;  3MGB A;  4LUN U;  3APC A;  3L16 A;  4UI9 C;  3ZFW A;  4EPZ A;  2WXK A;  3FU6 A;  2P58 C;  2YIN A;  1HF8 A;  4DPR A;  3UPV A;  3FFL A;  3NZS A;  2X3M A;  3TL5 A;  3ZYL A;  3R7Q A;  3FEX A;  4UWF A;  2MHK A;  4GCO A;  4NAC A;  5KJK A;  3PRZ A;  2WQ7 A;  4UQX A;  3OXF A;  4AP2 A;  3LVQ E;  3PH0 C;  5G04 J;  2I1K A;  4Q94 A;  2ZU6 B;  1KLX A;  3T5X A;  3CVX A;  4WNE A;  3CK8 A;  4PS7 A;  4EBA G;  1Y8M A;  5T8I A;  4DLQ A;  3PEV B;  3HYM B;  3EHM A;  2Y3A A;  4WWP A;  3CLJ A;  4MRU A;  2HM8 A;  4N3A A;  4AIF A;  3D9K A;  3FH5 A;  4ANV A;  2Y4T A;  2WXG A;  3OAW A;  5C1D A;  3PS6 A;  3LY9 A;  2NXP A;  2AXZ A;  4GZ6 A;  1UG3 A;  3LXU X;  3QWP A;  4O6F A;  3OTN A;  4GA2 A;  5KJN A;  4WUY A;  4A55 A;  2E0I A;  4FU3 A;  3S7B A;  2WPV A;  4V3I A;  5AYW D;  3LS8 A;  2UWJ G;  4GZD A;  3PVL A;  4U63 A;  3RRM B;  3ESK A;  1SZA A;  2DBA A;  2WXH A;  2WXI A;  1DNP A;  2R5S A;  3JCK C;  2FBN A;  2WM9 A;  3LEW A;  5AEN A;  4WWN A;  3UQ3 A;  2YHC A;  2VGX B;  4IYP A;  3ASD A;  3ONL A;  3U4T A;  2FUL A;  4GYO A;  3RIB A;  3VLE A;  4J8S A;  4XI0 A;  4ACL A;  3JQ0 A;  2A4Z A;  1E8Y A;  2L9B A;  2Y4U A;  4FJY A;  4XE0 A;  3MKQ B;  4FC8 A;  3ZEF A;  1QNF A;  4URK A;  3O48 A;  3UT8 A;  3I4G A;  4NUR A;  4CRW A;  2YNQ A;  4CT0 A;  4DJA A;  4L1B A;  1OUV A;  3QB2 A;  3FWV A;  4YND A;  2OOE A;  2BF0 X;  2LO6 A;  5BPP A;  3L17 A;  5G05 J;  1S0P A;  4J8D A;  4I9C A;  3S2A A;  2IOL A;  3VLD A;  4BTB A;  1L5J A;  4K0R A;  2WB2 A;  3Q5M A;  1ELW A;  4KT6 B;  4XZ4 A;  2L0T B;  4GCN A;  2KCL A;  3FTS A;  3Q15 A;  1W3B A;  4BTA A;  4C0E A;  3D3M A;  3CVY A;  4GML A;  2FF4 A;  2IQC A;  4U8H A;  4M3O A;  1HG2 A;  2MOW A;  2WMN A;  1HH8 A;  4JEU A;  4YVQ C;  3ZHE A;  2PQR A;  3APD A;  4N3C A;  1N52 A;  3B7S A;  3JUI A;  1E8X A;  3CIA A;  3HIZ A;  4N2S A;  2VSY A;  1WM5 A;  3HVE B;  3TXM A;  2KCK A;  3G2V A;  4XIF A;  5G05 C;  2BUG A;  2WXR A;  4U07 A;  2WVI A;  1EYH A;  2JEK A;  4FA6 A;  3AS4 A;  4CGW A;  3T5V A;  5FWQ A;  3PE3 A;  4UQZ A;  2ION A;  4UWK A;  2V0P A;  3I3N A;  2AXU A;  2J4D A;  3QJZ A;  2CG2 A;  3VTX A;  2E2E A;  5DBK A;  3GYZ A;  3CSF A;  5JJT A;  4WAF A;  2ILR A;  3FUI A;  3OXG A;  4AJW A;  3FU5 A;  4FUL A;  3L22 A;  4L7T A;  5D0Q D;  3QWW A;  4FHJ A;  4GZ5 A;  3P1U A;  4RG6 A;  2J08 A;  3UX4 A;  3QDN A;  4JEH A;  1NA3 A;  1NP7 A;  2R17 C;  3Q49 B;  1HFA A;  5E75 A;  1IQR A;  4GB9 A;  2NSZ A;  3SNX A;  2CHZ A;  2VSO E;  2XEV A;  2DCP A;  5CCM A;  2LSU A;  5JJ6 A;  3KAE A;  4U0S A;  3UMV A;  4DLO A;  4GZ3 A;  1WAO 1;  3PNT B;  5AIJ A;  3CKC A;  5BV0 A;  1TJF A;  1ELK A;  4JHR A;  1P5Q A;  4AVX A;  3ZYM A;  2YQ8 A;  3CHO A;  2XCB A;  3ZIM A;  4TRQ A;  4UQY A;  4HLE A;  3FUL A;  3ZN3 A;  3PZD A;  3EHN A;  4XI9 A;  3CVN A;  1HE8 A;  3MKR A;  5JJ7 A;  4A1S A;  2WXP A;  4JL0 A;  3N71 A;  2XHE A;  2L0I A;  3ZPJ A;  1QZ2 A;  3JQ1 A;  1LF8 A;  4JHJ A;  5J08 A;  3U64 A;  4ILG A;  3WXX A;  2C0L A;  5AJD A;  4ATG A;  2J4B A;  3GZ2 A;  4AY5 A;  2X38 A;  1HZ4 A;  1PC2 A;  2WXL A;  3PDN A;  1U3D A;  4WWO A;  1E8W A;  3PEU B;  5LX8 A;  2EQX A;  2JLB A;  1GW6 A;  2GRM A;  4F1S A;  5M72 A;  3FUE A;  2YHE A;  1HO8 A;  3LCA A;  4RSY A;  4BWR A;  2CHX A;  1JPL A;  3UUX A;  3PUJ A;  4EZJ A;  2VGY A;  3AU4 A;  2QY7 A;  3P2B A;  4ANW A;  3ZGQ A;  4KVM A;  3CQC B;  4CCA A;  3ASF A;  3FH8 A;  3CKB A;  2IJG X;  4GAA A;  3TXN A;  3D9N A;  4TUU A;  1BPO A;  3MKQ A;  1SZ9 A;  3CVP A;  3ML8 A;  1HS6 A;  4F7A A;  3GZ1 A;  4LER A;  3S7D A;  1PAQ A;  4OYS A;  3MV3 B;  5HQ8 A;  4G11 A;  4AXH A;  2IU1 A;  1H2T C;  2OVB A;  3I5P A;  3KEZ A;  4GA0 A;  3FUN A;  4J0U A;  3SD5 A;  3URZ A;  3ASH A;  4PH4 B;  4DI4 A;  2C0M A;  3QNK A;  3FTZ A;  3QAQ A;  3FU3 A;  4GZC A;  3PUK A;  4UI9 K;  2V5F A;  3B7T A;  4LRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...