1A17A

Tetratricopeptide repeats of protein phosphatase 5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
159
structure length
159
Chain Sequence
PPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 5
publication title The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 159
sequence length 159
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1997-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1a17A00
4UQZA 3ULQA 4BT9A 2PL2A 3ZHEA 3GW4A 5KJNA 4YNDA 4UI9C 3MEKA 2YQ8A 5EX3A 4B94A 4U0ZA 5FT9A 2PZIA 2Q7FA 2FO7A 3QWVA 1NZNA 2VSYA 4F3VA 3Q4AB 1QZ2A 4U0SA 3RO3A 4RG6A 2KCLA 1YA0A 2UY1B 5FZRA 3N71A 3O48A 1KT0A 1IHGA 3HYMB 3CV0A 2UWJG 5JJTA 4Y6WA 5HI7A 2VGXA 3LKUA 3TG4A 4Y6CA 2KCVA 2FEZA 3LCAA 4WNGA 4I2ZA 4N3AA 5BW8C 4HOQA 5D0OD 3WXXA 3NF1A 4NRHB 1ELWA 4I9EA 3ZN3A 1PC2A 4HOSA 5EKQD 5A6CA 4O6FA 2VGXB 4AM9A 3AS4A 5EX0A 3ASFA 1NA3A 3CVPA 4XI0A 4J8EA 2V5FA 3CVQA 4UQYA 4GCOA 3ASGA 3TG5A 2IFUA 4HOUA 1QQEA 3UQ3A 5KJMA 4GZ3A 5CHEE 3VTYA 4KYOB 2LSUA 4GZ6A 2IF4A 2KC7A 4WNDA 5FZQA 2ONDA 2XPIA 3CVNA 4G2VA 3ASDA 3CKCA 5BNWA 4EQFA 4AIFA 2FF4A 4JA9A 2Y4UA 4IN3B 4GPKA 3CK7A 4CDRA 4CGVA 4XIFA 3K9IA 2LNIA 4A1SA 4GA2A 2VYIA 4ME2A 3QOUA 2FBNA 2UY1A 2WPVA 5JJ6A 3KD7A 4G26A 4N2SA 3Q5MA 4UQXA 3CKBA 4UI9J 3PE4A 2XGSA 3AS8A 3Q47B 4U07A 4WNEA 2XCCA 4H7XA 3QWWA 4GZ5A 5G05C 4N3CA 4UI9K 3LPZA 3GYZA 1A17A 3U4TA 5CCMA 4N2QA 5G05J 4NQ0A 1HXIA 3MA5A 3IEGA 4GYYA 1KLXA 3RIBA 3CVLA 3OXGA 2KCKA 3LY7A 2BUGA 3GZ2A 3RO2A 2JLBA 3ZPJA 5DBKA 3Q49B 4U04A 5BT1A 2HO1A 4I17A 2FI7A 4XI9A 1KT1A 4GCNA 2E2EA 2XGMA 1Y8MA 3S7BA 4WUYA 1W3BA 3QKYA 4KXKB 4GA1A 1WM5A 1FCHA 4JHRA 5FTPA 2P58C 1E96B 4BTBA 3GZ1A 3RKVA 4N39A 3FFLA 3RJVA 5ARGA 5AYWD 5JJ7A 4LEUA 3KS2A 2QFCA 2HR2A 1OUVA 1ZBPA 4JA7A 2I6HA 2MHKA 3EDTB 2WQHA 3PE3A 3SF4A 2XCBA 2LSVA 5HQ8A 4AY6A 4I9CA 5CCLA 5LCWC 4W9RA 1ZU2A 2R5SA 3QWPA 2J9QA 3KAEA 2GW1A 3ZGQA 3MKRA 2Y4TA 3SZ7A 3S7JA 4G23A 3CEQA 3S7DA 4JL0A 2YHCA 3FWVA 2L6JA 1P5QA 2VQ2A 3OXLA 2PQNA 2C2LA 3ASHA 4U0UA 4H7YA 1XNFA 2OOEA 3ZHEB 4APOA 2XEVA 5C1DA 2PQRA 3ESKA 3URZA 4HOTA 2KATA 3ZFWA 3TGOA 1NA0A 2DBAA 3LYAA 4I1AA 3CK8A 3OXFA 4RG9A 4J8FA 3LY9A 5KJKA 5G04C 5A7DB 3LY8A 4N3BA 4GA0A 4G1TA 3MV3B 3BEEA 3CK9A 5KJLA 5G04J 5FZSA 3E4BA 3FP3A 4BWRA 3UPVA 4J8DA 4G24A 1TJCA 2NC9A 4BT8A 3AS5A 4GYWA 3QDNA 1WAO1 4N5CA 5FJYA 2VGYA 4WNFA 4CGWA 4KBQA 4I2WA 3TAXA 5D0QD 4YVQC 3R9AB 2XGOA 1HZ4A 2C0MA 5ARFA 1IYGA 2HYZA 1B89A 3Q15A 4GYOA 3PDNA 3U3WA 1HH8A 3MV2B 3RU0A 3JYSA 3UUXA 3S7FA 4AY5A 1ELRA 5LCWJ 5DIZA 2VSNA 3VTXA 4HORA 4YVOA 4ABNA 4BTAA 2AVPA 4J0UA 5M72A 4G25A 2C0LA
chains in the Genus database with same CATH superfamily
4UQZA 3G2SA 3ULQA 2NSZA 3MKQA 5AQBA 1N0QA 2HE0A 5BV1A 3Q78A 3F6QA 3UM2A 4YNDA 1HFAA 3IKOB 4CDNA 3MEKA 2YQ8A 5EX3A 4B94A 3BQOA 2Q7FA 4FJYA 2FO7A 4JW1A 2VSYA 4JVSA 4HRMB 1TR4A 1NFIE 3ZXSA 3RO3A 3PNLB 1IQRA 4R7LA 5BXOA 4AXHA 4I6JA 4O1PA 3SBTB 2BKGA 3O48A 5ANLA 4EBAG 1S63A 3B7SA 4ZHBA 4KT6B 2P9SG 1IQUA 5JJTA 2DIWA 1N4RA 4NACA 4YDOA 5D2MC 4MRUA 3L22A 1UG3A 2GGFA 4WNGA 1A5EA 3WXXA 4HFGA 3NF1A 2J07A 3CHOA 4QQIA 3B13A 1PC2A 3CVXA 4O6FA 1MHQA 4EZKA 2M63A 4AM9A 2E0IA 2WXQA 4DLOA 5EX0A 3I4GA 5J90A 3CVPA 4XI0A 5JHAA 1E7VA 3AU5A 1K1BA 2WXJA 4L9PA 2WMNA 3RAUA 4LUNU 1U3CA 4K0RA 4NIKA 5CHEE 2WXMA 5FQ7A 3QK0A 3FH8A 3X2QE 4E85A 3EU5A 2LSUA 4AEZC 2IF4A 2KC7A 5FZQA 3D9HA 3SHFA 1N4QA 4AV7A 3LJ3A 4JC8A 3RRMB 1O1RA 2R05A 2ETAA 4BFRA 3ASDA 3GZSA 4LNGA 2R59A 4JA9A 2A5UA 4C9BB 5B1AE 4IN3B 3QARA 3IHYA 4UWKA 2GRMA 4AVXA 3K9IA 1KZOA 2OV8A 2VYIA 3NZUA 4ME2A 2EINE 1N0RA 3J5QB 4JPSA 1XGWA 3PUKA 1LD8A 2OVBA 3Q9NC 1O1SA 4UI9J 3C3RA 4FHJA 2WQ6A 3TXNA 4EZJA 1FT1A 1JCSA 1TN7A 5EIDA 3L82A 2DWZA 1A17A 2X3MA 4FU3A 4L23A 4NQ0A 1HXIA 4ANXA 3RRUA 3IEGA 4FJZA 3TWUA 1KLXA 4CT4A 2BEDA 2Y69E 3NOGD 3OXGA 1VDYA 3LY7A 2BUGA 3PEUB 2JLBA 3CVUA 2X6FA 3UX4A 3OAWA 1MJ0A 3FUDA 1Z3YA 3MX3A 1Y8MA 3Q7AA 3QKYA 1TN8A 3PZ2A 4JZYA 1O5MA 2A4ZA 4GTQA 2YNQA 3ABKE 4BTBA 4FHKA 3PREA 1K1AA 2GROB 4TUMA 5ARGA 1UOHA 4DRXE 3W9FA 5AYWD 3G2WA 4PS3A 2QFCA 3MGBA 2RFMA 1OUVA 5D66A 2MHKA 3DSVA 1TNZA 3CQGB 4KVOA 5C2YA 4RLYA 2GRLA 5CCLA 1OCCE 5LCWC 5LX8A 5EYPF 1NP7A 3C98A 4JXTA 3HXEA 3EHMA 1N11A 4MBGA 2DYSE 1EPUA 4A63B 3WG7E 4U63A 3ULYA 4K5CA 3ONLA 1TYQG 2Y4TA 3SZ7A 3FTSA 2KZTB 3SGHA 5KNHD 2IEJA 4ATGA 4BX9A 4NURA 2YHCA 3CHPA 3U66A 4J8SA 1HE8A 3AG1E 2J49A 2PQNA 1V54E 1K3ZD 3MKQB 1XNFA 3UKRG 4G8LA 5CBOA 5J08A 4APOA 2X6HA 2XEVA 4TXQA 5C1DA 3TWWA 2PQRA 1WDYA 3DSWA 3FUEA 1N94A 1ELKA 3ZFWA 4CCAA 2DBAA 4I1AA 3SQVA 4KZCA 2BTDA 3LY9A 3L13A 1OWOA 2WXIA 1DNPA 3CIAA 4HRNA 4XX5A 3P1UA 3FTYA 3IHVA 3BEEA 3CK9A 3PUJA 5FZSA 3E4BA 4BWRA 1PY1A 4G24A 4XZ4A 4BT8A 4L2LA 4GYWA 4ILHB 3QDNA 3D9MA 3B95A 3NB2A 3E33A 5AIJA 1OWLA 2XS8A 2EQXA 4WNFA 2IU1A 4HS2A 3CGHA 5CRUA 3QAQA 2CHWA 3G2UA 4YVQC 3ZXPA 2ZGDA 5BPPA 2C0MA 3CSFA 3TWXA 4DK5A 1IYGA 3FUJA 2ZXWE 5FIOA 5KCMA 2F8YA 5AARA 1HF8A 3MV2B 1JUQA 4I43A 2VTBA 2WXNA 4AY5A 1ELRA 3RK6A 2R2LA 3FULA 4GTRA 4J0UA 3FUFA 1LF8A 2PL2A 3GW4A 3ZYMA 3DSXA 4UI9C 4FC8A 4FADA 2WXOA 4JHKA 1E8ZA 4U0ZA 3DSSA 1JCRA 2WXFA 4ATZD 3QWVA 1H6OA 1UJKA 3PRZA 2YHEA 5EYLA 4KVMA 3TWQA 3FUIA 1WY6A 5FZRA 4EECA 3FTZA 3L9TA 3UINC 1IHGA 3HXDA 3FH7A 3VLEA 3ZYLA 2UWJG 5AAOA 3DBSA 2WVIA 4PUCA 4Y6CA 1N4PA 4N3AA 4HOQA 2KBXA 5B1BE 1YCSB 2X38A 4I9EA 4M7CA 3ZYKA 5BXUA 3UM0A 5HS0A 3ZN3A 2F0YA 2CFUA 2VGXB 5KBAA 3FH5A 3PNTB 1X5BA 2NXPA 3CVVA 2WB2A 1U3DA 2IO3C 4UQYA 3T8MA 3ASGA 3KEZA 3TG5A 5JMND 5AQ9A 1E8WA 2IFUA 1QQEA 1KZPA 2LXMA 2ZISA 5BUZA 3UXGA 3UQ3A 2CFZA 2AJAA 3G2VA 3OTNA 3DEOA 4ILGA 3TJPA 4WNDA 2VJ8A 1EDUA 4PH4B 3AAAC 5AENA 2XEHA 3NZSA 2PM7A 4G2VA 4DI4A 4OVUA 3AG3E 3L6AA 2XEEA 5G55A 4AIFA 4PS7A 2FF4A 4ANVA 2Y4UA 3JQ0A 3L54A 3IV0A 2FO1E 4GA2A 2XQ0A 3QOUA 2IOLA 2J8SD 4Z68A 2I1KA 2UY1A 3L16A 2CG3A 5JJ6A 3FEXA 3T8KA 2H6GA 3Q47B 1NI1A 4DX7D 1N9AA 4GZ5A 5G05C 5ENOD 4N3CA 3AU4A 3DXKG 4N2QA 2RKKA 2EIME 3ZW3A 5AJLA 3EJNA 2VSOE 2DYRE 1BU9A 2X6IA 3HXBA 2WXHA 3RO2A 2VSXE 3D9PA 4O60A 3SI5A 5DBKA 4I1OB 4KZ0A 4WWNA 4E6HA 1DCEA 1S64A 2EIJE 4I17A 4XI9A 1KT1A 1TJFA 4GCNA 3ONKA 4LRZA 3HVEA 1HG5A 5FINA 2Y0BG 1V55E 2JEKA 4LNUD 2A5EA 3Q73A 2XENA 4JHRA 1H2UA 3L17A 3V79K 5FQ4A 1E96B 3GZ1A 3APFA 4CDMA 5A23A 4J6IA 3FFLA 3PS6A 3T5XA 3MYVA 4KMOA 4FLHA 5JJ7A 3CQCB 5CEDB 1JPLA 3R9MA 2HR2A 3DRAA 1ZBPA 4JA7A 2I6HA 4UWLA 2WQHA 2CHZA 3TWRA 2Y3AA 3PE3A 3UIOC 3QNKA 4I1MA 4AY6A 4I9CA 1AWCB 1ZU2A 3DSUA 2RFAA 5EN5D 3PZ4A 3ASOE 2LO6A 2VGEA 4DLQA 3IBEA 4F53A 3B7BA 4C0MA 3V31A 1AP7A 3FDHA 2VTBB 3SD5A 3CHSA 2IQCA 3CEQA 3B7TA 3L08A 1P5QA 3D9JA 4L2YA 1U2VG 4HRLA 3E37A 3EHQA 4J8YA 2H6IA 1TNOA 2XS1A 3ASHA 1ZB1A 4H7YA 4U0UA 2OOEA 3V2XA 2ZIRA 4Q96A 3E32A 2QC9A 3I5PA 1KPSB 3URZA 2L0TB 1INZA 4HOTA 3HHMA 2KATA 3C72A 3TGOA 1NA0A 1OWNA 4LG6A 3T5VA 4RG9A 1H2VC 3SO8A 4DX6D 4MS6A 3Q9UC 5G04C 5A7DB 3LY8A 2P2CP 3ABLE 4G1TA 3MV3B 4C0EA 3UM1A 4D10C 3CVWA 2H6FA 4RQIA 5H7PA 4UWGA 3AJIA 4J8DA 4B8AA 4F6RD 1FVFA 1Z6TA 4N5CA 1BLXB 4G11A 1TNUA 4GTTA 4KBQA 4I2WA 4U8YD 4K5BA 2XRZA 4DX1A 2L0IA 3TAXA 3R9AB 2XGOA 3D9OA 3PZDA 4XKBA 4XE0A 3S2AA 2ETCA 3D3MA 1HZ4A 4O1OA 4GU5A 2BF0X 5ARFA 3NOCD 4GYOA 1SQMA 5CERB 3JYSA 4PS8A 3JCKC 2VSNA 4YVOA 2AVPA 2OEVA 4G25A 1E90A 3TWSA 4BT9A 1BI7B 5ENQD 4F1PA 4WWPA 3FTXA 5KJNA 4WWOA 3APDA 1IXVA 1N54A 3ABME 4ZFHA 2PZIA 3UTMA 3UT8A 1HX8A 1MYOA 4F3VA 3Q4AB 4GB9A 2KCLA 1OCOE 3ZKJA 3Q7FA 1UW4B 1YA0A 3PZ1A 4U96D 2UY1B 3FTVA 4N5QA 2GRNB 4HLEA 1KT0A 3HYMB 1TNYA 5JA4D 1N95A 1JWGA 3LKUA 3SBSA 3TG4A 5AJDA 2KCVA 1HU3A 2FEZA 4B93B 2IOSA 1SVXA 4I2ZA 5BW8C 3LEWA 5D0OD 1FT2A 4L1BA 4Q94A 3FHEA 2L6BA 4HOSA 1MX6A 5EKQD 3HXFA 3CSTA 3MJWA 3ASFA 1DC2A 3ZIMA 1UJJA 3CVQA 3P2BA 2GRPB 5E76A 5LOZA 2XZTG 4PDXA 3HVEB 4UUCA 2P9KG 2J4BA 1S0PA 4GZ3A 3VTYA 4TRQA 4I6GA 4GZ6A 3U9WA 2I9CA 3CLJA 3ZUVB 1EF1C 2ONDA 4YDYA 1L5JA 4DI3A 3PEVB 2CHXA 4JEUA 3Q75A 2CG2A 4ILIA 4JD2G 1G3NB 3UKUG 3ZU7B 4TUUA 3CKCA 2V4HC 3JQ1A 4GPKA 3CK7A 3TL5A 2LNIA 3NAWA 3UM3A 3D9KA 3NBNB 5EDSA 3SNXA 3UT4A 2V4LA 4G26A 4N2SA 1E8XA 4UQXA 4JB8P 3CKBA 2XGSA 1OCZE 3AS8A 2OCCE 4WNEA 4ANUA 2YINA 1NL4A 3ZRHA 4YDWA 4UI9K 3LPZA 4OAVB 1FPPA 1LD7A 3ZYQA 3KSQA 2F37A 4GTVA 3TWVA 3ZNGA 3APCA 3ASNE 2WMOA 2RD0A 4GYYA 3SY2A 5KWDA 3G2TA 3FY4A 4DUIA 3E30A 3JUEA 3GZ2A 5HKPA 2R02A 2J09A 3Q49B 4ACKA 3B7RL 5ANRA 4U04A 2XRYA 1H19A 5FQ8A 5BT1A 2HO1A 3FUHA 3EHRA 2FI7A 3ISMC 2WQ7A 2IJGX 3S7BA 2HM8A 3HRAA 2PNNA 2H6HA 4BETA 4GA1A 4MKTA 5AN8A 1WM5A 1LTXA 3LDZA 5FTPA 2ETBA 1RW2A 1PAQA 4ANWA 1D8DA 2P58C 1SA4A 3MZLB 4N39A 3RJVA 2QYJA 1FVHA 3D9IA 2P9UG 1JCQA 4FP7A 4LEUA 3KS2A 1HG2A 2XPYA 5ENTD 3R7RA 2GRQB 4RSYA 2FULA 4HNAD 1OY3D 2XCBA 5HQ8A 4BERA 1RZ4A 1UN8A 2IY0C 2KZTA 1HO8A 4LSZE 1X81A 2R03A 4F1SA 3FTUA 2AXVA 1QBQA 3U64A 1MZCA 3QWPA 4DX2A 2GW1A 3ZGQA 3W9GA 3MKRA 2PM6A 3EHNA 2P9IG 3LXUX 1EYHA 3S7JA 4G23A 3S7DA 4JL0A 4GAAA 1N4SA 3JUIA 2JABA 2ILRA 5LFAA 5CMWA 1TEZA 4FA6A 2C2LA 4CT0A 4A3VA 2LXLA 3FU3A 5AQ7A 4BSXA 3O4ZA 2J4DA 1O1TA 3ESKA 4EBAA 2DZOA 2XHEA 3DEPA 3LYAA 3OXFA 4GZCA 4J8FA 5KJKA 4TXPA 2QZAA 4N3BA 1OWPA 4GA0A 4J7WA 2I2OA 1OT8A 4F7AA 5CMYA 3JXIA 3UPVA 4FLBA 3PZ3A 3UIPC 3AS5A 2NYJA 4GPMA 5CBNA 5JHBA 5FJYA 2VGYA 3DXMG 4GZDA 4BESA 4CGWA 3CR3A 4X8QA 2WXGA 3IXEA 5D0QD 3J5PA 2MRIA 3VLFA 2V8SE 1E7UA 3KEAA 4U95D 3AG4E 5HRYA 4BEPA 2HYZA 2LUHA 3V30A 5KNGA 3RRNB 4C48B 3HIZA 1HH8A 1BPOA 3RU0A 2KM4A 4BX8A 2DCPA 3ESLA 5FQ6A 4HORA 2EILE 3Q79A 4BTAA 3I3NA 5M72A 3HG0D 2LAIA 2DVWA 1Q2ZA 2R17C 2BKKB 2AXZA 2X6JA 3ZHEA 2XZDG 3TXMA 4CZ2D 5FT9A 3T9KA 3TWTA 1MX2A 5T3RA 4HB5A 4MLPA 1NZNA 3D9NA 4GTMA 1QZ2A 4U0SA 3FTWA 4RG6A 3V2OA 1QNFA 5CRVA 1N52A 3N71A 3EU9A 3I4RB 3CV0A 5CEAA 4DPRA 2OVFA 3C5RA 4HLLA 2ZGGA 3QB2A 4Y6WA 5HI7A 4I6EA 2Y1LE 2VGXA 1SW6A 4HXIA 3BG0B 3EUVA 3VLDA 3SFXA 3ZEFA 3LCAA 5E75A 3SFYA 4OAUC 4NRHB 1ELWA 2RG8A 4HBDA 3BU8A 2XPZA 4A1GA 1BI8B 4BSZB 5A6CA 5IY5E 4GMJA 1OXJA 3DWLG 3AS4A 4AP2A 3FEYA 1NA3A 4AOFA 1SA5A 4J8EA 2V5FA 3QC1A 4GCOA 4OVVA 2P9PG 4DJAA 4HI8A 4B8CB 4GTSA 4TV3A 4HOUA 2IONA 5G2NA 5KJMA 1IKND 1H6PA 3PVLA 4JHJA 4KYOB 1DVPA 1JWFA 2EIKE 4OYSA 4IRUA 2AWIA 2XPIA 3CVNA 2QY7A 3HDXA 2P9LG 5BNWA 4EQFA 3ML8A 4B0ZA 5CECB 4YDEA 1HS6A 2L9BA 4CDRA 4CGVA 4XIFA 2GRRB 3ENEA 4A1SA 4UWFA 4G8KA 1H0AA 2FBNA 3AG2E 2AW6A 1IHBA 2I1JA 3LJNA 3MCXA 4P29A 3JXJA 2WPVA 3KD7A 3LS8A 3CVYA 3Q5MA 2F8XK 3KSLA 3NQPA 3PE4A 2B6CA 5B3SE 1GW6A 1SZ9A 4LERA 4U07A 4L7TA 2XCCA 4H7XA 3QWWA 3BUAA 5ENPD 3GYZA 3U4TA 5CCMA 1MQSA 5G05J 4EHMA 3D9LA 4GMRA 1D8EA 4V3IA 1K8KG 3FU5A 2V0PA 5ENSD 2AXUA 2DZNA 4HQDA 3MA5A 2MOWA 4ACLA 2KXPC 3RIBA 3CVLA 4TXRA 5FWQA 2KCKA 2WXPA 4FULA 3ULEG 5AQAA 3ZPJA 4AJWA 4RVBA 1OWMA 4GTPA 2E2EA 2XGMA 4M3OA 5LP0A 5T8IA 3SFZA 4JEHA 4WUYA 1W3BA 4KXKB 2X6KA 1Z5SC 5ENNA 4A55A 4U7EB 2ZU6B 2QYUA 4UWHA 4Q69A 1FCHA 4CYMD 3CHMA 3DPYA 4CEMA 3EIQC 4DX5D 3RKVA 3UI2A 4HI9A 1YMPA 3DSTA 4XEIG 5EILA 5BV0A 4CRWA 1UN9A 3EDTB 3FUMA 4GTOA 3SF4A 3EIJA 3FU6A 4K03A 2LSVA 2WXKA 2WM9A 3RSEG 4W9RA 3C3QA 2IO2C 3HXCA 4XKCA 4EPZA 2R5SA 5ITZF 2P9NG 3R7QA 4EZLA 3ML9A 1MX4A 3FU0A 3B7UX 1H6KA 1S70B 1YYHA 2J9QA 3BG1B 3KAEA 4URKA 1H2TC 3CHRA 4QFVA 5ENRD 3FWVA 2L6JA 4IULA 2VQ2A 4BY6A 2WXLA 3OXLA 1TN6A 3C3OA 2LAHA 2MYOA 3ZVVA 3ZHEB 1E8YA 4B89A 3FUKA 2OEWA 4HVBA 3DPDA 1QYMA 3CK8A 3E34A 1WG0A 2V5QC 3UT7A 1SZAA 3LVRE 4APFA 5KJLA 5G04J 3FP3A 5T4YA 1DCQA 4WAFA 4IYPA 1TJCA 2NC9A 2J08A 4LNBA 1WAO1 4U8VD 3UMVA 4A3TA 1BD8A 4LCTA 3LVQE 1TNBA 2WXRA 3PH0C 3CHQA 3QJZA 1Z3XA 1B89A 3Q15A 4GMLA 3PDNA 3FUNA 3U3WA 4U8HA 3UUXA 2B0OE 1Y6IA 3S7FA 4K5AB 5EIBE 5LCWJ 5DIZA 3VTXA 4ABNA 1OCRE 1D9SA 2C0LA
chains in the Genus database with same CATH topology
1E90A 1LF8A 4UQZA 3G2SA 2LAIA 3ULQA 2NSZA 3MKQA 4BT9A 2PL2A 4WWPA 2R17C 5BV1A 2AXZA 2X6JA 3ZHEA 3GW4A 3ZYMA 3FTXA 5KJNA 4YNDA 1HFAA 4UI9C 4WWOA 4FC8A 4FADA 2WXOA 3IKOB 4CDNA 3APDA 3MEKA 2YQ8A 4JHKA 5EX3A 3TXMA 4B94A 1E8ZA 4U0ZA 1N54A 5FT9A 2PZIA 2Q7FA 3UT8A 1HX8A 4FJYA 2FO7A 2WXFA 4JW1A 5T3RA 4MLPA 3QWVA 1NZNA 2VSYA 4F3VA 4JVSA 3Q4AB 4GB9A 3D9NA 1UJKA 3PRZA 3ZXSA 1QZ2A 2YHEA 4U0SA 3RO3A 3PNLB 3FTWA 4RG6A 1IQRA 2KCLA 4KVMA 1UW4B 1YA0A 1QNFA 4R7LA 3FUIA 2UY1B 1WY6A 4AXHA 3FTVA 4I6JA 3SBTB 5FZRA 1N52A 3N71A 4EECA 3O48A 4HLEA 3FTZA 1KT0A 1IHGA 5ANLA 4EBAG 3HYMB 3I4RB 3FH7A 3CV0A 3B7SA 3VLEA 3ZYLA 2OVFA 4DPRA 4KT6B 2UWJG 1JWGA 1IQUA 5JJTA 3QB2A 2DIWA 4Y6WA 5HI7A 4I6EA 2VGXA 4NACA 3DBSA 3LKUA 3SBSA 2WVIA 3TG4A 4HXIA 5AJDA 3BG0B 4PUCA 4MRUA 2KCVA 4Y6CA 1HU3A 2FEZA 3L22A 3VLDA 3ZEFA 3LCAA 1UG3A 2GGFA 2IOSA 4WNGA 5E75A 4I2ZA 4N3AA 5BW8C 3LEWA 4HOQA 5D0OD 3WXXA 4HFGA 3NF1A 4NRHB 1ELWA 2J07A 2RG8A 2X38A 4I9EA 3CHOA 3ZYKA 4L1BA 4Q94A 2XPZA 3FHEA 3ZN3A 4A1GA 3B13A 1PC2A 4HOSA 5EKQD 5A6CA 2CFUA 1MHQA 4O6FA 2M63A 2VGXB 4GMJA 4AM9A 4EZKA 3CVXA 2E0IA 3AS4A 2WXQA 3FH5A 4AP2A 3PNTB 3CSTA 3FEYA 3MJWA 1X5BA 3I4GA 5EX0A 3ASFA 1NA3A 2NXPA 3CVVA 2WB2A 4AOFA 5J90A 3CVPA 4XI0A 5JHAA 4J8EA 3ZIMA 1U3DA 1UJJA 2V5FA 3QC1A 3CVQA 4UQYA 3P2BA 1E7VA 4GCOA 3T8MA 3AU5A 3ASGA 3KEZA 2WXJA 4OVVA 3TG5A 4DJAA 5E76A 5LOZA 4B8CB 4TV3A 1E8WA 2IFUA 4HOUA 1QQEA 4PDXA 2IONA 5G2NA 2WMNA 3HVEB 5BUZA 4LUNU 1U3CA 2J4BA 3UQ3A 1S0PA 4K0RA 4GZ3A 5CHEE 3VTYA 5KJMA 2CFZA 2WXMA 3G2VA 3OTNA 5FQ7A 3PVLA 3QK0A 3FH8A 4JHJA 4E85A 4KYOB 4TRQA 4I6GA 2LSUA 4GZ6A 4ILGA 4AEZC 2IF4A 3U9WA 1DVPA 2I9CA 2KC7A 4WNDA 1JWFA 2VJ8A 3TJPA 3CLJA 1EF1C 1EDUA 5FZQA 4PH4B 2ONDA 4OYSA 3SHFA 1L5JA 4IRUA 4DI3A 3PEVB 5AENA 2CHXA 4AV7A 4JEUA 2AWIA 2CG2A 3LJ3A 4ILIA 2XPIA 4JC8A 3NZSA 3RRMB 3CVNA 2PM7A 2QY7A 4G2VA 3HDXA 4TUUA 3ASDA 4BFRA 4DI4A 3CKCA 3GZSA 4OVUA 5BNWA 4EQFA 3ML8A 3L6AA 4B0ZA 5G55A 4AIFA 4PS7A 2R59A 2FF4A 4JA9A 2A5UA 1HS6A 4C9BB 4ANVA 3JQ1A 2Y4UA 4IN3B 2L9BA 3QARA 3CK7A 3JQ0A 3IHYA 4UWKA 4CDRA 2GRMA 3L54A 3IV0A 4XIFA 4AVXA 3K9IA 3TL5A 4CGVA 2LNIA 3ENEA 2OV8A 4A1SA 4UWFA 4GA2A 2XQ0A 2VYIA 1H0AA 3D9KA 3NZUA 3QOUA 2IOLA 4ME2A 2FBNA 2I1KA 2AW6A 2UY1A 1XGWA 3L16A 2I1JA 3PUKA 4JPSA 2CG3A 3MCXA 4P29A 5EDSA 3SNXA 2WPVA 5JJ6A 3KD7A 3LS8A 3UT4A 2V4LA 4G26A 4N2SA 3CVYA 2OVBA 1E8XA 3Q5MA 4UQXA 3CKBA 4UI9J 3NQPA 2XGSA 3PE4A 1GW6A 1SZ9A 3AS8A 3FEXA 4FHJA 2WQ6A 3TXNA 3Q47B 4LERA 4EZJA 4U07A 4WNEA 4L7TA 2XCCA 4H7XA 3QWWA 4GZ5A 4ANUA 2YINA 3ZRHA 5G05C 4N3CA 3AU4A 4UI9K 3LPZA 3GYZA 1A17A 2X3MA 4FU3A 3U4TA 4L23A 5CCMA 3ZYQA 4N2QA 1MQSA 5G05J 3D9LA 5AJLA 3ZW3A 4V3IA 3EJNA 4NQ0A 3FU5A 3APCA 1HXIA 2V0PA 4GPKA 4ANXA 2AXUA 3RRUA 3MA5A 2VSOE 3IEGA 4FJZA 2MOWA 2WMOA 2RD0A 4GYYA 1KLXA 4ACLA 4CT4A 2X6IA 3RIBA 3G2TA 3CVLA 3FY4A 3OXGA 2KCKA 2WXHA 1VDYA 3LY7A 5FWQA 2BUGA 2WXPA 4FULA 3GZ2A 3RO2A 2VSXE 3D9PA 3PEUB 2JLBA 3ZPJA 3SI5A 5DBKA 2J09A 3Q49B 4I1OB 4KZ0A 4ACKA 3CVUA 2X6FA 3B7RL 4AJWA 4WWNA 5ANRA 4E6HA 4U04A 2XRYA 3UX4A 3OAWA 1OWMA 1H19A 4RVBA 5FQ8A 5BT1A 4DLOA 2HO1A 3FUHA 4I17A 2FI7A 4XI9A 1KT1A 3FUDA 1TJFA 2E2EA 4GCNA 2WQ7A 2IJGX 2XGMA 1Z3YA 3MX3A 3ONKA 4LRZA 1Y8MA 4M3OA 3S7BA 5LP0A 3HVEA 5T8IA 3SFZA 4JEHA 1HG5A 2HM8A 4WUYA 1W3BA 3QKYA 4KXKB 2JEKA 2X6KA 5ENNA 4JZYA 4A55A 4GA1A 2A4ZA 2ZU6B 4MKTA 1WM5A 4UWHA 4Q69A 1FCHA 2YNQA 4JHRA 3LDZA 5FTPA 3CHMA 1H2UA 1PAQA 4ANWA 3L17A 2P58C 5FQ4A 1E96B 4CEMA 3EIQC 3GZ1A 4BTBA 3APFA 3RKVA 4FHKA 3MZLB 3PREA 4CDMA 4N39A 5A23A 4J6IA 3FFLA 3PS6A 3RJVA 3T5XA 3MYVA 4KMOA 5ARGA 4FLHA 1FVHA 3D9IA 5AYWD 5JJ7A 3CQCB 4FP7A 3G2WA 4LEUA 3KS2A 4PS3A 1HG2A 2QFCA 2XPYA 1JPLA 3MGBA 3R7RA 5BV0A 2HR2A 1OUVA 4CRWA 1ZBPA 4JA7A 2I6HA 1UN9A 2MHKA 3EDTB 4UWLA 2WQHA 2CHZA 2Y3AA 3PE3A 4RSYA 2FULA 3CQGB 3FUMA 3SF4A 3EIJA 3QNKA 4KVOA 2XCBA 3FU6A 4K03A 4I1MA 2LSVA 2GRLA 5C2YA 5HQ8A 4I9CA 2WXKA 4AY6A 2WM9A 5CCLA 5LCWC 4W9RA 1UN8A 5LX8A 1NP7A 1ZU2A 3C98A 4JXTA 2KZTA 1HO8A 3EHMA 4XKCA 4EPZA 2R5SA 4F1SA 3FTUA 2AXVA 3R7QA 3U64A 1EPUA 4EZLA 2LO6A 3ML9A 3FU0A 3QWPA 4DLQA 4U63A 3B7UX 3IBEA 4F53A 1H6KA 2J9QA 3BG1B 3KAEA 2GW1A 4C0MA 3ZGQA 3ONLA 4URKA 3MKRA 1H2TC 2Y4TA 3CHRA 2PM6A 3EHNA 3SZ7A 3FTSA 3LXUX 2KZTB 4QFVA 1EYHA 3SGHA 3FDHA 2VTBB 3SD5A 3CHSA 3S7JA 2IQCA 4G23A 3CEQA 3S7DA 3B7TA 4JL0A 4GAAA 4ATGA 3JUIA 3L08A 4BX9A 4NURA 2YHCA 3FWVA 2L6JA 3CHPA 3U66A 4J8SA 1P5QA 2ILRA 3D9JA 1HE8A 2VQ2A 4IULA 4L2YA 4BY6A 5CMWA 5LFAA 2J49A 2WXLA 3OXLA 1TEZA 2PQNA 4FA6A 2C2LA 3ASHA 4H7YA 4U0UA 3MKQB 1XNFA 2LAHA 4CT0A 2OOEA 3ZVVA 4A3VA 3ZHEB 4Q96A 3FU3A 1E8YA 4BSXA 5J08A 4APOA 2X6HA 2XEVA 5C1DA 3O4ZA 2J4DA 2PQRA 3ESKA 3I5PA 4B89A 4EBAA 3URZA 2L0TB 3FUEA 1INZA 4HOTA 3FUKA 3HHMA 2XHEA 2KATA 4HVBA 1ELKA 3ZFWA 4CCAA 3TGOA 1NA0A 1OWNA 2DBAA 3DPDA 3LYAA 4I1AA 3CK8A 3OXFA 3T5VA 4GZCA 4RG9A 1H2VC 4KZCA 2BTDA 4J8FA 3LY9A 5KJKA 3L13A 4MS6A 5G04C 1OWOA 5A7DB 3LY8A 2WXIA 4N3BA 1OWPA 3UT7A 4GA0A 1DNPA 1SZAA 3CIAA 3LVRE 2I2OA 4XX5A 3P1UA 3FTYA 3IHVA 3MV3B 3BEEA 4G1TA 4C0EA 3CK9A 4APFA 5KJLA 5G04J 4D10C 3PUJA 4F7AA 5FZSA 5CMYA 3E4BA 3FP3A 3CVWA 4BWRA 1PY1A 3UPVA 5T4YA 4FLBA 4UWGA 4WAFA 4J8DA 4B8AA 4G24A 4IYPA 1TJCA 2NC9A 4XZ4A 4BT8A 2J08A 3AS5A 4L2LA 4GYWA 4ILHB 3QDNA 1FVFA 1WAO1 5JHBA 3D9MA 1Z6TA 4N5CA 5FJYA 3UMVA 2VGYA 4A3TA 4G11A 1OWLA 4LCTA 5AIJA 2EQXA 4GZDA 3LVQE 4WNFA 2IU1A 4KBQA 4I2WA 3CR3A 4CGWA 2XRZA 4HS2A 2L0IA 2WXRA 3TAXA 2WXGA 5D0QD 3CGHA 3QAQA 2CHWA 3G2UA 2MRIA 4YVQC 3R9AB 2XGOA 3D9OA 3PZDA 3VLFA 4XKBA 4XE0A 3S2AA 2V8SE 3D3MA 3PH0C 1HZ4A 5BPPA 2C0MA 3CSFA 3CHQA 1E7UA 4GU5A 2BF0X 5ARFA 4DK5A 1IYGA 2HYZA 3FUJA 3QJZA 1Z3XA 1B89A 5KCMA 3Q15A 4GYOA 3RRNB 4GMLA 1SQMA 3HIZA 3PDNA 3FUNA 3U3WA 1HH8A 1HF8A 1JUQA 1BPOA 3MV2B 3RU0A 4I43A 3JYSA 2KM4A 4U8HA 3UUXA 2VTBA 1Y6IA 3S7FA 4BX8A 2WXNA 4AY5A 1ELRA 2DCPA 3ESLA 4PS8A 3JCKC 5LCWJ 5FQ6A 5DIZA 2VSNA 3VTXA 4HORA 3RK6A 3FULA 4YVOA 4ABNA 4BTAA 2AVPA 4J0UA 3I3NA 5M72A 4G25A 2C0LA 3FUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQZ A;  3ULQ A;  4BT9 A;  2PL2 A;  3ZHE A;  3GW4 A;  5KJN A;  4YND A;  4UI9 C;  3MEK A;  2YQ8 A;  5EX3 A;  4B94 A;  4U0Z A;  5FT9 A;  2PZI A;  2Q7F A;  2FO7 A;  3QWV A;  1NZN A;  2VSY A;  4F3V A;  3Q4A B;  1QZ2 A;  4U0S A;  3RO3 A;  4RG6 A;  2KCL A;  1YA0 A;  2UY1 B;  5FZR A;  3N71 A;  3O48 A;  1KT0 A;  1IHG A;  3HYM B;  3CV0 A;  2UWJ G;  5JJT A;  4Y6W A;  5HI7 A;  2VGX A;  3LKU A;  3TG4 A;  4Y6C A;  2KCV A;  2FEZ A;  3LCA A;  4WNG A;  4I2Z A;  4N3A A;  5BW8 C;  4HOQ A;  5D0O D;  3WXX A;  3NF1 A;  4NRH B;  1ELW A;  4I9E A;  3ZN3 A;  1PC2 A;  4HOS A;  5EKQ D;  5A6C A;  4O6F A;  2VGX B;  4AM9 A;  3AS4 A;  5EX0 A;  3ASF A;  1NA3 A;  3CVP A;  4XI0 A;  4J8E A;  2V5F A;  3CVQ A;  4UQY A;  4GCO A;  3ASG A;  3TG5 A;  2IFU A;  4HOU A;  1QQE A;  3UQ3 A;  5KJM A;  4GZ3 A;  5CHE E;  3VTY A;  4KYO B;  2LSU A;  4GZ6 A;  2IF4 A;  2KC7 A;  4WND A;  5FZQ A;  2OND A;  2XPI A;  3CVN A;  4G2V A;  3ASD A;  3CKC A;  5BNW A;  4EQF A;  4AIF A;  2FF4 A;  4JA9 A;  2Y4U A;  4IN3 B;  4GPK A;  3CK7 A;  4CDR A;  4CGV A;  4XIF A;  3K9I A;  2LNI A;  4A1S A;  4GA2 A;  2VYI A;  4ME2 A;  3QOU A;  2FBN A;  2UY1 A;  2WPV A;  5JJ6 A;  3KD7 A;  4G26 A;  4N2S A;  3Q5M A;  4UQX A;  3CKB A;  4UI9 J;  3PE4 A;  2XGS A;  3AS8 A;  3Q47 B;  4U07 A;  4WNE A;  2XCC A;  4H7X A;  3QWW A;  4GZ5 A;  5G05 C;  4N3C A;  4UI9 K;  3LPZ A;  3GYZ A;  1A17 A;  3U4T A;  5CCM A;  4N2Q A;  5G05 J;  4NQ0 A;  1HXI A;  3MA5 A;  3IEG A;  4GYY A;  1KLX A;  3RIB A;  3CVL A;  3OXG A;  2KCK A;  3LY7 A;  2BUG A;  3GZ2 A;  3RO2 A;  2JLB A;  3ZPJ A;  5DBK A;  3Q49 B;  4U04 A;  5BT1 A;  2HO1 A;  4I17 A;  2FI7 A;  4XI9 A;  1KT1 A;  4GCN A;  2E2E A;  2XGM A;  1Y8M A;  3S7B A;  4WUY A;  1W3B A;  3QKY A;  4KXK B;  4GA1 A;  1WM5 A;  1FCH A;  4JHR A;  5FTP A;  2P58 C;  1E96 B;  4BTB A;  3GZ1 A;  3RKV A;  4N39 A;  3FFL A;  3RJV A;  5ARG A;  5AYW D;  5JJ7 A;  4LEU A;  3KS2 A;  2QFC A;  2HR2 A;  1OUV A;  1ZBP A;  4JA7 A;  2I6H A;  2MHK A;  3EDT B;  2WQH A;  3PE3 A;  3SF4 A;  2XCB A;  2LSV A;  5HQ8 A;  4AY6 A;  4I9C A;  5CCL A;  5LCW C;  4W9R A;  1ZU2 A;  2R5S A;  3QWP A;  2J9Q A;  3KAE A;  2GW1 A;  3ZGQ A;  3MKR A;  2Y4T A;  3SZ7 A;  3S7J A;  4G23 A;  3CEQ A;  3S7D A;  4JL0 A;  2YHC A;  3FWV A;  2L6J A;  1P5Q A;  2VQ2 A;  3OXL A;  2PQN A;  2C2L A;  3ASH A;  4U0U A;  4H7Y A;  1XNF A;  2OOE A;  3ZHE B;  4APO A;  2XEV A;  5C1D A;  2PQR A;  3ESK A;  3URZ A;  4HOT A;  2KAT A;  3ZFW A;  3TGO A;  1NA0 A;  2DBA A;  3LYA A;  4I1A A;  3CK8 A;  3OXF A;  4RG9 A;  4J8F A;  3LY9 A;  5KJK A;  5G04 C;  5A7D B;  3LY8 A;  4N3B A;  4GA0 A;  4G1T A;  3MV3 B;  3BEE A;  3CK9 A;  5KJL A;  5G04 J;  5FZS A;  3E4B A;  3FP3 A;  4BWR A;  3UPV A;  4J8D A;  4G24 A;  1TJC A;  2NC9 A;  4BT8 A;  3AS5 A;  4GYW A;  3QDN A;  1WAO 1;  4N5C A;  5FJY A;  2VGY A;  4WNF A;  4CGW A;  4KBQ A;  4I2W A;  3TAX A;  5D0Q D;  4YVQ C;  3R9A B;  2XGO A;  1HZ4 A;  2C0M A;  5ARF A;  1IYG A;  2HYZ A;  1B89 A;  3Q15 A;  4GYO A;  3PDN A;  3U3W A;  1HH8 A;  3MV2 B;  3RU0 A;  3JYS A;  3UUX A;  3S7F A;  4AY5 A;  1ELR A;  5LCW J;  5DIZ A;  2VSN A;  3VTX A;  4HOR A;  4YVO A;  4ABN A;  4BTA A;  2AVP A;  4J0U A;  5M72 A;  4G25 A;  2C0L A; 
#chains in the Genus database with same CATH topology
 4UQZ A;  3G2S A;  3ULQ A;  2NSZ A;  3MKQ A;  5AQB A;  1N0Q A;  2HE0 A;  5BV1 A;  3Q78 A;  3F6Q A;  3UM2 A;  4YND A;  1HFA A;  3IKO B;  4CDN A;  3MEK A;  2YQ8 A;  5EX3 A;  4B94 A;  3BQO A;  2Q7F A;  4FJY A;  2FO7 A;  4JW1 A;  2VSY A;  4JVS A;  4HRM B;  1TR4 A;  1NFI E;  3ZXS A;  3RO3 A;  3PNL B;  1IQR A;  4R7L A;  5BXO A;  4AXH A;  4I6J A;  4O1P A;  3SBT B;  2BKG A;  3O48 A;  5ANL A;  4EBA G;  1S63 A;  3B7S A;  4ZHB A;  4KT6 B;  2P9S G;  1IQU A;  5JJT A;  2DIW A;  1N4R A;  4NAC A;  4YDO A;  5D2M C;  4MRU A;  3L22 A;  1UG3 A;  2GGF A;  4WNG A;  1A5E A;  3WXX A;  4HFG A;  3NF1 A;  2J07 A;  3CHO A;  4QQI A;  3B13 A;  1PC2 A;  3CVX A;  4O6F A;  1MHQ A;  4EZK A;  2M63 A;  4AM9 A;  2E0I A;  2WXQ A;  4DLO A;  5EX0 A;  3I4G A;  5J90 A;  3CVP A;  4XI0 A;  5JHA A;  1E7V A;  3AU5 A;  1K1B A;  2WXJ A;  4L9P A;  2WMN A;  3RAU A;  4LUN U;  1U3C A;  4K0R A;  4NIK A;  5CHE E;  2WXM A;  5FQ7 A;  3QK0 A;  3FH8 A;  3X2Q E;  4E85 A;  3EU5 A;  2LSU A;  4AEZ C;  2IF4 A;  2KC7 A;  5FZQ A;  3D9H A;  3SHF A;  1N4Q A;  4AV7 A;  3LJ3 A;  4JC8 A;  3RRM B;  1O1R A;  2R05 A;  2ETA A;  4BFR A;  3ASD A;  3GZS A;  4LNG A;  2R59 A;  4JA9 A;  2A5U A;  4C9B B;  5B1A E;  4IN3 B;  3QAR A;  3IHY A;  4UWK A;  2GRM A;  4AVX A;  3K9I A;  1KZO A;  2OV8 A;  2VYI A;  3NZU A;  4ME2 A;  2EIN E;  1N0R A;  3J5Q B;  4JPS A;  1XGW A;  3PUK A;  1LD8 A;  2OVB A;  3Q9N C;  1O1S A;  4UI9 J;  3C3R A;  4FHJ A;  2WQ6 A;  3TXN A;  4EZJ A;  1FT1 A;  1JCS A;  1TN7 A;  5EID A;  3L82 A;  2DWZ A;  1A17 A;  2X3M A;  4FU3 A;  4L23 A;  4NQ0 A;  1HXI A;  4ANX A;  3RRU A;  3IEG A;  4FJZ A;  3TWU A;  1KLX A;  4CT4 A;  2BED A;  2Y69 E;  3NOG D;  3OXG A;  1VDY A;  3LY7 A;  2BUG A;  3PEU B;  2JLB A;  3CVU A;  2X6F A;  3UX4 A;  3OAW A;  1MJ0 A;  3FUD A;  1Z3Y A;  3MX3 A;  1Y8M A;  3Q7A A;  3QKY A;  1TN8 A;  3PZ2 A;  4JZY A;  1O5M A;  2A4Z A;  4GTQ A;  2YNQ A;  3ABK E;  4BTB A;  4FHK A;  3PRE A;  1K1A A;  2GRO B;  4TUM A;  5ARG A;  1UOH A;  4DRX E;  3W9F A;  5AYW D;  3G2W A;  4PS3 A;  2QFC A;  3MGB A;  2RFM A;  1OUV A;  5D66 A;  2MHK A;  3DSV A;  1TNZ A;  3CQG B;  4KVO A;  5C2Y A;  4RLY A;  2GRL A;  5CCL A;  1OCC E;  5LCW C;  5LX8 A;  5EYP F;  1NP7 A;  3C98 A;  4JXT A;  3HXE A;  3EHM A;  1N11 A;  4MBG A;  2DYS E;  1EPU A;  4A63 B;  3WG7 E;  4U63 A;  3ULY A;  4K5C A;  3ONL A;  1TYQ G;  2Y4T A;  3SZ7 A;  3FTS A;  2KZT B;  3SGH A;  5KNH D;  2IEJ A;  4ATG A;  4BX9 A;  4NUR A;  2YHC A;  3CHP A;  3U66 A;  4J8S A;  1HE8 A;  3AG1 E;  2J49 A;  2PQN A;  1V54 E;  1K3Z D;  3MKQ B;  1XNF A;  3UKR G;  4G8L A;  5CBO A;  5J08 A;  4APO A;  2X6H A;  2XEV A;  4TXQ A;  5C1D A;  3TWW A;  2PQR A;  1WDY A;  3DSW A;  3FUE A;  1N94 A;  1ELK A;  3ZFW A;  4CCA A;  2DBA A;  4I1A A;  3SQV A;  4KZC A;  2BTD A;  3LY9 A;  3L13 A;  1OWO A;  2WXI A;  1DNP A;  3CIA A;  4HRN A;  4XX5 A;  3P1U A;  3FTY A;  3IHV A;  3BEE A;  3CK9 A;  3PUJ A;  5FZS A;  3E4B A;  4BWR A;  1PY1 A;  4G24 A;  4XZ4 A;  4BT8 A;  4L2L A;  4GYW A;  4ILH B;  3QDN A;  3D9M A;  3B95 A;  3NB2 A;  3E33 A;  5AIJ A;  1OWL A;  2XS8 A;  2EQX A;  4WNF A;  2IU1 A;  4HS2 A;  3CGH A;  5CRU A;  3QAQ A;  2CHW A;  3G2U A;  4YVQ C;  3ZXP A;  2ZGD A;  5BPP A;  2C0M A;  3CSF A;  3TWX A;  4DK5 A;  1IYG A;  3FUJ A;  2ZXW E;  5FIO A;  5KCM A;  2F8Y A;  5AAR A;  1HF8 A;  3MV2 B;  1JUQ A;  4I43 A;  2VTB A;  2WXN A;  4AY5 A;  1ELR A;  3RK6 A;  2R2L A;  3FUL A;  4GTR A;  4J0U A;  3FUF A;  1LF8 A;  2PL2 A;  3GW4 A;  3ZYM A;  3DSX A;  4UI9 C;  4FC8 A;  4FAD A;  2WXO A;  4JHK A;  1E8Z A;  4U0Z A;  3DSS A;  1JCR A;  2WXF A;  4ATZ D;  3QWV A;  1H6O A;  1UJK A;  3PRZ A;  2YHE A;  5EYL A;  4KVM A;  3TWQ A;  3FUI A;  1WY6 A;  5FZR A;  4EEC A;  3FTZ A;  3L9T A;  3UIN C;  1IHG A;  3HXD A;  3FH7 A;  3VLE A;  3ZYL A;  2UWJ G;  5AAO A;  3DBS A;  2WVI A;  4PUC A;  4Y6C A;  1N4P A;  4N3A A;  4HOQ A;  2KBX A;  5B1B E;  1YCS B;  2X38 A;  4I9E A;  4M7C A;  3ZYK A;  5BXU A;  3UM0 A;  5HS0 A;  3ZN3 A;  2F0Y A;  2CFU A;  2VGX B;  5KBA A;  3FH5 A;  3PNT B;  1X5B A;  2NXP A;  3CVV A;  2WB2 A;  1U3D A;  2IO3 C;  4UQY A;  3T8M A;  3ASG A;  3KEZ A;  3TG5 A;  5JMN D;  5AQ9 A;  1E8W A;  2IFU A;  1QQE A;  1KZP A;  2LXM A;  2ZIS A;  5BUZ A;  3UXG A;  3UQ3 A;  2CFZ A;  2AJA A;  3G2V A;  3OTN A;  3DEO A;  4ILG A;  3TJP A;  4WND A;  2VJ8 A;  1EDU A;  4PH4 B;  3AAA C;  5AEN A;  2XEH A;  3NZS A;  2PM7 A;  4G2V A;  4DI4 A;  4OVU A;  3AG3 E;  3L6A A;  2XEE A;  5G55 A;  4AIF A;  4PS7 A;  2FF4 A;  4ANV A;  2Y4U A;  3JQ0 A;  3L54 A;  3IV0 A;  2FO1 E;  4GA2 A;  2XQ0 A;  3QOU A;  2IOL A;  2J8S D;  4Z68 A;  2I1K A;  2UY1 A;  3L16 A;  2CG3 A;  5JJ6 A;  3FEX A;  3T8K A;  2H6G A;  3Q47 B;  1NI1 A;  4DX7 D;  1N9A A;  4GZ5 A;  5G05 C;  5ENO D;  4N3C A;  3AU4 A;  3DXK G;  4N2Q A;  2RKK A;  2EIM E;  3ZW3 A;  5AJL A;  3EJN A;  2VSO E;  2DYR E;  1BU9 A;  2X6I A;  3HXB A;  2WXH A;  3RO2 A;  2VSX E;  3D9P A;  4O60 A;  3SI5 A;  5DBK A;  4I1O B;  4KZ0 A;  4WWN A;  4E6H A;  1DCE A;  1S64 A;  2EIJ E;  4I17 A;  4XI9 A;  1KT1 A;  1TJF A;  4GCN A;  3ONK A;  4LRZ A;  3HVE A;  1HG5 A;  5FIN A;  2Y0B G;  1V55 E;  2JEK A;  4LNU D;  2A5E A;  3Q73 A;  2XEN A;  4JHR A;  1H2U A;  3L17 A;  3V79 K;  5FQ4 A;  1E96 B;  3GZ1 A;  3APF A;  4CDM A;  5A23 A;  4J6I A;  3FFL A;  3PS6 A;  3T5X A;  3MYV A;  4KMO A;  4FLH A;  5JJ7 A;  3CQC B;  5CED B;  1JPL A;  3R9M A;  2HR2 A;  3DRA A;  1ZBP A;  4JA7 A;  2I6H A;  4UWL A;  2WQH A;  2CHZ A;  3TWR A;  2Y3A A;  3PE3 A;  3UIO C;  3QNK A;  4I1M A;  4AY6 A;  4I9C A;  1AWC B;  1ZU2 A;  3DSU A;  2RFA A;  5EN5 D;  3PZ4 A;  3ASO E;  2LO6 A;  2VGE A;  4DLQ A;  3IBE A;  4F53 A;  3B7B A;  4C0M A;  3V31 A;  1AP7 A;  3FDH A;  2VTB B;  3SD5 A;  3CHS A;  2IQC A;  3CEQ A;  3B7T A;  3L08 A;  1P5Q A;  3D9J A;  4L2Y A;  1U2V G;  4HRL A;  3E37 A;  3EHQ A;  4J8Y A;  2H6I A;  1TNO A;  2XS1 A;  3ASH A;  1ZB1 A;  4H7Y A;  4U0U A;  2OOE A;  3V2X A;  2ZIR A;  4Q96 A;  3E32 A;  2QC9 A;  3I5P A;  1KPS B;  3URZ A;  2L0T B;  1INZ A;  4HOT A;  3HHM A;  2KAT A;  3C72 A;  3TGO A;  1NA0 A;  1OWN A;  4LG6 A;  3T5V A;  4RG9 A;  1H2V C;  3SO8 A;  4DX6 D;  4MS6 A;  3Q9U C;  5G04 C;  5A7D B;  3LY8 A;  2P2C P;  3ABL E;  4G1T A;  3MV3 B;  4C0E A;  3UM1 A;  4D10 C;  3CVW A;  2H6F A;  4RQI A;  5H7P A;  4UWG A;  3AJI A;  4J8D A;  4B8A A;  4F6R D;  1FVF A;  1Z6T A;  4N5C A;  1BLX B;  4G11 A;  1TNU A;  4GTT A;  4KBQ A;  4I2W A;  4U8Y D;  4K5B A;  2XRZ A;  4DX1 A;  2L0I A;  3TAX A;  3R9A B;  2XGO A;  3D9O A;  3PZD A;  4XKB A;  4XE0 A;  3S2A A;  2ETC A;  3D3M A;  1HZ4 A;  4O1O A;  4GU5 A;  2BF0 X;  5ARF A;  3NOC D;  4GYO A;  1SQM A;  5CER B;  3JYS A;  4PS8 A;  3JCK C;  2VSN A;  4YVO A;  2AVP A;  2OEV A;  4G25 A;  1E90 A;  3TWS A;  4BT9 A;  1BI7 B;  5ENQ D;  4F1P A;  4WWP A;  3FTX A;  5KJN A;  4WWO A;  3APD A;  1IXV A;  1N54 A;  3ABM E;  4ZFH A;  2PZI A;  3UTM A;  3UT8 A;  1HX8 A;  1MYO A;  4F3V A;  3Q4A B;  4GB9 A;  2KCL A;  1OCO E;  3ZKJ A;  3Q7F A;  1UW4 B;  1YA0 A;  3PZ1 A;  4U96 D;  2UY1 B;  3FTV A;  4N5Q A;  2GRN B;  4HLE A;  1KT0 A;  3HYM B;  1TNY A;  5JA4 D;  1N95 A;  1JWG A;  3LKU A;  3SBS A;  3TG4 A;  5AJD A;  2KCV A;  1HU3 A;  2FEZ A;  4B93 B;  2IOS A;  1SVX A;  4I2Z A;  5BW8 C;  3LEW A;  5D0O D;  1FT2 A;  4L1B A;  4Q94 A;  3FHE A;  2L6B A;  4HOS A;  1MX6 A;  5EKQ D;  3HXF A;  3CST A;  3MJW A;  3ASF A;  1DC2 A;  3ZIM A;  1UJJ A;  3CVQ A;  3P2B A;  2GRP B;  5E76 A;  5LOZ A;  2XZT G;  4PDX A;  3HVE B;  4UUC A;  2P9K G;  2J4B A;  1S0P A;  4GZ3 A;  3VTY A;  4TRQ A;  4I6G A;  4GZ6 A;  3U9W A;  2I9C A;  3CLJ A;  3ZUV B;  1EF1 C;  2OND A;  4YDY A;  1L5J A;  4DI3 A;  3PEV B;  2CHX A;  4JEU A;  3Q75 A;  2CG2 A;  4ILI A;  4JD2 G;  1G3N B;  3UKU G;  3ZU7 B;  4TUU A;  3CKC A;  2V4H C;  3JQ1 A;  4GPK A;  3CK7 A;  3TL5 A;  2LNI A;  3NAW A;  3UM3 A;  3D9K A;  3NBN B;  5EDS A;  3SNX A;  3UT4 A;  2V4L A;  4G26 A;  4N2S A;  1E8X A;  4UQX A;  4JB8 P;  3CKB A;  2XGS A;  1OCZ E;  3AS8 A;  2OCC E;  4WNE A;  4ANU A;  2YIN A;  1NL4 A;  3ZRH A;  4YDW A;  4UI9 K;  3LPZ A;  4OAV B;  1FPP A;  1LD7 A;  3ZYQ A;  3KSQ A;  2F37 A;  4GTV A;  3TWV A;  3ZNG A;  3APC A;  3ASN E;  2WMO A;  2RD0 A;  4GYY A;  3SY2 A;  5KWD A;  3G2T A;  3FY4 A;  4DUI A;  3E30 A;  3JUE A;  3GZ2 A;  5HKP A;  2R02 A;  2J09 A;  3Q49 B;  4ACK A;  3B7R L;  5ANR A;  4U04 A;  2XRY A;  1H19 A;  5FQ8 A;  5BT1 A;  2HO1 A;  3FUH A;  3EHR A;  2FI7 A;  3ISM C;  2WQ7 A;  2IJG X;  3S7B A;  2HM8 A;  3HRA A;  2PNN A;  2H6H A;  4BET A;  4GA1 A;  4MKT A;  5AN8 A;  1WM5 A;  1LTX A;  3LDZ A;  5FTP A;  2ETB A;  1RW2 A;  1PAQ A;  4ANW A;  1D8D A;  2P58 C;  1SA4 A;  3MZL B;  4N39 A;  3RJV A;  2QYJ A;  1FVH A;  3D9I A;  2P9U G;  1JCQ A;  4FP7 A;  4LEU A;  3KS2 A;  1HG2 A;  2XPY A;  5ENT D;  3R7R A;  2GRQ B;  4RSY A;  2FUL A;  4HNA D;  1OY3 D;  2XCB A;  5HQ8 A;  4BER A;  1RZ4 A;  1UN8 A;  2IY0 C;  2KZT A;  1HO8 A;  4LSZ E;  1X81 A;  2R03 A;  4F1S A;  3FTU A;  2AXV A;  1QBQ A;  3U64 A;  1MZC A;  3QWP A;  4DX2 A;  2GW1 A;  3ZGQ A;  3W9G A;  3MKR A;  2PM6 A;  3EHN A;  2P9I G;  3LXU X;  1EYH A;  3S7J A;  4G23 A;  3S7D A;  4JL0 A;  4GAA A;  1N4S A;  3JUI A;  2JAB A;  2ILR A;  5LFA A;  5CMW A;  1TEZ A;  4FA6 A;  2C2L A;  4CT0 A;  4A3V A;  2LXL A;  3FU3 A;  5AQ7 A;  4BSX A;  3O4Z A;  2J4D A;  1O1T A;  3ESK A;  4EBA A;  2DZO A;  2XHE A;  3DEP A;  3LYA A;  3OXF A;  4GZC A;  4J8F A;  5KJK A;  4TXP A;  2QZA A;  4N3B A;  1OWP A;  4GA0 A;  4J7W A;  2I2O A;  1OT8 A;  4F7A A;  5CMY A;  3JXI A;  3UPV A;  4FLB A;  3PZ3 A;  3UIP C;  3AS5 A;  2NYJ A;  4GPM A;  5CBN A;  5JHB A;  5FJY A;  2VGY A;  3DXM G;  4GZD A;  4BES A;  4CGW A;  3CR3 A;  4X8Q A;  2WXG A;  3IXE A;  5D0Q D;  3J5P A;  2MRI A;  3VLF A;  2V8S E;  1E7U A;  3KEA A;  4U95 D;  3AG4 E;  5HRY A;  4BEP A;  2HYZ A;  2LUH A;  3V30 A;  5KNG A;  3RRN B;  4C48 B;  3HIZ A;  1HH8 A;  1BPO A;  3RU0 A;  2KM4 A;  4BX8 A;  2DCP A;  3ESL A;  5FQ6 A;  4HOR A;  2EIL E;  3Q79 A;  4BTA A;  3I3N A;  5M72 A;  3HG0 D;  2LAI A;  2DVW A;  1Q2Z A;  2R17 C;  2BKK B;  2AXZ A;  2X6J A;  3ZHE A;  2XZD G;  3TXM A;  4CZ2 D;  5FT9 A;  3T9K A;  3TWT A;  1MX2 A;  5T3R A;  4HB5 A;  4MLP A;  1NZN A;  3D9N A;  4GTM A;  1QZ2 A;  4U0S A;  3FTW A;  4RG6 A;  3V2O A;  1QNF A;  5CRV A;  1N52 A;  3N71 A;  3EU9 A;  3I4R B;  3CV0 A;  5CEA A;  4DPR A;  2OVF A;  3C5R A;  4HLL A;  2ZGG A;  3QB2 A;  4Y6W A;  5HI7 A;  4I6E A;  2Y1L E;  2VGX A;  1SW6 A;  4HXI A;  3BG0 B;  3EUV A;  3VLD A;  3SFX A;  3ZEF A;  3LCA A;  5E75 A;  3SFY A;  4OAU C;  4NRH B;  1ELW A;  2RG8 A;  4HBD A;  3BU8 A;  2XPZ A;  4A1G A;  1BI8 B;  4BSZ B;  5A6C A;  5IY5 E;  4GMJ A;  1OXJ A;  3DWL G;  3AS4 A;  4AP2 A;  3FEY A;  1NA3 A;  4AOF A;  1SA5 A;  4J8E A;  2V5F A;  3QC1 A;  4GCO A;  4OVV A;  2P9P G;  4DJA A;  4HI8 A;  4B8C B;  4GTS A;  4TV3 A;  4HOU A;  2ION A;  5G2N A;  5KJM A;  1IKN D;  1H6P A;  3PVL A;  4JHJ A;  4KYO B;  1DVP A;  1JWF A;  2EIK E;  4OYS A;  4IRU A;  2AWI A;  2XPI A;  3CVN A;  2QY7 A;  3HDX A;  2P9L G;  5BNW A;  4EQF A;  3ML8 A;  4B0Z A;  5CEC B;  4YDE A;  1HS6 A;  2L9B A;  4CDR A;  4CGV A;  4XIF A;  2GRR B;  3ENE A;  4A1S A;  4UWF A;  4G8K A;  1H0A A;  2FBN A;  3AG2 E;  2AW6 A;  1IHB A;  2I1J A;  3LJN A;  3MCX A;  4P29 A;  3JXJ A;  2WPV A;  3KD7 A;  3LS8 A;  3CVY A;  3Q5M A;  2F8X K;  3KSL A;  3NQP A;  3PE4 A;  2B6C A;  5B3S E;  1GW6 A;  1SZ9 A;  4LER A;  4U07 A;  4L7T A;  2XCC A;  4H7X A;  3QWW A;  3BUA A;  5ENP D;  3GYZ A;  3U4T A;  5CCM A;  1MQS A;  5G05 J;  4EHM A;  3D9L A;  4GMR A;  1D8E A;  4V3I A;  1K8K G;  3FU5 A;  2V0P A;  5ENS D;  2AXU A;  2DZN A;  4HQD A;  3MA5 A;  2MOW A;  4ACL A;  2KXP C;  3RIB A;  3CVL A;  4TXR A;  5FWQ A;  2KCK A;  2WXP A;  4FUL A;  3ULE G;  5AQA A;  3ZPJ A;  4AJW A;  4RVB A;  1OWM A;  4GTP A;  2E2E A;  2XGM A;  4M3O A;  5LP0 A;  5T8I A;  3SFZ A;  4JEH A;  4WUY A;  1W3B A;  4KXK B;  2X6K A;  1Z5S C;  5ENN A;  4A55 A;  4U7E B;  2ZU6 B;  2QYU A;  4UWH A;  4Q69 A;  1FCH A;  4CYM D;  3CHM A;  3DPY A;  4CEM A;  3EIQ C;  4DX5 D;  3RKV A;  3UI2 A;  4HI9 A;  1YMP A;  3DST A;  4XEI G;  5EIL A;  5BV0 A;  4CRW A;  1UN9 A;  3EDT B;  3FUM A;  4GTO A;  3SF4 A;  3EIJ A;  3FU6 A;  4K03 A;  2LSV A;  2WXK A;  2WM9 A;  3RSE G;  4W9R A;  3C3Q A;  2IO2 C;  3HXC A;  4XKC A;  4EPZ A;  2R5S A;  5ITZ F;  2P9N G;  3R7Q A;  4EZL A;  3ML9 A;  1MX4 A;  3FU0 A;  3B7U X;  1H6K A;  1S70 B;  1YYH A;  2J9Q A;  3BG1 B;  3KAE A;  4URK A;  1H2T C;  3CHR A;  4QFV A;  5ENR D;  3FWV A;  2L6J A;  4IUL A;  2VQ2 A;  4BY6 A;  2WXL A;  3OXL A;  1TN6 A;  3C3O A;  2LAH A;  2MYO A;  3ZVV A;  3ZHE B;  1E8Y A;  4B89 A;  3FUK A;  2OEW A;  4HVB A;  3DPD A;  1QYM A;  3CK8 A;  3E34 A;  1WG0 A;  2V5Q C;  3UT7 A;  1SZA A;  3LVR E;  4APF A;  5KJL A;  5G04 J;  3FP3 A;  5T4Y A;  1DCQ A;  4WAF A;  4IYP A;  1TJC A;  2NC9 A;  2J08 A;  4LNB A;  1WAO 1;  4U8V D;  3UMV A;  4A3T A;  1BD8 A;  4LCT A;  3LVQ E;  1TNB A;  2WXR A;  3PH0 C;  3CHQ A;  3QJZ A;  1Z3X A;  1B89 A;  3Q15 A;  4GML A;  3PDN A;  3FUN A;  3U3W A;  4U8H A;  3UUX A;  2B0O E;  1Y6I A;  3S7F A;  4K5A B;  5EIB E;  5LCW J;  5DIZ A;  3VTX A;  4ABN A;  1OCR E;  1D9S A;  2C0L A; 
#chains in the Genus database with same CATH homology
 1E90 A;  1LF8 A;  4UQZ A;  3G2S A;  2LAI A;  3ULQ A;  2NSZ A;  3MKQ A;  4BT9 A;  2PL2 A;  4WWP A;  2R17 C;  5BV1 A;  2AXZ A;  2X6J A;  3ZHE A;  3GW4 A;  3ZYM A;  3FTX A;  5KJN A;  4YND A;  1HFA A;  4UI9 C;  4WWO A;  4FC8 A;  4FAD A;  2WXO A;  3IKO B;  4CDN A;  3APD A;  3MEK A;  2YQ8 A;  4JHK A;  5EX3 A;  3TXM A;  4B94 A;  1E8Z A;  4U0Z A;  1N54 A;  5FT9 A;  2PZI A;  2Q7F A;  3UT8 A;  1HX8 A;  4FJY A;  2FO7 A;  2WXF A;  4JW1 A;  5T3R A;  4MLP A;  3QWV A;  1NZN A;  2VSY A;  4F3V A;  4JVS A;  3Q4A B;  4GB9 A;  3D9N A;  1UJK A;  3PRZ A;  3ZXS A;  1QZ2 A;  2YHE A;  4U0S A;  3RO3 A;  3PNL B;  3FTW A;  4RG6 A;  1IQR A;  2KCL A;  4KVM A;  1UW4 B;  1YA0 A;  1QNF A;  4R7L A;  3FUI A;  2UY1 B;  1WY6 A;  4AXH A;  3FTV A;  4I6J A;  3SBT B;  5FZR A;  1N52 A;  3N71 A;  4EEC A;  3O48 A;  4HLE A;  3FTZ A;  1KT0 A;  1IHG A;  5ANL A;  4EBA G;  3HYM B;  3I4R B;  3FH7 A;  3CV0 A;  3B7S A;  3VLE A;  3ZYL A;  2OVF A;  4DPR A;  4KT6 B;  2UWJ G;  1JWG A;  1IQU A;  5JJT A;  3QB2 A;  2DIW A;  4Y6W A;  5HI7 A;  4I6E A;  2VGX A;  4NAC A;  3DBS A;  3LKU A;  3SBS A;  2WVI A;  3TG4 A;  4HXI A;  5AJD A;  3BG0 B;  4PUC A;  4MRU A;  2KCV A;  4Y6C A;  1HU3 A;  2FEZ A;  3L22 A;  3VLD A;  3ZEF A;  3LCA A;  1UG3 A;  2GGF A;  2IOS A;  4WNG A;  5E75 A;  4I2Z A;  4N3A A;  5BW8 C;  3LEW A;  4HOQ A;  5D0O D;  3WXX A;  4HFG A;  3NF1 A;  4NRH B;  1ELW A;  2J07 A;  2RG8 A;  2X38 A;  4I9E A;  3CHO A;  3ZYK A;  4L1B A;  4Q94 A;  2XPZ A;  3FHE A;  3ZN3 A;  4A1G A;  3B13 A;  1PC2 A;  4HOS A;  5EKQ D;  5A6C A;  2CFU A;  1MHQ A;  4O6F A;  2M63 A;  2VGX B;  4GMJ A;  4AM9 A;  4EZK A;  3CVX A;  2E0I A;  3AS4 A;  2WXQ A;  3FH5 A;  4AP2 A;  3PNT B;  3CST A;  3FEY A;  3MJW A;  1X5B A;  3I4G A;  5EX0 A;  3ASF A;  1NA3 A;  2NXP A;  3CVV A;  2WB2 A;  4AOF A;  5J90 A;  3CVP A;  4XI0 A;  5JHA A;  4J8E A;  3ZIM A;  1U3D A;  1UJJ A;  2V5F A;  3QC1 A;  3CVQ A;  4UQY A;  3P2B A;  1E7V A;  4GCO A;  3T8M A;  3AU5 A;  3ASG A;  3KEZ A;  2WXJ A;  4OVV A;  3TG5 A;  4DJA A;  5E76 A;  5LOZ A;  4B8C B;  4TV3 A;  1E8W A;  2IFU A;  4HOU A;  1QQE A;  4PDX A;  2ION A;  5G2N A;  2WMN A;  3HVE B;  5BUZ A;  4LUN U;  1U3C A;  2J4B A;  3UQ3 A;  1S0P A;  4K0R A;  4GZ3 A;  5CHE E;  3VTY A;  5KJM A;  2CFZ A;  2WXM A;  3G2V A;  3OTN A;  5FQ7 A;  3PVL A;  3QK0 A;  3FH8 A;  4JHJ A;  4E85 A;  4KYO B;  4TRQ A;  4I6G A;  2LSU A;  4GZ6 A;  4ILG A;  4AEZ C;  2IF4 A;  3U9W A;  1DVP A;  2I9C A;  2KC7 A;  4WND A;  1JWF A;  2VJ8 A;  3TJP A;  3CLJ A;  1EF1 C;  1EDU A;  5FZQ A;  4PH4 B;  2OND A;  4OYS A;  3SHF A;  1L5J A;  4IRU A;  4DI3 A;  3PEV B;  5AEN A;  2CHX A;  4AV7 A;  4JEU A;  2AWI A;  2CG2 A;  3LJ3 A;  4ILI A;  2XPI A;  4JC8 A;  3NZS A;  3RRM B;  3CVN A;  2PM7 A;  2QY7 A;  4G2V A;  3HDX A;  4TUU A;  3ASD A;  4BFR A;  4DI4 A;  3CKC A;  3GZS A;  4OVU A;  5BNW A;  4EQF A;  3ML8 A;  3L6A A;  4B0Z A;  5G55 A;  4AIF A;  4PS7 A;  2R59 A;  2FF4 A;  4JA9 A;  2A5U A;  1HS6 A;  4C9B B;  4ANV A;  3JQ1 A;  2Y4U A;  4IN3 B;  2L9B A;  3QAR A;  3CK7 A;  3JQ0 A;  3IHY A;  4UWK A;  4CDR A;  2GRM A;  3L54 A;  3IV0 A;  4XIF A;  4AVX A;  3K9I A;  3TL5 A;  4CGV A;  2LNI A;  3ENE A;  2OV8 A;  4A1S A;  4UWF A;  4GA2 A;  2XQ0 A;  2VYI A;  1H0A A;  3D9K A;  3NZU A;  3QOU A;  2IOL A;  4ME2 A;  2FBN A;  2I1K A;  2AW6 A;  2UY1 A;  1XGW A;  3L16 A;  2I1J A;  3PUK A;  4JPS A;  2CG3 A;  3MCX A;  4P29 A;  5EDS A;  3SNX A;  2WPV A;  5JJ6 A;  3KD7 A;  3LS8 A;  3UT4 A;  2V4L A;  4G26 A;  4N2S A;  3CVY A;  2OVB A;  1E8X A;  3Q5M A;  4UQX A;  3CKB A;  4UI9 J;  3NQP A;  2XGS A;  3PE4 A;  1GW6 A;  1SZ9 A;  3AS8 A;  3FEX A;  4FHJ A;  2WQ6 A;  3TXN A;  3Q47 B;  4LER A;  4EZJ A;  4U07 A;  4WNE A;  4L7T A;  2XCC A;  4H7X A;  3QWW A;  4GZ5 A;  4ANU A;  2YIN A;  3ZRH A;  5G05 C;  4N3C A;  3AU4 A;  4UI9 K;  3LPZ A;  3GYZ A;  1A17 A;  2X3M A;  4FU3 A;  3U4T A;  4L23 A;  5CCM A;  3ZYQ A;  4N2Q A;  1MQS A;  5G05 J;  3D9L A;  5AJL A;  3ZW3 A;  4V3I A;  3EJN A;  4NQ0 A;  3FU5 A;  3APC A;  1HXI A;  2V0P A;  4GPK A;  4ANX A;  2AXU A;  3RRU A;  3MA5 A;  2VSO E;  3IEG A;  4FJZ A;  2MOW A;  2WMO A;  2RD0 A;  4GYY A;  1KLX A;  4ACL A;  4CT4 A;  2X6I A;  3RIB A;  3G2T A;  3CVL A;  3FY4 A;  3OXG A;  2KCK A;  2WXH A;  1VDY A;  3LY7 A;  5FWQ A;  2BUG A;  2WXP A;  4FUL A;  3GZ2 A;  3RO2 A;  2VSX E;  3D9P A;  3PEU B;  2JLB A;  3ZPJ A;  3SI5 A;  5DBK A;  2J09 A;  3Q49 B;  4I1O B;  4KZ0 A;  4ACK A;  3CVU A;  2X6F A;  3B7R L;  4AJW A;  4WWN A;  5ANR A;  4E6H A;  4U04 A;  2XRY A;  3UX4 A;  3OAW A;  1OWM A;  1H19 A;  4RVB A;  5FQ8 A;  5BT1 A;  4DLO A;  2HO1 A;  3FUH A;  4I17 A;  2FI7 A;  4XI9 A;  1KT1 A;  3FUD A;  1TJF A;  2E2E A;  4GCN A;  2WQ7 A;  2IJG X;  2XGM A;  1Z3Y A;  3MX3 A;  3ONK A;  4LRZ A;  1Y8M A;  4M3O A;  3S7B A;  5LP0 A;  3HVE A;  5T8I A;  3SFZ A;  4JEH A;  1HG5 A;  2HM8 A;  4WUY A;  1W3B A;  3QKY A;  4KXK B;  2JEK A;  2X6K A;  5ENN A;  4JZY A;  4A55 A;  4GA1 A;  2A4Z A;  2ZU6 B;  4MKT A;  1WM5 A;  4UWH A;  4Q69 A;  1FCH A;  2YNQ A;  4JHR A;  3LDZ A;  5FTP A;  3CHM A;  1H2U A;  1PAQ A;  4ANW A;  3L17 A;  2P58 C;  5FQ4 A;  1E96 B;  4CEM A;  3EIQ C;  3GZ1 A;  4BTB A;  3APF A;  3RKV A;  4FHK A;  3MZL B;  3PRE A;  4CDM A;  4N39 A;  5A23 A;  4J6I A;  3FFL A;  3PS6 A;  3RJV A;  3T5X A;  3MYV A;  4KMO A;  5ARG A;  4FLH A;  1FVH A;  3D9I A;  5AYW D;  5JJ7 A;  3CQC B;  4FP7 A;  3G2W A;  4LEU A;  3KS2 A;  4PS3 A;  1HG2 A;  2QFC A;  2XPY A;  1JPL A;  3MGB A;  3R7R A;  5BV0 A;  2HR2 A;  1OUV A;  4CRW A;  1ZBP A;  4JA7 A;  2I6H A;  1UN9 A;  2MHK A;  3EDT B;  4UWL A;  2WQH A;  2CHZ A;  2Y3A A;  3PE3 A;  4RSY A;  2FUL A;  3CQG B;  3FUM A;  3SF4 A;  3EIJ A;  3QNK A;  4KVO A;  2XCB A;  3FU6 A;  4K03 A;  4I1M A;  2LSV A;  2GRL A;  5C2Y A;  5HQ8 A;  4I9C A;  2WXK A;  4AY6 A;  2WM9 A;  5CCL A;  5LCW C;  4W9R A;  1UN8 A;  5LX8 A;  1NP7 A;  1ZU2 A;  3C98 A;  4JXT A;  2KZT A;  1HO8 A;  3EHM A;  4XKC A;  4EPZ A;  2R5S A;  4F1S A;  3FTU A;  2AXV A;  3R7Q A;  3U64 A;  1EPU A;  4EZL A;  2LO6 A;  3ML9 A;  3FU0 A;  3QWP A;  4DLQ A;  4U63 A;  3B7U X;  3IBE A;  4F53 A;  1H6K A;  2J9Q A;  3BG1 B;  3KAE A;  2GW1 A;  4C0M A;  3ZGQ A;  3ONL A;  4URK A;  3MKR A;  1H2T C;  2Y4T A;  3CHR A;  2PM6 A;  3EHN A;  3SZ7 A;  3FTS A;  3LXU X;  2KZT B;  4QFV A;  1EYH A;  3SGH A;  3FDH A;  2VTB B;  3SD5 A;  3CHS A;  3S7J A;  2IQC A;  4G23 A;  3CEQ A;  3S7D A;  3B7T A;  4JL0 A;  4GAA A;  4ATG A;  3JUI A;  3L08 A;  4BX9 A;  4NUR A;  2YHC A;  3FWV A;  2L6J A;  3CHP A;  3U66 A;  4J8S A;  1P5Q A;  2ILR A;  3D9J A;  1HE8 A;  2VQ2 A;  4IUL A;  4L2Y A;  4BY6 A;  5CMW A;  5LFA A;  2J49 A;  2WXL A;  3OXL A;  1TEZ A;  2PQN A;  4FA6 A;  2C2L A;  3ASH A;  4H7Y A;  4U0U A;  3MKQ B;  1XNF A;  2LAH A;  4CT0 A;  2OOE A;  3ZVV A;  4A3V A;  3ZHE B;  4Q96 A;  3FU3 A;  1E8Y A;  4BSX A;  5J08 A;  4APO A;  2X6H A;  2XEV A;  5C1D A;  3O4Z A;  2J4D A;  2PQR A;  3ESK A;  3I5P A;  4B89 A;  4EBA A;  3URZ A;  2L0T B;  3FUE A;  1INZ A;  4HOT A;  3FUK A;  3HHM A;  2XHE A;  2KAT A;  4HVB A;  1ELK A;  3ZFW A;  4CCA A;  3TGO A;  1NA0 A;  1OWN A;  2DBA A;  3DPD A;  3LYA A;  4I1A A;  3CK8 A;  3OXF A;  3T5V A;  4GZC A;  4RG9 A;  1H2V C;  4KZC A;  2BTD A;  4J8F A;  3LY9 A;  5KJK A;  3L13 A;  4MS6 A;  5G04 C;  1OWO A;  5A7D B;  3LY8 A;  2WXI A;  4N3B A;  1OWP A;  3UT7 A;  4GA0 A;  1DNP A;  1SZA A;  3CIA A;  3LVR E;  2I2O A;  4XX5 A;  3P1U A;  3FTY A;  3IHV A;  3MV3 B;  3BEE A;  4G1T A;  4C0E A;  3CK9 A;  4APF A;  5KJL A;  5G04 J;  4D10 C;  3PUJ A;  4F7A A;  5FZS A;  5CMY A;  3E4B A;  3FP3 A;  3CVW A;  4BWR A;  1PY1 A;  3UPV A;  5T4Y A;  4FLB A;  4UWG A;  4WAF A;  4J8D A;  4B8A A;  4G24 A;  4IYP A;  1TJC A;  2NC9 A;  4XZ4 A;  4BT8 A;  2J08 A;  3AS5 A;  4L2L A;  4GYW A;  4ILH B;  3QDN A;  1FVF A;  1WAO 1;  5JHB A;  3D9M A;  1Z6T A;  4N5C A;  5FJY A;  3UMV A;  2VGY A;  4A3T A;  4G11 A;  1OWL A;  4LCT A;  5AIJ A;  2EQX A;  4GZD A;  3LVQ E;  4WNF A;  2IU1 A;  4KBQ A;  4I2W A;  3CR3 A;  4CGW A;  2XRZ A;  4HS2 A;  2L0I A;  2WXR A;  3TAX A;  2WXG A;  5D0Q D;  3CGH A;  3QAQ A;  2CHW A;  3G2U A;  2MRI A;  4YVQ C;  3R9A B;  2XGO A;  3D9O A;  3PZD A;  3VLF A;  4XKB A;  4XE0 A;  3S2A A;  2V8S E;  3D3M A;  3PH0 C;  1HZ4 A;  5BPP A;  2C0M A;  3CSF A;  3CHQ A;  1E7U A;  4GU5 A;  2BF0 X;  5ARF A;  4DK5 A;  1IYG A;  2HYZ A;  3FUJ A;  3QJZ A;  1Z3X A;  1B89 A;  5KCM A;  3Q15 A;  4GYO A;  3RRN B;  4GML A;  1SQM A;  3HIZ A;  3PDN A;  3FUN A;  3U3W A;  1HH8 A;  1HF8 A;  1JUQ A;  1BPO A;  3MV2 B;  3RU0 A;  4I43 A;  3JYS A;  2KM4 A;  4U8H A;  3UUX A;  2VTB A;  1Y6I A;  3S7F A;  4BX8 A;  2WXN A;  4AY5 A;  1ELR A;  2DCP A;  3ESL A;  4PS8 A;  3JCK C;  5LCW J;  5FQ6 A;  5DIZ A;  2VSN A;  3VTX A;  4HOR A;  3RK6 A;  3FUL A;  4YVO A;  4ABN A;  4BTA A;  2AVP A;  4J0U A;  3I3N A;  5M72 A;  4G25 A;  2C0L A;  3FUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...