4J8EA

Middle domain of hsc70-interacting protein, crystal form i
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
119
structure length
119
Chain Sequence
APQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Hsc70-interacting protein
publication title Structure and function of Hip, an attenuator of the Hsp70 chaperone cycle.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 46
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4j8eA00
3N71A 4G23A 4CGVA 2PL2A 4UQZA 4IN3B 4U0UA 1PC2A 1ELRA 3ASFA 3MEKA 4UQYA 4WNDA 5CCLA 4ME2A 2FI7A 4ABNA 2QFCA 4I9EA 5ARGA 2YHCA 4GZ6A 2VGXA 5KJKA 2KCVA 3ZHEB 3BEEA 3SF4A 3ULQA 5FZRA 3ZFWA 4UQXA 3Q4AB 4G2VA 4WNFA 3CK9A 5G05C 4YNDA 3QDNA 4N3AA 4WUYA 5G05J 2VGYA 4AY5A 2BUGA 3LKUA 3ZHEA 3AS8A 2KCKA 3CK8A 4UI9C 3RIBA 2JLBA 4U07A 3ZN3A 4A1SA 3ASDA 4UI9J 4GCNA 3LPZA 3UPVA 4BTAA 2HR2A 5C1DA 2NC9A 1ZU2A 4I1AA 3CKCA 5A7DB 4BT9A 5DBKA 4I2ZA 1WM5A 1W3BA 4AY6A 3WXXA 3FFLA 3Q15A 4JA7A 3QKYA 2XGOA 4UI9K 3FWVA 4WNGA 3MV3B 4RG6A 4BT8A 3LY8A 2PZIA 4JL0A 2VSYA 4YVOA 1A17A 4HOTA 5ARFA 3CK7A 5JJ6A 2Y4UA 3RKVA 4N5CA 3ASHA 4Y6CA 1QQEA 4HORA 5LCWJ 2KC7A 3Q49B 3OXFA 2KCLA 3QWPA 4N3BA 4WNEA 2YQ8A 4G25A 2V5FA 2VGXB 2I6HA 3PDNA 3PE4A 1XNFA 4GYYA 5DIZA 3NF1A 3S7FA 3TG5A 2Y4TA 2FF4A 4H7YA 2P58C 5JJ7A 5FZQA 3RJVA 4KXKB 5FZSA 1KLXA 5EKQD 4BTBA 2VQ2A 4GA0A 2GW1A 3IEGA 5AYWD 3AS4A 2DBAA 3LCAA 3ZGQA 4RG9A 2HO1A 3MV2B 4U0ZA 2PQRA 5A6CA 4G24A 1ZBPA 3CVLA 3VTXA 3LY9A 2R5SA 3CVNA 2XCCA 5G04C 5FJYA 3U3WA 1QZ2A 2OOEA 2WPVA 2VSNA 5G04J 3LYAA 3CV0A 3ESKA 1IYGA 4U0SA 1WAO1 4N3CA 3TAXA 4YVQC 5KJMA 3HYMB 4XIFA 2KATA 3FP3A 2XPIA 2UY1A 3KD7A 2C0LA 4KYOB 5KJNA 4N2SA 5FTPA 3GW4A 3O48A 3QWWA 4G1TA 2C0MA 4EQFA 3K9IA 4H7XA 5D0QD 4JA9A 4GZ3A 4J8EA 2VYIA 5D0OD 1ELWA 3LY7A 5HI7A 4GA1A 1FCHA 4Y6WA 3TG4A 4N39A 5LCWC 4XI9A 1KT0A 4GA2A 5CHEE 4NRHB 3JYSA 2UWJG 3QOUA 4GPKA 4KBQA 1YA0A 4XI0A 4N2QA 2Q7FA 3GYZA 5CCMA 3MA5A 4GYWA 3KS2A 1NA3A 3RO3A 4JHRA 3OXLA 2FBNA 1IHGA 5EX3A 4J0UA 1HXIA 1NA0A 3AS5A 3GZ2A 3UUXA 4BWRA 5KJLA 1P5QA 2ONDA 4GYOA 2MHKA 2FO7A 2XGSA 3E4BA 4B94A 4AIFA 2XGMA 2L6JA 1KT1A 2AVPA 3U4TA 1TJCA 2J9QA 1HZ4A 4AM9A 3RU0A 2PQNA 4HOSA 2UY1B 3SZ7A 4F3VA 1Y8MA 3QWVA 3Q5MA 2XCBA 5JJTA 3CKBA 3CVPA 4U04A 2C2LA 1B89A 3PE3A 5EX0A 4J8DA 2E2EA 3S7BA 4GZ5A 4CGWA 1NZNA 3OXGA 3TGOA 5BT1A 1E96B 3URZA 1HH8A 3KAEA 4HOUA 5HQ8A 4J8FA 2XEVA 3ZPJA 5FT9A 3S7DA 5M72A 4NQ0A 4APOA 2HYZA 2IFUA 2LNIA 4O6FA 4I9CA 4I2WA 3UQ3A 5BW8C 4LEUA 3RO2A 4I17A 2LSVA 3ASGA 1OUVA 2IF4A 4W9RA 3EDTB 4CDRA 5BNWA 4G26A 4HOQA 3S7JA 3MKRA 3Q47B 2LSUA 2FEZA 3VTYA 3CEQA 4GCOA 3CVQA 3R9AB 3GZ1A 2WQHA
chains in the Genus database with same CATH superfamily
3CVVA 3EHMA 1H6OA 4B0ZA 3CHMA 2E0IA 2P9SG 3CLJA 3PZ2A 4U0UA 4CDMA 1WY6A 5T4YA 4LUNU 4XEIG 3ASFA 4K5CA 2R05A 3UM3A 1SA5A 2CFZA 1MX4A 3FUEA 3FUJA 3CR3A 4EZLA 2WXHA 4ME2A 2AXUA 4LRZA 3JCKC 4I9EA 4A3VA 4C48B 5FQ4A 3IHVA 4JZYA 1H19A 5FZRA 2X6HA 1AWCB 4WNFA 3CK9A 3D9HA 4YDWA 4DLOA 4AY5A 5CBNA 4ANWA 4TRQA 3LEWA 3UIPC 4XX5A 4UI9C 1N11A 4DUIA 5ENOD 2F0YA 3UPVA 4BTAA 2GRPB 1YMPA 3FHEA 4GMRA 3EJNA 3BG1B 2MOWA 1ZB1A 2NC9A 3B13A 3ZNGA 2WXRA 4I1AA 2WXIA 3CKCA 4TXPA 2YHEA 2EIME 3C5RA 1WM5A 2EQXA 3ULEG 4AY6A 3FFLA 3FH8A 2XGOA 3ZIMA 4LNUD 3MV3B 4RG6A 5ARFA 2XS1A 2ETBA 1JCQA 1RW2A 4JW1A 5G55A 4ACLA 3RKVA 4NIKA 1TYQG 1DVPA 4LNGA 2WVIA 4HQDA 4B93B 5ENQD 4B8AA 4J8SA 2YQ8A 1E90A 2ZXWE 3FTXA 3V79K 1YCSB 3PDNA 5E75A 3PE4A 4GYYA 4GAAA 4DX5D 3HHMA 5DIZA 1MX6A 4ATGA 1N0QA 3LVRE 2WXMA 2VGEA 5JJ7A 3J5PA 3FUMA 1KLXA 2GW1A 5AYWD 3F6QA 2DBAA 2HE0A 3LCAA 5ENTD 1QYMA 2HO1A 4BY6A 5IY5E 3NAWA 1N4SA 1KZOA 3CVLA 3V31A 3VTXA 2LXMA 2KZTA 3LY9A 2B6CA 1NP7A 4U8VD 1OCOE 2BKGA 4MLPA 5JHAA 2OOEA 4UWLA 5G04J 1HO8A 3ESKA 1IYGA 1ELKA 5LX8A 3FTWA 3HRAA 4YVQC 4DJAA 1UN9A 4C0EA 3TWTA 2J07A 1U2VG 3IHYA 4XKCA 1S63A 2C0LA 4D10C 4X8QA 3G2TA 5FTPA 5H7PA 3K9IA 2DYRE 3DSWA 3E34A 4JA9A 4L7TA 4J8EA 3DWLG 5D0OD 3RRUA 3LY7A 1FCHA 2XZDG 5FQ6A 3DBSA 3ZVVA 2AWIA 1QBQA 4KBQA 2WXPA 1E8ZA 2Q7FA 4U8HA 4MBGA 2ZU6B 3KS2A 5AQ9A 4BERA 2WMOA 1TR4A 5BV0A 1IHGA 5EX3A 4J0UA 3GZ2A 2GROB 4DX6D 4U95D 1TJFA 2V0PA 2KZTB 1G3NB 2FO7A 2X3MA 4PS8A 5AJDA 3C72A 1N9AA 4A3TA 2X6IA 3G2WA 3U4TA 1IKND 4ILGA 2YINA 2QYJA 4HOSA 1JPLA 1HG2A 2XPZA 1MQSA 2Y1LE 2WXGA 2V5QC 3HXBA 2WQ6A 2R02A 4ZHBA 4TV3A 1KZPA 1X5BA 3SNXA 2DCPA 4NACA 4JD2G 4L1BA 5JJTA 4U04A 3L9TA 2C2LA 4M7CA 2H6HA 3PE3A 2L6BA 2IO2C 4U96D 2XZTG 4BESA 4KMOA 4K5AB 3TGOA 5CRVA 3DSXA 3AG3E 1DCEA 3T5VA 1BD8A 2H6IA 3KAEA 4HS2A 5JMND 2GRNB 4J8YA 3SFXA 2LXLA 2HYZA 2VSXE 2L9BA 4I2WA 3CSTA 4ANVA 3PUKA 3RO2A 3ASNE 3UM1A 5EN5D 4W9RA 3EDTB 3WG7E 1Z5SC 2KBXA 4HOQA 2YNQA 4UWHA 3ABKE 1D8EA 2EIJE 4TUUA 3CVQA 4ANXA 3ZYMA 1YYHA 3GZ1A 3ULYA 2GRRB 2H6GA 1OCZE 4G23A 1UN8A 4GZDA 2AW6A 5BV1A 1E7VA 5ANRA 3QK0A 1BPOA 3SBTB 4F1PA 3Q7FA 5T8IA 4PS3A 3EHQA 4IULA 2EINE 3FUIA 5CCLA 3FUFA 2FI7A 3VLEA 3SFYA 5ARGA 2BKKB 2RD0A 3Q9NC 3ZHEB 3AG1E 3SF4A 3UI2A 3ZFWA 5G05C 1O1RA 2XQ0A 4J7WA 5A23A 1E7UA 2X6KA 2VGYA 2AJAA 4PUCA 2BUGA 3PZDA 5CEAA 4C9BB 1TN7A 4EBAG 4ILHB 5FIOA 4A1SA 3ASDA 4UI9J 3LDZA 4ILIA 1DNPA 4GCNA 4HI9A 1O1TA 1OWMA 2F37A 1SZAA 2HR2A 5C1DA 4HLEA 1ZU2A 3X2QE 1IQRA 5A7DB 1LD7A 3PUJA 4JPSA 4TUMA 3UM0A 3WXXA 3Q15A 4JA7A 1HU3A 3QKYA 2GRLA 5FINA 3LY8A 3G2VA 4JL0A 3MJWA 4CRWA 3OTNA 3T9KA 4WWPA 4L9PA 3C3RA 5JJ6A 3I5PA 2Y4UA 1OT8A 1OWNA 3V30A 1HG5A 4N5CA 3ASHA 4Y6CA 4UWFA 4BFRA 2DZOA 4GTRA 2ZGGA 4FHJA 3Q49B 4MRUA 2Y0BG 3AJIA 3JXJA 3C3QA 4JXTA 4I6JA 1UJJA 4G25A 4OAVB 3AU4A 3DRAA 4OAUC 2J09A 2ZGDA 1XNFA 3SY2A 3D9NA 3TG5A 2RG8A 2Y4TA 4M3OA 3SGHA 2FF4A 5ENRD 5CMYA 4H7YA 4LCTA 3RJVA 4NURA 4F53A 1HFAA 2BF0X 5FZSA 4BTBA 3FTVA 4HXIA 3FUHA 5JHBA 3AS4A 3TWQA 4FHKA 3FUNA 1NFIE 3ZGQA 1TN8A 3B7SA 3MV2B 3FULA 1X81A 1DCQA 3T5XA 1LTXA 4DLQA 1NI1A 4G24A 2P9KG 5ENNA 1NL4A 2WM9A 2GRQB 3G2UA 3ASOE 2R5SA 5FJYA 3U3WA 1QZ2A 5KWDA 2VSNA 3RK6A 3CV0A 4JVSA 2IOLA 1FVFA 5LOZA 2RFMA 3PZ3A 4N3CA 3QAQA 2P9PG 3MYVA 4XKBA 4GMJA 4N5QA 5ENPD 3CVUA 2WMNA 3RSEG 5KJMA 3HYMB 4XIFA 3PEVB 2LO6A 2KATA 1E8YA 3U9WA 4HRMB 2CHWA 4DX7D 4BSZB 1H0AA 4KYOB 4MKTA 1H2VC 5KJNA 4A1GA 4N2SA 1S64A 3QWWA 4G1TA 3E30A 2EIKE 4YDOA 4FA6A 5D0QD 3LJNA 3PEUB 2NYJA 3TG4A 3RRMB 1HE8A 5EDSA 3Q79A 4XI9A 2OV8A 5CHEE 3D9IA 5J90A 2QC9A 3CGHA 2J8SD 2WXNA 3B7UX 3UINC 3D9PA 4XI0A 3TWXA 3GYZA 1V54E 4GYWA 1TNBA 3OXLA 3VLDA 2I2OA 2OEVA 2IO3C 1A5EA 3PZ4A 4P29A 1EF1C 4AVXA 3DSVA 3HVEA 2MRIA 1HXIA 1NA0A 4OYSA 5KJLA 4BWRA 2ONDA 3EU9A 4Q96A 4JC8A 4LG6A 3SQVA 2H6FA 3CHOA 4AIFA 3UT4A 5B3SE 3UKRG 3NOGD 3APFA 2L6JA 2R03A 1KT1A 2AVPA 2F8XK 3Q78A 2ZIRA 2J9QA 3I4GA 4AM9A 5CERB 3RU0A 3RAUA 4EBAA 3NZUA 3Q7AA 3DSSA 2PQNA 3D9MA 1XGWA 3SZ7A 3ABLE 3D9LA 4TXRA 4C0MA 1Q2ZA 3QWVA 3Q5MA 3PH0C 2XCBA 3KEZA 2CG2A 1Z6TA 3D9OA 4R7LA 2P9NG 5CEDB 5ANLA 3MKQA 4I1MA 5D66A 1O1SA 2E2EA 4GZ5A 4EZJA 5HS0A 3OXGA 5BT1A 2RFAA 3NOCD 2XEHA 2KM4A 1E8WA 2A5EA 5FWQA 1MJ0A 2NSZA 2WXOA 5M72A 4O6FA 2L0TB 1N4PA 4I9CA 4WAFA 4CT0A 3ZKJA 3MX3A 1SQMA 5BW8C 4DK5A 1PY1A 5BXUA 2XENA 4I17A 2X6FA 2LSVA 3FEYA 4CDRA 1UW4B 3UMVA 1SZ9A 5BUZA 3ZXPA 3Q73A 3HVEB 4U63A 2FEZA 3ZU7B 2IEJA 2AXVA 1KPSB 5EILA 5FQ7A 2R2LA 1WDYA 4U8YD 3CSFA 2WQHA 1GW6A 1OY3D 3IBEA 5ENSD 4ATZD 2P9IG 3W9FA 4CGVA 4CZ2D 4V3IA 2PL2A 3ONLA 4UQZA 4IN3B 3R9MA 4B89A 3APDA 3HG0D 2NXPA 4AP2A 2LUHA 3BG0B 4UQYA 4WNDA 2PM7A 4ABNA 4MS6A 2YHCA 2VGXA 3FTYA 5KJKA 1BLXB 2KCVA 3ULQA 4CCAA 4UQXA 3Q4AB 4G2VA 4FC8A 3P1UA 4YNDA 3QDNA 4HB5A 2QZAA 1K8KG 2OVBA 3MKQB 5G05J 4FADA 3C3OA 3ZHEA 2KCKA 3CK8A 2I1JA 3ZN3A 2VTBB 3LPZA 2DZNA 4HI8A 3PZ1A 1TNYA 3FY4A 4BT9A 3OAWA 5G2NA 4DRXE 1LD8A 3J5QB 3IV0A 3NBNB 2I9CA 5B1AE 4HRLA 1OCCE 3I3NA 4UI9K 3FWVA 1SA4A 3TWUA 4BT8A 1FPPA 4HRNA 3LJ3A 3AAAC 4UWGA 2LAHA 3CK7A 1TNOA 2WXKA 4EECA 1N4RA 5C2YA 3CVWA 4B8CB 4L2LA 4OVVA 3FUDA 3FTSA 1QQEA 1N0RA 4BX8A 4F1SA 5LCWJ 2J4DA 2KC7A 3RRNB 3OXFA 4E6HA 3QWPA 4TXQA 2P9UG 4KZ0A 3B95A 2V5FA 3ZEFA 2VGXB 4U7EB 4DX1A 3L54A 4CT4A 3S7FA 3CHPA 1PAQA 4E85A 3P2BA 4UWKA 5B1BE 4GTQA 5FZQA 3CIAA 3ENEA 3FH5A 4LSZE 4KXKB 4BEPA 2VQ2A 4GA0A 3IEGA 2WXFA 4GTSA 4G8KA 2XEEA 4RG9A 2FO1E 4U0ZA 5A6CA 4CYMD 1ZBPA 4L2YA 3DXMG 3S2AA 1BI8B 2CG3A 2XRZA 4GTVA 2XCCA 5LFAA 1K1AA 4Q69A 2WPVA 1O5MA 4HNAD 5EIBE 3LYAA 3ZYLA 3UX4A 1WAO1 2BEDA 3TAXA 3ISMC 5CMWA 2X38A 5KBAA 2HM8A 2P9LG 3FP3A 4RSYA 2UY1A 3ZYKA 3DSUA 3Q75A 3FDHA 3KD7A 1TNUA 3UXGA 4A63B 3FTZA 2X6JA 4PS7A 4HBDA 4DPRA 3KSQA 2I1KA 1TN6A 2KXPC 2IQCA 4H7XA 3GZSA 3SBSA 4GZ3A 3NZSA 2VSOE 4BSXA 3JXIA 4KZCA 2VYIA 3BU8A 4PH4B 3L13A 4O1OA 5HI7A 2LAIA 4GA1A 3APCA 3V2OA 1VDYA 5LCWC 3FH7A 2J4BA 4GA2A 1H2UA 3JYSA 4CDNA 2UWJG 3EIQC 3ONKA 4N2QA 2Y3AA 3UKUG 3RO3A 3LVQE 2A4ZA 2XRYA 1EPUA 4DI3A 2FBNA 3TWWA 4GTOA 3FU3A 1DC2A 2CHZA 5AARA 4GYOA 2AXZA 3E4BA 3I4RB 3ML9A 2VJ8A 2XHEA 2DVWA 1MYOA 1S70B 4HLLA 1RZ4A 1TNZA 3R7RA 2WXLA 1N54A 4HVBA 4I43A 1JWGA 3G2SA 4JEHA 4L23A 2UY1B 2WXQA 3MCXA 4F3VA 5KNGA 1Y8MA 1Z3XA 4KT6B 3EUVA 4RLYA 3L82A 1BI7B 3CHRA 3CVPA 3CVYA 1B89A 5EX0A 4J8DA 3PNLB 3Q9UC 3UIOC 1UJKA 4AEZC 3JQ0A 4CGWA 1NZNA 5FQ8A 4I6EA 3TXMA 1HH8A 1BU9A 1U3CA 3ZPJA 4FU3A 5FT9A 3CQGB 3U66A 4G8LA 4APOA 2LNIA 1H6PA 3PREA 4GB9A 3UQ3A 3SO8A 2CFUA 4LEUA 1TEZA 3UT7A 1OUVA 5AQBA 5BNWA 3QC1A 4G26A 4GU5A 3ZW3A 3LS8A 3Q47B 3ML8A 2LSUA 3VTYA 3CEQA 1OXJA 4GCOA 1OWPA 3R9AB 3CHQA 3FTUA 5CBOA 4I1OB 3N71A 3ZRHA 3LXUX 2GRMA 2JEKA 5ITZF 3JUIA 5BPPA 1PC2A 1ELRA 4AJWA 3MEKA 3B7TA 2P2CP 3MGBA 4AOFA 5EYPF 4BX9A 1HX8A 2QFCA 4GZ6A 4DX2A 1FVHA 3BEEA 2A5UA 3HIZA 3L08A 4FJZA 2DYSE 5T3RA 3PRZA 1N52A 3EIJA 4GMLA 5KNHD 2B0OE 3D3MA 3JQ1A 4ZFHA 4N3AA 4WUYA 5HKPA 3ZUVB 2DWZA 1LF8A 5LP0A 3FEXA 3LKUA 3AS8A 5AQAA 4AV7A 3RIBA 2JLBA 4U07A 4K0RA 2WQ7A 3NB2A 4F6RD 4WWNA 4O60A 1U3DA 5CRUA 1WG0A 2IY0C 3VLFA 2L0IA 3B7RL 2F8YA 1S0PA 5BXOA 2ZISA 5J08A 5AIJA 1MHQA 2VTBA 5DBKA 4I2ZA 3C98A 4CEMA 1W3BA 3L16A 3D9JA 3R7QA 4EZKA 3V2XA 4DI4A 4OVUA 3JUEA 3TXNA 2R17C 4WNGA 2PZIA 2VSYA 1D8DA 4URKA 3E33A 3UT8A 4YVOA 1A17A 1MX2A 4HOTA 4FJYA 3L17A 3IXEA 1IQUA 1N94A 3ZXSA 3DEPA 5E76A 2QY7A 3ABME 4RQIA 4HORA 1K1BA 2KCLA 4WWOA 1L5JA 4N3BA 2XS8A 4UUCA 4WNEA 3HXDA 4RVBA 2WB2A 4LNBA 4APFA 2I6HA 1JUQA 3DEOA 3NF1A 3T8KA 1OWLA 1Y6IA 3HXFA 3QJZA 2P58C 1INZA 3FUKA 5EKQD 2V8SE 4XE0A 3SFZA 3KEAA 3NQPA 4O1PA 5CECB 3QB2A 3TWSA 4K5BA 4A55A 4ACKA 1K3ZD 3L6AA 3HDXA 5EIDA 2OVFA 2PQRA 2V4LA 2WXJA 3KSLA 4I6GA 3PNTB 4KVOA 5HRYA 3TL5A 3TWVA 3BUAA 4KVMA 3CVNA 5G04C 3EHNA 1UOHA 4U0SA 4FLHA 1SW6A 3CHSA 3QARA 3B7BA 5AN8A 1EYHA 3O4ZA 5EYLA 3E37A 2XPIA 1Z3YA 4BETA 3ZYQA 5AAOA 3BQOA 4G11A 3DPDA 3GW4A 3O48A 4K03A 3AG4E 2C0MA 1H6KA 4EQFA 1D9SA 2Y69E 1JCSA 3UM2A 4YDYA 1EDUA 1OCRE 3QNKA 4IYPA 1ELWA 3PVLA 3W9GA 4Y6WA 4N39A 2MYOA 4QFVA 4Q94A 1KT0A 2R59A 4NRHB 4PDXA 3SD5A 3QOUA 4GPKA 3DPYA 2OCCE 1HF8A 1YA0A 4Z68A 1UG3A 3SHFA 5CCMA 3MA5A 4LERA 3U64A 3EHRA 3T8MA 1FT2A 1NA3A 3ESLA 3DSTA 4JHRA 4JHJA 3FU6A 1H2TC 1AP7A 2M63A 2ILRA 3AS5A 4AXHA 2IOSA 3UUXA 1P5QA 5KCMA 4GZCA 2MHKA 3E32A 1HS6A 2XGSA 3MZLB 1IHBA 5D2MC 3TWRA 2GGFA 4B94A 2PM6A 2XGMA 3AU5A 3D9KA 3DXKG 3CVXA 4JHKA 1N95A 1TJCA 1HZ4A 3PS6A 4XZ4A 4GPMA 4GTPA 2PNNA 4EPZA 4HFGA 2CHXA 2OEWA 2DIWA 1JWFA 3CQCB 2IJGX 2J49A 4JEUA 4JB8P 4YDEA 2XPYA 2ETAA 1MZCA 1IXVA 3HXCA 3CKBA 2BTDA 4FLBA 4GTTA 3L22A 1JCRA 5AJLA 1OWOA 4QQIA 2FULA 3S7BA 2IONA 2ETCA 2EILE 4F7AA 1E96B 3URZA 4EHMA 4HOUA 5HQ8A 4J8FA 1N4QA 2XEVA 3FU5A 3HXEA 2QYUA 2RKKA 3S7DA 4NQ0A 3FU0A 2IFUA 5AQ7A 4ANUA 3EU5A 2JABA 4FULA 4GTMA 1V55E 2IU1A 3SI5A 3UTMA 1FT1A 1QNFA 3ASGA 3TJPA 2V4HC 2IF4A 4IRUA 3IKOB 3S7JA 3MKRA 1E8XA 1SVXA 5AENA 5JA4D 4J6IA 2J08A 3AG2E 4FP7A
chains in the Genus database with same CATH topology
4I1OB 3N71A 4G23A 3CVVA 1UN8A 3EHMA 4GZDA 2AW6A 5BV1A 3ZRHA 1E7VA 4CGVA 4B0ZA 3CHMA 3LXUX 4V3IA 2E0IA 2GRMA 2PL2A 2JEKA 3CLJA 3ONLA 4UQZA 4IN3B 5ANRA 4U0UA 4B89A 3APDA 4CDMA 1WY6A 3JUIA 5BPPA 5T4YA 1PC2A 3QK0A 1ELRA 4LUNU 3RRUA 4AJWA 3ASFA 2NXPA 1BPOA 3SBTB 5T8IA 4AP2A 2CFZA 4PS3A 4IULA 3FUEA 3MEKA 3B7TA 3MGBA 3FUIA 4AOFA 3FUJA 3CR3A 3BG0B 4UQYA 4EZLA 4WNDA 3FUFA 2PM7A 2WXHA 4BX9A 4ME2A 5CCLA 2AXUA 1HX8A 2FI7A 4ABNA 4LRZA 3VLEA 4MS6A 3JCKC 2QFCA 4I9EA 5ARGA 4A3VA 2YHCA 4GZ6A 2VGXA 3FTYA 2RD0A 5FQ4A 5KJKA 1FVHA 3IHVA 2KCVA 3ZHEB 4JZYA 3BEEA 1H19A 3SF4A 3ULQA 2A5UA 5FZRA 2X6HA 4CCAA 3HIZA 3L08A 4FJZA 3ZFWA 4UQXA 5T3RA 3Q4AB 4G2VA 3PRZA 1N52A 3EIJA 4GMLA 4WNFA 3D3MA 3CK9A 4FC8A 5G05C 3P1UA 4YNDA 3QDNA 3JQ1A 2XQ0A 2OVBA 3MKQB 1E7UA 5A23A 2X6KA 4N3AA 4WUYA 5G05J 2VGYA 4FADA 4DLOA 4PUCA 4AY5A 1LF8A 5LP0A 4ANWA 4TRQA 3FEXA 2BUGA 3LKUA 3ZHEA 3AS8A 3PZDA 2KCKA 3LEWA 4AV7A 3CK8A 4XX5A 4UI9C 4C9BB 3RIBA 2I1JA 2JLBA 4EBAG 4U07A 4ILHB 3ZN3A 4A1SA 4K0RA 2VTBB 3ASDA 2WQ7A 4UI9J 3LDZA 4ILIA 4WWNA 1DNPA 4GCNA 3LPZA 3UPVA 4BTAA 1U3DA 1OWMA 3FHEA 3EJNA 3VLFA 3BG1B 1SZAA 2HR2A 2L0IA 2MOWA 2NC9A 3B7RL 3B13A 4HLEA 5C1DA 1S0PA 5J08A 1ZU2A 2WXRA 4I1AA 2WXIA 3CKCA 5AIJA 2YHEA 3FY4A 1IQRA 1MHQA 5A7DB 4BT9A 3OAWA 2VTBA 5DBKA 4I2ZA 5G2NA 3C98A 1WM5A 2EQXA 4CEMA 1W3BA 3PUJA 4JPSA 3IV0A 4AY6A 3WXXA 2I9CA 3FFLA 3L16A 3Q15A 3D9JA 3FH8A 4JA7A 1HU3A 3QKYA 3R7QA 4EZKA 3I3NA 4DI4A 2XGOA 2GRLA 4OVUA 4UI9K 3ZIMA 3FWVA 3TXNA 2R17C 4WNGA 3MV3B 4RG6A 4BT8A 3LY8A 2PZIA 3G2VA 4JL0A 2VSYA 3LJ3A 4UWGA 3MJWA 4URKA 3UT8A 4YVOA 1A17A 2LAHA 4CRWA 4FJYA 5ARFA 4HOTA 3OTNA 3CK7A 4WWPA 3L17A 2WXKA 4EECA 5JJ6A 3I5PA 2Y4UA 4JW1A 5G55A 1OWNA 4ACLA 1IQUA 5C2YA 3CVWA 3RKVA 1HG5A 4N5CA 4B8CB 3ASHA 4Y6CA 3ZXSA 5E76A 4L2LA 4OVVA 4UWFA 3FUDA 4BFRA 1DVPA 1QQEA 2QY7A 3FTSA 2WVIA 4HORA 4BX8A 4F1SA 4FHJA 5LCWJ 2J4DA 2KC7A 3Q49B 3OXFA 3RRNB 4E6HA 2KCLA 4WWOA 4MRUA 1L5JA 4B8AA 3QWPA 4N3BA 4J8SA 4JXTA 4WNEA 4RVBA 2WB2A 2YQ8A 1E90A 4I6JA 4KZ0A 1UJJA 4G25A 3FTXA 4APFA 2V5FA 3ZEFA 2VGXB 3AU4A 2I6HA 3PDNA 1JUQA 2J09A 5E75A 3PE4A 1XNFA 4GYYA 3L54A 4GAAA 3HHMA 5DIZA 3NF1A 3D9NA 4CT4A 3S7FA 3CHPA 1OWLA 1Y6IA 3TG5A 2RG8A 2Y4TA 4M3OA 4ATGA 3SGHA 1PAQA 4E85A 2FF4A 3LVRE 5CMYA 3P2BA 4UWKA 4H7YA 3QJZA 2WXMA 2P58C 5JJ7A 4LCTA 5FZQA 3CIAA 3ENEA 3FH5A 3RJVA 1INZA 4NURA 3FUMA 4KXKB 4F53A 1HFAA 2BF0X 5FZSA 1KLXA 3FUKA 3FTVA 5EKQD 4BTBA 2VQ2A 2V8SE 4XE0A 3SFZA 3NQPA 4GA0A 4HXIA 2GW1A 3FUHA 3IEGA 5AYWD 3AS4A 5JHBA 2DBAA 4FHKA 3LCAA 3QB2A 3FUNA 2WXFA 3ZGQA 4RG9A 3B7SA 2HO1A 3MV2B 4BY6A 3FULA 4A55A 4ACKA 3L6AA 3HDXA 3T5XA 4U0ZA 2OVFA 2PQRA 4DLQA 5A6CA 2V4LA 2WXJA 4I6GA 4G24A 1ZBPA 3CVLA 4L2YA 5ENNA 3PNTB 2WM9A 4KVOA 3VTXA 3S2AA 3TL5A 2KZTA 3G2UA 3LY9A 2CG3A 2XRZA 1NP7A 2R5SA 3CVNA 4KVMA 2XCCA 4MLPA 5G04C 5JHAA 5FJYA 5LFAA 3EHNA 3U3WA 1QZ2A 2OOEA 2WPVA 4Q69A 4UWLA 2VSNA 5G04J 3RK6A 1HO8A 3LYAA 3CV0A 3ESKA 4JVSA 2IOLA 1FVFA 1IYGA 4U0SA 3ZYLA 3UX4A 5LOZA 1ELKA 1WAO1 4FLHA 5LX8A 4N3CA 3FTWA 3QAQA 3CHSA 3TAXA 5CMWA 3QARA 3MYVA 4XKBA 4GMJA 3CVUA 4YVQC 2WMNA 4DJAA 1UN9A 1EYHA 2X38A 4C0EA 3O4ZA 5KJMA 3HYMB 4XIFA 2HM8A 3PEVB 2J07A 2LO6A 2KATA 3FP3A 4RSYA 2XPIA 1E8YA 3U9WA 2UY1A 1Z3YA 3ZYKA 3ZYQA 3FDHA 3IHYA 2CHWA 3KD7A 4XKCA 2C0LA 1H0AA 4G11A 4KYOB 4D10C 4MKTA 3DPDA 1H2VC 3FTZA 2X6JA 5KJNA 4A1GA 4PS7A 4N2SA 3G2TA 5FTPA 4DPRA 3GW4A 3O48A 2I1KA 3QWWA 4G1TA 4K03A 2C0MA 1H6KA 4EQFA 2IQCA 4FA6A 3K9IA 4H7XA 5D0QD 3GZSA 3SBSA 4JA9A 4GZ3A 3NZSA 3PEUB 2VSOE 4L7TA 1EDUA 4BSXA 4J8EA 3QNKA 4IYPA 4KZCA 2VYIA 5D0OD 4PH4B 3L13A 1ELWA 3LY7A 3PVLA 2LAIA 4GA1A 1FCHA 3APCA 4Y6WA 5FQ6A 5HI7A 3TG4A 3RRMB 4N39A 1VDYA 3DBSA 4QFVA 5LCWC 1HE8A 5EDSA 3FH7A 4XI9A 3ZVVA 4Q94A 1KT0A 2OV8A 2J4BA 4GA2A 5CHEE 2R59A 3D9IA 1H2UA 4NRHB 4PDXA 3JYSA 5J90A 3CGHA 2AWIA 4CDNA 3SD5A 2UWJG 2WXNA 3QOUA 4GPKA 3EIQC 3B7UX 4KBQA 3ONKA 1HF8A 1YA0A 3D9PA 1UG3A 2WXPA 4XI0A 1E8ZA 4N2QA 2Y3AA 2Q7FA 3SHFA 3GYZA 4U8HA 5CCMA 3MA5A 4LERA 3U64A 4GYWA 2ZU6B 3KS2A 3T8MA 1NA3A 3RO3A 3ESLA 4JHRA 3OXLA 3VLDA 3LVQE 2I2OA 2A4ZA 2XRYA 4JHJA 3FU6A 1EPUA 2WMOA 4DI3A 1H2TC 5BV0A 2FBNA 1IHGA 4P29A 1EF1C 2M63A 5EX3A 2ILRA 3FU3A 4AVXA 3HVEA 4J0UA 2MRIA 1HXIA 1NA0A 3AS5A 4AXHA 2CHZA 4OYSA 3GZ2A 2IOSA 3UUXA 4BWRA 5KJLA 1P5QA 2ONDA 4Q96A 5KCMA 4GYOA 1TJFA 2MHKA 4GZCA 4JC8A 2V0PA 2AXZA 2KZTB 2FO7A 2X3MA 1HS6A 2XGSA 3MZLB 3E4BA 2GGFA 3I4RB 3ML9A 4B94A 3CHOA 2VJ8A 2PM6A 2XHEA 4PS8A 5AJDA 2XGMA 3UT4A 4AIFA 3AU5A 3D9KA 3APFA 2L6JA 3CVXA 1KT1A 2AVPA 2X6IA 4JHKA 4A3TA 3G2WA 3U4TA 3R7RA 1TJCA 2WXLA 1N54A 2J9QA 1HZ4A 3I4GA 4I43A 3PS6A 2YINA 4ILGA 4HVBA 4XZ4A 4AM9A 4EPZA 4HFGA 2CHXA 1JWGA 3RU0A 4EBAA 3G2SA 3NZUA 4JEHA 2DIWA 4L23A 2PQNA 3D9MA 1JWFA 1XGWA 3CQCB 1JPLA 2IJGX 2J49A 2UY1B 4JEUA 4HOSA 1HG2A 2XPZA 1MQSA 3SZ7A 3D9LA 2WXGA 2WXQA 3MCXA 4F3VA 2XPYA 4C0MA 2WQ6A 1Y8MA 4TV3A 3QWVA 1Z3XA 1X5BA 4KT6B 3Q5MA 3SNXA 2DCPA 4NACA 3PH0C 2XCBA 4L1BA 3KEZA 3CHRA 2CG2A 1Z6TA 5JJTA 3CKBA 3CVPA 4U04A 3D9OA 4R7LA 2C2LA 3CVYA 2BTDA 4FLBA 1B89A 3PE3A 3L22A 5EX0A 4J8DA 5AJLA 5ANLA 3MKQA 4I1MA 1OWOA 2E2EA 2FULA 3PNLB 3S7BA 4GZ5A 1UJKA 4AEZC 4EZJA 3JQ0A 4CGWA 2IONA 1NZNA 3OXGA 4KMOA 3TGOA 5FQ8A 5BT1A 4I6EA 3TXMA 4F7AA 1E96B 3URZA 3T5VA 1HH8A 3KAEA 4HOUA 4HS2A 2KM4A 5HQ8A 1E8WA 1U3CA 4J8FA 5FWQA 2XEVA 3FU5A 2NSZA 3ZPJA 2WXOA 4FU3A 5FT9A 3CQGB 3U66A 3S7DA 5M72A 4NQ0A 4APOA 3FU0A 2HYZA 2IFUA 2LNIA 4O6FA 2L0TB 4I9CA 4WAFA 4ANUA 2VSXE 4CT0A 2L9BA 3PREA 4I2WA 3CSTA 4GB9A 3UQ3A 3MX3A 1SQMA 5BW8C 4FULA 2CFUA 4ANVA 3PUKA 4DK5A 4LEUA 1PY1A 2IU1A 3RO2A 3SI5A 4I17A 3UT7A 1TEZA 1QNFA 2X6FA 2LSVA 3ASGA 1OUVA 3FEYA 3TJPA 2IF4A 4W9RA 3EDTB 4CDRA 4IRUA 5BNWA 1UW4B 3UMVA 3IKOB 3QC1A 4G26A 1SZ9A 4GU5A 4HOQA 3S7JA 5BUZA 3MKRA 1E8XA 3ZW3A 2YNQA 3HVEB 3LS8A 3Q47B 4UWHA 4U63A 3ML8A 2LSUA 5AENA 2FEZA 3VTYA 3CEQA 4TUUA 4GCOA 2AXVA 3CVQA 1OWPA 5FQ7A 4ANXA 4J6IA 3ZYMA 2J08A 3R9AB 3GZ1A 3CHQA 3CSFA 2WQHA 3FTUA 1GW6A 4FP7A 3IBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N71 A;  4G23 A;  4CGV A;  2PL2 A;  4UQZ A;  4IN3 B;  4U0U A;  1PC2 A;  1ELR A;  3ASF A;  3MEK A;  4UQY A;  4WND A;  5CCL A;  4ME2 A;  2FI7 A;  4ABN A;  2QFC A;  4I9E A;  5ARG A;  2YHC A;  4GZ6 A;  2VGX A;  5KJK A;  2KCV A;  3ZHE B;  3BEE A;  3SF4 A;  3ULQ A;  5FZR A;  3ZFW A;  4UQX A;  3Q4A B;  4G2V A;  4WNF A;  3CK9 A;  5G05 C;  4YND A;  3QDN A;  4N3A A;  4WUY A;  5G05 J;  2VGY A;  4AY5 A;  2BUG A;  3LKU A;  3ZHE A;  3AS8 A;  2KCK A;  3CK8 A;  4UI9 C;  3RIB A;  2JLB A;  4U07 A;  3ZN3 A;  4A1S A;  3ASD A;  4UI9 J;  4GCN A;  3LPZ A;  3UPV A;  4BTA A;  2HR2 A;  5C1D A;  2NC9 A;  1ZU2 A;  4I1A A;  3CKC A;  5A7D B;  4BT9 A;  5DBK A;  4I2Z A;  1WM5 A;  1W3B A;  4AY6 A;  3WXX A;  3FFL A;  3Q15 A;  4JA7 A;  3QKY A;  2XGO A;  4UI9 K;  3FWV A;  4WNG A;  3MV3 B;  4RG6 A;  4BT8 A;  3LY8 A;  2PZI A;  4JL0 A;  2VSY A;  4YVO A;  1A17 A;  4HOT A;  5ARF A;  3CK7 A;  5JJ6 A;  2Y4U A;  3RKV A;  4N5C A;  3ASH A;  4Y6C A;  1QQE A;  4HOR A;  5LCW J;  2KC7 A;  3Q49 B;  3OXF A;  2KCL A;  3QWP A;  4N3B A;  4WNE A;  2YQ8 A;  4G25 A;  2V5F A;  2VGX B;  2I6H A;  3PDN A;  3PE4 A;  1XNF A;  4GYY A;  5DIZ A;  3NF1 A;  3S7F A;  3TG5 A;  2Y4T A;  2FF4 A;  4H7Y A;  2P58 C;  5JJ7 A;  5FZQ A;  3RJV A;  4KXK B;  5FZS A;  1KLX A;  5EKQ D;  4BTB A;  2VQ2 A;  4GA0 A;  2GW1 A;  3IEG A;  5AYW D;  3AS4 A;  2DBA A;  3LCA A;  3ZGQ A;  4RG9 A;  2HO1 A;  3MV2 B;  4U0Z A;  2PQR A;  5A6C A;  4G24 A;  1ZBP A;  3CVL A;  3VTX A;  3LY9 A;  2R5S A;  3CVN A;  2XCC A;  5G04 C;  5FJY A;  3U3W A;  1QZ2 A;  2OOE A;  2WPV A;  2VSN A;  5G04 J;  3LYA A;  3CV0 A;  3ESK A;  1IYG A;  4U0S A;  1WAO 1;  4N3C A;  3TAX A;  4YVQ C;  5KJM A;  3HYM B;  4XIF A;  2KAT A;  3FP3 A;  2XPI A;  2UY1 A;  3KD7 A;  2C0L A;  4KYO B;  5KJN A;  4N2S A;  5FTP A;  3GW4 A;  3O48 A;  3QWW A;  4G1T A;  2C0M A;  4EQF A;  3K9I A;  4H7X A;  5D0Q D;  4JA9 A;  4GZ3 A;  4J8E A;  2VYI A;  5D0O D;  1ELW A;  3LY7 A;  5HI7 A;  4GA1 A;  1FCH A;  4Y6W A;  3TG4 A;  4N39 A;  5LCW C;  4XI9 A;  1KT0 A;  4GA2 A;  5CHE E;  4NRH B;  3JYS A;  2UWJ G;  3QOU A;  4GPK A;  4KBQ A;  1YA0 A;  4XI0 A;  4N2Q A;  2Q7F A;  3GYZ A;  5CCM A;  3MA5 A;  4GYW A;  3KS2 A;  1NA3 A;  3RO3 A;  4JHR A;  3OXL A;  2FBN A;  1IHG A;  5EX3 A;  4J0U A;  1HXI A;  1NA0 A;  3AS5 A;  3GZ2 A;  3UUX A;  4BWR A;  5KJL A;  1P5Q A;  2OND A;  4GYO A;  2MHK A;  2FO7 A;  2XGS A;  3E4B A;  4B94 A;  4AIF A;  2XGM A;  2L6J A;  1KT1 A;  2AVP A;  3U4T A;  1TJC A;  2J9Q A;  1HZ4 A;  4AM9 A;  3RU0 A;  2PQN A;  4HOS A;  2UY1 B;  3SZ7 A;  4F3V A;  1Y8M A;  3QWV A;  3Q5M A;  2XCB A;  5JJT A;  3CKB A;  3CVP A;  4U04 A;  2C2L A;  1B89 A;  3PE3 A;  5EX0 A;  4J8D A;  2E2E A;  3S7B A;  4GZ5 A;  4CGW A;  1NZN A;  3OXG A;  3TGO A;  5BT1 A;  1E96 B;  3URZ A;  1HH8 A;  3KAE A;  4HOU A;  5HQ8 A;  4J8F A;  2XEV A;  3ZPJ A;  5FT9 A;  3S7D A;  5M72 A;  4NQ0 A;  4APO A;  2HYZ A;  2IFU A;  2LNI A;  4O6F A;  4I9C A;  4I2W A;  3UQ3 A;  5BW8 C;  4LEU A;  3RO2 A;  4I17 A;  2LSV A;  3ASG A;  1OUV A;  2IF4 A;  4W9R A;  3EDT B;  4CDR A;  5BNW A;  4G26 A;  4HOQ A;  3S7J A;  3MKR A;  3Q47 B;  2LSU A;  2FEZ A;  3VTY A;  3CEQ A;  4GCO A;  3CVQ A;  3R9A B;  3GZ1 A;  2WQH A; 
#chains in the Genus database with same CATH topology
 3CVV A;  3EHM A;  1H6O A;  4B0Z A;  3CHM A;  2E0I A;  2P9S G;  3CLJ A;  3PZ2 A;  4U0U A;  4CDM A;  1WY6 A;  5T4Y A;  4LUN U;  4XEI G;  3ASF A;  4K5C A;  2R05 A;  3UM3 A;  1SA5 A;  2CFZ A;  1MX4 A;  3FUE A;  3FUJ A;  3CR3 A;  4EZL A;  2WXH A;  4ME2 A;  2AXU A;  4LRZ A;  3JCK C;  4I9E A;  4A3V A;  4C48 B;  5FQ4 A;  3IHV A;  4JZY A;  1H19 A;  5FZR A;  2X6H A;  1AWC B;  4WNF A;  3CK9 A;  3D9H A;  4YDW A;  4DLO A;  4AY5 A;  5CBN A;  4ANW A;  4TRQ A;  3LEW A;  3UIP C;  4XX5 A;  4UI9 C;  1N11 A;  4DUI A;  5ENO D;  2F0Y A;  3UPV A;  4BTA A;  2GRP B;  1YMP A;  3FHE A;  4GMR A;  3EJN A;  3BG1 B;  2MOW A;  1ZB1 A;  2NC9 A;  3B13 A;  3ZNG A;  2WXR A;  4I1A A;  2WXI A;  3CKC A;  4TXP A;  2YHE A;  2EIM E;  3C5R A;  1WM5 A;  2EQX A;  3ULE G;  4AY6 A;  3FFL A;  3FH8 A;  2XGO A;  3ZIM A;  4LNU D;  3MV3 B;  4RG6 A;  5ARF A;  2XS1 A;  2ETB A;  1JCQ A;  1RW2 A;  4JW1 A;  5G55 A;  4ACL A;  3RKV A;  4NIK A;  1TYQ G;  1DVP A;  4LNG A;  2WVI A;  4HQD A;  4B93 B;  5ENQ D;  4B8A A;  4J8S A;  2YQ8 A;  1E90 A;  2ZXW E;  3FTX A;  3V79 K;  1YCS B;  3PDN A;  5E75 A;  3PE4 A;  4GYY A;  4GAA A;  4DX5 D;  3HHM A;  5DIZ A;  1MX6 A;  4ATG A;  1N0Q A;  3LVR E;  2WXM A;  2VGE A;  5JJ7 A;  3J5P A;  3FUM A;  1KLX A;  2GW1 A;  5AYW D;  3F6Q A;  2DBA A;  2HE0 A;  3LCA A;  5ENT D;  1QYM A;  2HO1 A;  4BY6 A;  5IY5 E;  3NAW A;  1N4S A;  1KZO A;  3CVL A;  3V31 A;  3VTX A;  2LXM A;  2KZT A;  3LY9 A;  2B6C A;  1NP7 A;  4U8V D;  1OCO E;  2BKG A;  4MLP A;  5JHA A;  2OOE A;  4UWL A;  5G04 J;  1HO8 A;  3ESK A;  1IYG A;  1ELK A;  5LX8 A;  3FTW A;  3HRA A;  4YVQ C;  4DJA A;  1UN9 A;  4C0E A;  3TWT A;  2J07 A;  1U2V G;  3IHY A;  4XKC A;  1S63 A;  2C0L A;  4D10 C;  4X8Q A;  3G2T A;  5FTP A;  5H7P A;  3K9I A;  2DYR E;  3DSW A;  3E34 A;  4JA9 A;  4L7T A;  4J8E A;  3DWL G;  5D0O D;  3RRU A;  3LY7 A;  1FCH A;  2XZD G;  5FQ6 A;  3DBS A;  3ZVV A;  2AWI A;  1QBQ A;  4KBQ A;  2WXP A;  1E8Z A;  2Q7F A;  4U8H A;  4MBG A;  2ZU6 B;  3KS2 A;  5AQ9 A;  4BER A;  2WMO A;  1TR4 A;  5BV0 A;  1IHG A;  5EX3 A;  4J0U A;  3GZ2 A;  2GRO B;  4DX6 D;  4U95 D;  1TJF A;  2V0P A;  2KZT B;  1G3N B;  2FO7 A;  2X3M A;  4PS8 A;  5AJD A;  3C72 A;  1N9A A;  4A3T A;  2X6I A;  3G2W A;  3U4T A;  1IKN D;  4ILG A;  2YIN A;  2QYJ A;  4HOS A;  1JPL A;  1HG2 A;  2XPZ A;  1MQS A;  2Y1L E;  2WXG A;  2V5Q C;  3HXB A;  2WQ6 A;  2R02 A;  4ZHB A;  4TV3 A;  1KZP A;  1X5B A;  3SNX A;  2DCP A;  4NAC A;  4JD2 G;  4L1B A;  5JJT A;  4U04 A;  3L9T A;  2C2L A;  4M7C A;  2H6H A;  3PE3 A;  2L6B A;  2IO2 C;  4U96 D;  2XZT G;  4BES A;  4KMO A;  4K5A B;  3TGO A;  5CRV A;  3DSX A;  3AG3 E;  1DCE A;  3T5V A;  1BD8 A;  2H6I A;  3KAE A;  4HS2 A;  5JMN D;  2GRN B;  4J8Y A;  3SFX A;  2LXL A;  2HYZ A;  2VSX E;  2L9B A;  4I2W A;  3CST A;  4ANV A;  3PUK A;  3RO2 A;  3ASN E;  3UM1 A;  5EN5 D;  4W9R A;  3EDT B;  3WG7 E;  1Z5S C;  2KBX A;  4HOQ A;  2YNQ A;  4UWH A;  3ABK E;  1D8E A;  2EIJ E;  4TUU A;  3CVQ A;  4ANX A;  3ZYM A;  1YYH A;  3GZ1 A;  3ULY A;  2GRR B;  2H6G A;  1OCZ E;  4G23 A;  1UN8 A;  4GZD A;  2AW6 A;  5BV1 A;  1E7V A;  5ANR A;  3QK0 A;  1BPO A;  3SBT B;  4F1P A;  3Q7F A;  5T8I A;  4PS3 A;  3EHQ A;  4IUL A;  2EIN E;  3FUI A;  5CCL A;  3FUF A;  2FI7 A;  3VLE A;  3SFY A;  5ARG A;  2BKK B;  2RD0 A;  3Q9N C;  3ZHE B;  3AG1 E;  3SF4 A;  3UI2 A;  3ZFW A;  5G05 C;  1O1R A;  2XQ0 A;  4J7W A;  5A23 A;  1E7U A;  2X6K A;  2VGY A;  2AJA A;  4PUC A;  2BUG A;  3PZD A;  5CEA A;  4C9B B;  1TN7 A;  4EBA G;  4ILH B;  5FIO A;  4A1S A;  3ASD A;  4UI9 J;  3LDZ A;  4ILI A;  1DNP A;  4GCN A;  4HI9 A;  1O1T A;  1OWM A;  2F37 A;  1SZA A;  2HR2 A;  5C1D A;  4HLE A;  1ZU2 A;  3X2Q E;  1IQR A;  5A7D B;  1LD7 A;  3PUJ A;  4JPS A;  4TUM A;  3UM0 A;  3WXX A;  3Q15 A;  4JA7 A;  1HU3 A;  3QKY A;  2GRL A;  5FIN A;  3LY8 A;  3G2V A;  4JL0 A;  3MJW A;  4CRW A;  3OTN A;  3T9K A;  4WWP A;  4L9P A;  3C3R A;  5JJ6 A;  3I5P A;  2Y4U A;  1OT8 A;  1OWN A;  3V30 A;  1HG5 A;  4N5C A;  3ASH A;  4Y6C A;  4UWF A;  4BFR A;  2DZO A;  4GTR A;  2ZGG A;  4FHJ A;  3Q49 B;  4MRU A;  2Y0B G;  3AJI A;  3JXJ A;  3C3Q A;  4JXT A;  4I6J A;  1UJJ A;  4G25 A;  4OAV B;  3AU4 A;  3DRA A;  4OAU C;  2J09 A;  2ZGD A;  1XNF A;  3SY2 A;  3D9N A;  3TG5 A;  2RG8 A;  2Y4T A;  4M3O A;  3SGH A;  2FF4 A;  5ENR D;  5CMY A;  4H7Y A;  4LCT A;  3RJV A;  4NUR A;  4F53 A;  1HFA A;  2BF0 X;  5FZS A;  4BTB A;  3FTV A;  4HXI A;  3FUH A;  5JHB A;  3AS4 A;  3TWQ A;  4FHK A;  3FUN A;  1NFI E;  3ZGQ A;  1TN8 A;  3B7S A;  3MV2 B;  3FUL A;  1X81 A;  1DCQ A;  3T5X A;  1LTX A;  4DLQ A;  1NI1 A;  4G24 A;  2P9K G;  5ENN A;  1NL4 A;  2WM9 A;  2GRQ B;  3G2U A;  3ASO E;  2R5S A;  5FJY A;  3U3W A;  1QZ2 A;  5KWD A;  2VSN A;  3RK6 A;  3CV0 A;  4JVS A;  2IOL A;  1FVF A;  5LOZ A;  2RFM A;  3PZ3 A;  4N3C A;  3QAQ A;  2P9P G;  3MYV A;  4XKB A;  4GMJ A;  4N5Q A;  5ENP D;  3CVU A;  2WMN A;  3RSE G;  5KJM A;  3HYM B;  4XIF A;  3PEV B;  2LO6 A;  2KAT A;  1E8Y A;  3U9W A;  4HRM B;  2CHW A;  4DX7 D;  4BSZ B;  1H0A A;  4KYO B;  4MKT A;  1H2V C;  5KJN A;  4A1G A;  4N2S A;  1S64 A;  3QWW A;  4G1T A;  3E30 A;  2EIK E;  4YDO A;  4FA6 A;  5D0Q D;  3LJN A;  3PEU B;  2NYJ A;  3TG4 A;  3RRM B;  1HE8 A;  5EDS A;  3Q79 A;  4XI9 A;  2OV8 A;  5CHE E;  3D9I A;  5J90 A;  2QC9 A;  3CGH A;  2J8S D;  2WXN A;  3B7U X;  3UIN C;  3D9P A;  4XI0 A;  3TWX A;  3GYZ A;  1V54 E;  4GYW A;  1TNB A;  3OXL A;  3VLD A;  2I2O A;  2OEV A;  2IO3 C;  1A5E A;  3PZ4 A;  4P29 A;  1EF1 C;  4AVX A;  3DSV A;  3HVE A;  2MRI A;  1HXI A;  1NA0 A;  4OYS A;  5KJL A;  4BWR A;  2OND A;  3EU9 A;  4Q96 A;  4JC8 A;  4LG6 A;  3SQV A;  2H6F A;  3CHO A;  4AIF A;  3UT4 A;  5B3S E;  3UKR G;  3NOG D;  3APF A;  2L6J A;  2R03 A;  1KT1 A;  2AVP A;  2F8X K;  3Q78 A;  2ZIR A;  2J9Q A;  3I4G A;  4AM9 A;  5CER B;  3RU0 A;  3RAU A;  4EBA A;  3NZU A;  3Q7A A;  3DSS A;  2PQN A;  3D9M A;  1XGW A;  3SZ7 A;  3ABL E;  3D9L A;  4TXR A;  4C0M A;  1Q2Z A;  3QWV A;  3Q5M A;  3PH0 C;  2XCB A;  3KEZ A;  2CG2 A;  1Z6T A;  3D9O A;  4R7L A;  2P9N G;  5CED B;  5ANL A;  3MKQ A;  4I1M A;  5D66 A;  1O1S A;  2E2E A;  4GZ5 A;  4EZJ A;  5HS0 A;  3OXG A;  5BT1 A;  2RFA A;  3NOC D;  2XEH A;  2KM4 A;  1E8W A;  2A5E A;  5FWQ A;  1MJ0 A;  2NSZ A;  2WXO A;  5M72 A;  4O6F A;  2L0T B;  1N4P A;  4I9C A;  4WAF A;  4CT0 A;  3ZKJ A;  3MX3 A;  1SQM A;  5BW8 C;  4DK5 A;  1PY1 A;  5BXU A;  2XEN A;  4I17 A;  2X6F A;  2LSV A;  3FEY A;  4CDR A;  1UW4 B;  3UMV A;  1SZ9 A;  5BUZ A;  3ZXP A;  3Q73 A;  3HVE B;  4U63 A;  2FEZ A;  3ZU7 B;  2IEJ A;  2AXV A;  1KPS B;  5EIL A;  5FQ7 A;  2R2L A;  1WDY A;  4U8Y D;  3CSF A;  2WQH A;  1GW6 A;  1OY3 D;  3IBE A;  5ENS D;  4ATZ D;  2P9I G;  3W9F A;  4CGV A;  4CZ2 D;  4V3I A;  2PL2 A;  3ONL A;  4UQZ A;  4IN3 B;  3R9M A;  4B89 A;  3APD A;  3HG0 D;  2NXP A;  4AP2 A;  2LUH A;  3BG0 B;  4UQY A;  4WND A;  2PM7 A;  4ABN A;  4MS6 A;  2YHC A;  2VGX A;  3FTY A;  5KJK A;  1BLX B;  2KCV A;  3ULQ A;  4CCA A;  4UQX A;  3Q4A B;  4G2V A;  4FC8 A;  3P1U A;  4YND A;  3QDN A;  4HB5 A;  2QZA A;  1K8K G;  2OVB A;  3MKQ B;  5G05 J;  4FAD A;  3C3O A;  3ZHE A;  2KCK A;  3CK8 A;  2I1J A;  3ZN3 A;  2VTB B;  3LPZ A;  2DZN A;  4HI8 A;  3PZ1 A;  1TNY A;  3FY4 A;  4BT9 A;  3OAW A;  5G2N A;  4DRX E;  1LD8 A;  3J5Q B;  3IV0 A;  3NBN B;  2I9C A;  5B1A E;  4HRL A;  1OCC E;  3I3N A;  4UI9 K;  3FWV A;  1SA4 A;  3TWU A;  4BT8 A;  1FPP A;  4HRN A;  3LJ3 A;  3AAA C;  4UWG A;  2LAH A;  3CK7 A;  1TNO A;  2WXK A;  4EEC A;  1N4R A;  5C2Y A;  3CVW A;  4B8C B;  4L2L A;  4OVV A;  3FUD A;  3FTS A;  1QQE A;  1N0R A;  4BX8 A;  4F1S A;  5LCW J;  2J4D A;  2KC7 A;  3RRN B;  3OXF A;  4E6H A;  3QWP A;  4TXQ A;  2P9U G;  4KZ0 A;  3B95 A;  2V5F A;  3ZEF A;  2VGX B;  4U7E B;  4DX1 A;  3L54 A;  4CT4 A;  3S7F A;  3CHP A;  1PAQ A;  4E85 A;  3P2B A;  4UWK A;  5B1B E;  4GTQ A;  5FZQ A;  3CIA A;  3ENE A;  3FH5 A;  4LSZ E;  4KXK B;  4BEP A;  2VQ2 A;  4GA0 A;  3IEG A;  2WXF A;  4GTS A;  4G8K A;  2XEE A;  4RG9 A;  2FO1 E;  4U0Z A;  5A6C A;  4CYM D;  1ZBP A;  4L2Y A;  3DXM G;  3S2A A;  1BI8 B;  2CG3 A;  2XRZ A;  4GTV A;  2XCC A;  5LFA A;  1K1A A;  4Q69 A;  2WPV A;  1O5M A;  4HNA D;  5EIB E;  3LYA A;  3ZYL A;  3UX4 A;  1WAO 1;  2BED A;  3TAX A;  3ISM C;  5CMW A;  2X38 A;  5KBA A;  2HM8 A;  2P9L G;  3FP3 A;  4RSY A;  2UY1 A;  3ZYK A;  3DSU A;  3Q75 A;  3FDH A;  3KD7 A;  1TNU A;  3UXG A;  4A63 B;  3FTZ A;  2X6J A;  4PS7 A;  4HBD A;  4DPR A;  3KSQ A;  2I1K A;  1TN6 A;  2KXP C;  2IQC A;  4H7X A;  3GZS A;  3SBS A;  4GZ3 A;  3NZS A;  2VSO E;  4BSX A;  3JXI A;  4KZC A;  2VYI A;  3BU8 A;  4PH4 B;  3L13 A;  4O1O A;  5HI7 A;  2LAI A;  4GA1 A;  3APC A;  3V2O A;  1VDY A;  5LCW C;  3FH7 A;  2J4B A;  4GA2 A;  1H2U A;  3JYS A;  4CDN A;  2UWJ G;  3EIQ C;  3ONK A;  4N2Q A;  2Y3A A;  3UKU G;  3RO3 A;  3LVQ E;  2A4Z A;  2XRY A;  1EPU A;  4DI3 A;  2FBN A;  3TWW A;  4GTO A;  3FU3 A;  1DC2 A;  2CHZ A;  5AAR A;  4GYO A;  2AXZ A;  3E4B A;  3I4R B;  3ML9 A;  2VJ8 A;  2XHE A;  2DVW A;  1MYO A;  1S70 B;  4HLL A;  1RZ4 A;  1TNZ A;  3R7R A;  2WXL A;  1N54 A;  4HVB A;  4I43 A;  1JWG A;  3G2S A;  4JEH A;  4L23 A;  2UY1 B;  2WXQ A;  3MCX A;  4F3V A;  5KNG A;  1Y8M A;  1Z3X A;  4KT6 B;  3EUV A;  4RLY A;  3L82 A;  1BI7 B;  3CHR A;  3CVP A;  3CVY A;  1B89 A;  5EX0 A;  4J8D A;  3PNL B;  3Q9U C;  3UIO C;  1UJK A;  4AEZ C;  3JQ0 A;  4CGW A;  1NZN A;  5FQ8 A;  4I6E A;  3TXM A;  1HH8 A;  1BU9 A;  1U3C A;  3ZPJ A;  4FU3 A;  5FT9 A;  3CQG B;  3U66 A;  4G8L A;  4APO A;  2LNI A;  1H6P A;  3PRE A;  4GB9 A;  3UQ3 A;  3SO8 A;  2CFU A;  4LEU A;  1TEZ A;  3UT7 A;  1OUV A;  5AQB A;  5BNW A;  3QC1 A;  4G26 A;  4GU5 A;  3ZW3 A;  3LS8 A;  3Q47 B;  3ML8 A;  2LSU A;  3VTY A;  3CEQ A;  1OXJ A;  4GCO A;  1OWP A;  3R9A B;  3CHQ A;  3FTU A;  5CBO A;  4I1O B;  3N71 A;  3ZRH A;  3LXU X;  2GRM A;  2JEK A;  5ITZ F;  3JUI A;  5BPP A;  1PC2 A;  1ELR A;  4AJW A;  3MEK A;  3B7T A;  2P2C P;  3MGB A;  4AOF A;  5EYP F;  4BX9 A;  1HX8 A;  2QFC A;  4GZ6 A;  4DX2 A;  1FVH A;  3BEE A;  2A5U A;  3HIZ A;  3L08 A;  4FJZ A;  2DYS E;  5T3R A;  3PRZ A;  1N52 A;  3EIJ A;  4GML A;  5KNH D;  2B0O E;  3D3M A;  3JQ1 A;  4ZFH A;  4N3A A;  4WUY A;  5HKP A;  3ZUV B;  2DWZ A;  1LF8 A;  5LP0 A;  3FEX A;  3LKU A;  3AS8 A;  5AQA A;  4AV7 A;  3RIB A;  2JLB A;  4U07 A;  4K0R A;  2WQ7 A;  3NB2 A;  4F6R D;  4WWN A;  4O60 A;  1U3D A;  5CRU A;  1WG0 A;  2IY0 C;  3VLF A;  2L0I A;  3B7R L;  2F8Y A;  1S0P A;  5BXO A;  2ZIS A;  5J08 A;  5AIJ A;  1MHQ A;  2VTB A;  5DBK A;  4I2Z A;  3C98 A;  4CEM A;  1W3B A;  3L16 A;  3D9J A;  3R7Q A;  4EZK A;  3V2X A;  4DI4 A;  4OVU A;  3JUE A;  3TXN A;  2R17 C;  4WNG A;  2PZI A;  2VSY A;  1D8D A;  4URK A;  3E33 A;  3UT8 A;  4YVO A;  1A17 A;  1MX2 A;  4HOT A;  4FJY A;  3L17 A;  3IXE A;  1IQU A;  1N94 A;  3ZXS A;  3DEP A;  5E76 A;  2QY7 A;  3ABM E;  4RQI A;  4HOR A;  1K1B A;  2KCL A;  4WWO A;  1L5J A;  4N3B A;  2XS8 A;  4UUC A;  4WNE A;  3HXD A;  4RVB A;  2WB2 A;  4LNB A;  4APF A;  2I6H A;  1JUQ A;  3DEO A;  3NF1 A;  3T8K A;  1OWL A;  1Y6I A;  3HXF A;  3QJZ A;  2P58 C;  1INZ A;  3FUK A;  5EKQ D;  2V8S E;  4XE0 A;  3SFZ A;  3KEA A;  3NQP A;  4O1P A;  5CEC B;  3QB2 A;  3TWS A;  4K5B A;  4A55 A;  4ACK A;  1K3Z D;  3L6A A;  3HDX A;  5EID A;  2OVF A;  2PQR A;  2V4L A;  2WXJ A;  3KSL A;  4I6G A;  3PNT B;  4KVO A;  5HRY A;  3TL5 A;  3TWV A;  3BUA A;  4KVM A;  3CVN A;  5G04 C;  3EHN A;  1UOH A;  4U0S A;  4FLH A;  1SW6 A;  3CHS A;  3QAR A;  3B7B A;  5AN8 A;  1EYH A;  3O4Z A;  5EYL A;  3E37 A;  2XPI A;  1Z3Y A;  4BET A;  3ZYQ A;  5AAO A;  3BQO A;  4G11 A;  3DPD A;  3GW4 A;  3O48 A;  4K03 A;  3AG4 E;  2C0M A;  1H6K A;  4EQF A;  1D9S A;  2Y69 E;  1JCS A;  3UM2 A;  4YDY A;  1EDU A;  1OCR E;  3QNK A;  4IYP A;  1ELW A;  3PVL A;  3W9G A;  4Y6W A;  4N39 A;  2MYO A;  4QFV A;  4Q94 A;  1KT0 A;  2R59 A;  4NRH B;  4PDX A;  3SD5 A;  3QOU A;  4GPK A;  3DPY A;  2OCC E;  1HF8 A;  1YA0 A;  4Z68 A;  1UG3 A;  3SHF A;  5CCM A;  3MA5 A;  4LER A;  3U64 A;  3EHR A;  3T8M A;  1FT2 A;  1NA3 A;  3ESL A;  3DST A;  4JHR A;  4JHJ A;  3FU6 A;  1H2T C;  1AP7 A;  2M63 A;  2ILR A;  3AS5 A;  4AXH A;  2IOS A;  3UUX A;  1P5Q A;  5KCM A;  4GZC A;  2MHK A;  3E32 A;  1HS6 A;  2XGS A;  3MZL B;  1IHB A;  5D2M C;  3TWR A;  2GGF A;  4B94 A;  2PM6 A;  2XGM A;  3AU5 A;  3D9K A;  3DXK G;  3CVX A;  4JHK A;  1N95 A;  1TJC A;  1HZ4 A;  3PS6 A;  4XZ4 A;  4GPM A;  4GTP A;  2PNN A;  4EPZ A;  4HFG A;  2CHX A;  2OEW A;  2DIW A;  1JWF A;  3CQC B;  2IJG X;  2J49 A;  4JEU A;  4JB8 P;  4YDE A;  2XPY A;  2ETA A;  1MZC A;  1IXV A;  3HXC A;  3CKB A;  2BTD A;  4FLB A;  4GTT A;  3L22 A;  1JCR A;  5AJL A;  1OWO A;  4QQI A;  2FUL A;  3S7B A;  2ION A;  2ETC A;  2EIL E;  4F7A A;  1E96 B;  3URZ A;  4EHM A;  4HOU A;  5HQ8 A;  4J8F A;  1N4Q A;  2XEV A;  3FU5 A;  3HXE A;  2QYU A;  2RKK A;  3S7D A;  4NQ0 A;  3FU0 A;  2IFU A;  5AQ7 A;  4ANU A;  3EU5 A;  2JAB A;  4FUL A;  4GTM A;  1V55 E;  2IU1 A;  3SI5 A;  3UTM A;  1FT1 A;  1QNF A;  3ASG A;  3TJP A;  2V4H C;  2IF4 A;  4IRU A;  3IKO B;  3S7J A;  3MKR A;  1E8X A;  1SVX A;  5AEN A;  5JA4 D;  4J6I A;  2J08 A;  3AG2 E;  4FP7 A; 
#chains in the Genus database with same CATH homology
 4I1O B;  3N71 A;  4G23 A;  3CVV A;  1UN8 A;  3EHM A;  4GZD A;  2AW6 A;  5BV1 A;  3ZRH A;  1E7V A;  4CGV A;  4B0Z A;  3CHM A;  3LXU X;  4V3I A;  2E0I A;  2GRM A;  2PL2 A;  2JEK A;  3CLJ A;  3ONL A;  4UQZ A;  4IN3 B;  5ANR A;  4U0U A;  4B89 A;  3APD A;  4CDM A;  1WY6 A;  3JUI A;  5BPP A;  5T4Y A;  1PC2 A;  3QK0 A;  1ELR A;  4LUN U;  3RRU A;  4AJW A;  3ASF A;  2NXP A;  1BPO A;  3SBT B;  5T8I A;  4AP2 A;  2CFZ A;  4PS3 A;  4IUL A;  3FUE A;  3MEK A;  3B7T A;  3MGB A;  3FUI A;  4AOF A;  3FUJ A;  3CR3 A;  3BG0 B;  4UQY A;  4EZL A;  4WND A;  3FUF A;  2PM7 A;  2WXH A;  4BX9 A;  4ME2 A;  5CCL A;  2AXU A;  1HX8 A;  2FI7 A;  4ABN A;  4LRZ A;  3VLE A;  4MS6 A;  3JCK C;  2QFC A;  4I9E A;  5ARG A;  4A3V A;  2YHC A;  4GZ6 A;  2VGX A;  3FTY A;  2RD0 A;  5FQ4 A;  5KJK A;  1FVH A;  3IHV A;  2KCV A;  3ZHE B;  4JZY A;  3BEE A;  1H19 A;  3SF4 A;  3ULQ A;  2A5U A;  5FZR A;  2X6H A;  4CCA A;  3HIZ A;  3L08 A;  4FJZ A;  3ZFW A;  4UQX A;  5T3R A;  3Q4A B;  4G2V A;  3PRZ A;  1N52 A;  3EIJ A;  4GML A;  4WNF A;  3D3M A;  3CK9 A;  4FC8 A;  5G05 C;  3P1U A;  4YND A;  3QDN A;  3JQ1 A;  2XQ0 A;  2OVB A;  3MKQ B;  1E7U A;  5A23 A;  2X6K A;  4N3A A;  4WUY A;  5G05 J;  2VGY A;  4FAD A;  4DLO A;  4PUC A;  4AY5 A;  1LF8 A;  5LP0 A;  4ANW A;  4TRQ A;  3FEX A;  2BUG A;  3LKU A;  3ZHE A;  3AS8 A;  3PZD A;  2KCK A;  3LEW A;  4AV7 A;  3CK8 A;  4XX5 A;  4UI9 C;  4C9B B;  3RIB A;  2I1J A;  2JLB A;  4EBA G;  4U07 A;  4ILH B;  3ZN3 A;  4A1S A;  4K0R A;  2VTB B;  3ASD A;  2WQ7 A;  4UI9 J;  3LDZ A;  4ILI A;  4WWN A;  1DNP A;  4GCN A;  3LPZ A;  3UPV A;  4BTA A;  1U3D A;  1OWM A;  3FHE A;  3EJN A;  3VLF A;  3BG1 B;  1SZA A;  2HR2 A;  2L0I A;  2MOW A;  2NC9 A;  3B7R L;  3B13 A;  4HLE A;  5C1D A;  1S0P A;  5J08 A;  1ZU2 A;  2WXR A;  4I1A A;  2WXI A;  3CKC A;  5AIJ A;  2YHE A;  3FY4 A;  1IQR A;  1MHQ A;  5A7D B;  4BT9 A;  3OAW A;  2VTB A;  5DBK A;  4I2Z A;  5G2N A;  3C98 A;  1WM5 A;  2EQX A;  4CEM A;  1W3B A;  3PUJ A;  4JPS A;  3IV0 A;  4AY6 A;  3WXX A;  2I9C A;  3FFL A;  3L16 A;  3Q15 A;  3D9J A;  3FH8 A;  4JA7 A;  1HU3 A;  3QKY A;  3R7Q A;  4EZK A;  3I3N A;  4DI4 A;  2XGO A;  2GRL A;  4OVU A;  4UI9 K;  3ZIM A;  3FWV A;  3TXN A;  2R17 C;  4WNG A;  3MV3 B;  4RG6 A;  4BT8 A;  3LY8 A;  2PZI A;  3G2V A;  4JL0 A;  2VSY A;  3LJ3 A;  4UWG A;  3MJW A;  4URK A;  3UT8 A;  4YVO A;  1A17 A;  2LAH A;  4CRW A;  4FJY A;  5ARF A;  4HOT A;  3OTN A;  3CK7 A;  4WWP A;  3L17 A;  2WXK A;  4EEC A;  5JJ6 A;  3I5P A;  2Y4U A;  4JW1 A;  5G55 A;  1OWN A;  4ACL A;  1IQU A;  5C2Y A;  3CVW A;  3RKV A;  1HG5 A;  4N5C A;  4B8C B;  3ASH A;  4Y6C A;  3ZXS A;  5E76 A;  4L2L A;  4OVV A;  4UWF A;  3FUD A;  4BFR A;  1DVP A;  1QQE A;  2QY7 A;  3FTS A;  2WVI A;  4HOR A;  4BX8 A;  4F1S A;  4FHJ A;  5LCW J;  2J4D A;  2KC7 A;  3Q49 B;  3OXF A;  3RRN B;  4E6H A;  2KCL A;  4WWO A;  4MRU A;  1L5J A;  4B8A A;  3QWP A;  4N3B A;  4J8S A;  4JXT A;  4WNE A;  4RVB A;  2WB2 A;  2YQ8 A;  1E90 A;  4I6J A;  4KZ0 A;  1UJJ A;  4G25 A;  3FTX A;  4APF A;  2V5F A;  3ZEF A;  2VGX B;  3AU4 A;  2I6H A;  3PDN A;  1JUQ A;  2J09 A;  5E75 A;  3PE4 A;  1XNF A;  4GYY A;  3L54 A;  4GAA A;  3HHM A;  5DIZ A;  3NF1 A;  3D9N A;  4CT4 A;  3S7F A;  3CHP A;  1OWL A;  1Y6I A;  3TG5 A;  2RG8 A;  2Y4T A;  4M3O A;  4ATG A;  3SGH A;  1PAQ A;  4E85 A;  2FF4 A;  3LVR E;  5CMY A;  3P2B A;  4UWK A;  4H7Y A;  3QJZ A;  2WXM A;  2P58 C;  5JJ7 A;  4LCT A;  5FZQ A;  3CIA A;  3ENE A;  3FH5 A;  3RJV A;  1INZ A;  4NUR A;  3FUM A;  4KXK B;  4F53 A;  1HFA A;  2BF0 X;  5FZS A;  1KLX A;  3FUK A;  3FTV A;  5EKQ D;  4BTB A;  2VQ2 A;  2V8S E;  4XE0 A;  3SFZ A;  3NQP A;  4GA0 A;  4HXI A;  2GW1 A;  3FUH A;  3IEG A;  5AYW D;  3AS4 A;  5JHB A;  2DBA A;  4FHK A;  3LCA A;  3QB2 A;  3FUN A;  2WXF A;  3ZGQ A;  4RG9 A;  3B7S A;  2HO1 A;  3MV2 B;  4BY6 A;  3FUL A;  4A55 A;  4ACK A;  3L6A A;  3HDX A;  3T5X A;  4U0Z A;  2OVF A;  2PQR A;  4DLQ A;  5A6C A;  2V4L A;  2WXJ A;  4I6G A;  4G24 A;  1ZBP A;  3CVL A;  4L2Y A;  5ENN A;  3PNT B;  2WM9 A;  4KVO A;  3VTX A;  3S2A A;  3TL5 A;  2KZT A;  3G2U A;  3LY9 A;  2CG3 A;  2XRZ A;  1NP7 A;  2R5S A;  3CVN A;  4KVM A;  2XCC A;  4MLP A;  5G04 C;  5JHA A;  5FJY A;  5LFA A;  3EHN A;  3U3W A;  1QZ2 A;  2OOE A;  2WPV A;  4Q69 A;  4UWL A;  2VSN A;  5G04 J;  3RK6 A;  1HO8 A;  3LYA A;  3CV0 A;  3ESK A;  4JVS A;  2IOL A;  1FVF A;  1IYG A;  4U0S A;  3ZYL A;  3UX4 A;  5LOZ A;  1ELK A;  1WAO 1;  4FLH A;  5LX8 A;  4N3C A;  3FTW A;  3QAQ A;  3CHS A;  3TAX A;  5CMW A;  3QAR A;  3MYV A;  4XKB A;  4GMJ A;  3CVU A;  4YVQ C;  2WMN A;  4DJA A;  1UN9 A;  1EYH A;  2X38 A;  4C0E A;  3O4Z A;  5KJM A;  3HYM B;  4XIF A;  2HM8 A;  3PEV B;  2J07 A;  2LO6 A;  2KAT A;  3FP3 A;  4RSY A;  2XPI A;  1E8Y A;  3U9W A;  2UY1 A;  1Z3Y A;  3ZYK A;  3ZYQ A;  3FDH A;  3IHY A;  2CHW A;  3KD7 A;  4XKC A;  2C0L A;  1H0A A;  4G11 A;  4KYO B;  4D10 C;  4MKT A;  3DPD A;  1H2V C;  3FTZ A;  2X6J A;  5KJN A;  4A1G A;  4PS7 A;  4N2S A;  3G2T A;  5FTP A;  4DPR A;  3GW4 A;  3O48 A;  2I1K A;  3QWW A;  4G1T A;  4K03 A;  2C0M A;  1H6K A;  4EQF A;  2IQC A;  4FA6 A;  3K9I A;  4H7X A;  5D0Q D;  3GZS A;  3SBS A;  4JA9 A;  4GZ3 A;  3NZS A;  3PEU B;  2VSO E;  4L7T A;  1EDU A;  4BSX A;  4J8E A;  3QNK A;  4IYP A;  4KZC A;  2VYI A;  5D0O D;  4PH4 B;  3L13 A;  1ELW A;  3LY7 A;  3PVL A;  2LAI A;  4GA1 A;  1FCH A;  3APC A;  4Y6W A;  5FQ6 A;  5HI7 A;  3TG4 A;  3RRM B;  4N39 A;  1VDY A;  3DBS A;  4QFV A;  5LCW C;  1HE8 A;  5EDS A;  3FH7 A;  4XI9 A;  3ZVV A;  4Q94 A;  1KT0 A;  2OV8 A;  2J4B A;  4GA2 A;  5CHE E;  2R59 A;  3D9I A;  1H2U A;  4NRH B;  4PDX A;  3JYS A;  5J90 A;  3CGH A;  2AWI A;  4CDN A;  3SD5 A;  2UWJ G;  2WXN A;  3QOU A;  4GPK A;  3EIQ C;  3B7U X;  4KBQ A;  3ONK A;  1HF8 A;  1YA0 A;  3D9P A;  1UG3 A;  2WXP A;  4XI0 A;  1E8Z A;  4N2Q A;  2Y3A A;  2Q7F A;  3SHF A;  3GYZ A;  4U8H A;  5CCM A;  3MA5 A;  4LER A;  3U64 A;  4GYW A;  2ZU6 B;  3KS2 A;  3T8M A;  1NA3 A;  3RO3 A;  3ESL A;  4JHR A;  3OXL A;  3VLD A;  3LVQ E;  2I2O A;  2A4Z A;  2XRY A;  4JHJ A;  3FU6 A;  1EPU A;  2WMO A;  4DI3 A;  1H2T C;  5BV0 A;  2FBN A;  1IHG A;  4P29 A;  1EF1 C;  2M63 A;  5EX3 A;  2ILR A;  3FU3 A;  4AVX A;  3HVE A;  4J0U A;  2MRI A;  1HXI A;  1NA0 A;  3AS5 A;  4AXH A;  2CHZ A;  4OYS A;  3GZ2 A;  2IOS A;  3UUX A;  4BWR A;  5KJL A;  1P5Q A;  2OND A;  4Q96 A;  5KCM A;  4GYO A;  1TJF A;  2MHK A;  4GZC A;  4JC8 A;  2V0P A;  2AXZ A;  2KZT B;  2FO7 A;  2X3M A;  1HS6 A;  2XGS A;  3MZL B;  3E4B A;  2GGF A;  3I4R B;  3ML9 A;  4B94 A;  3CHO A;  2VJ8 A;  2PM6 A;  2XHE A;  4PS8 A;  5AJD A;  2XGM A;  3UT4 A;  4AIF A;  3AU5 A;  3D9K A;  3APF A;  2L6J A;  3CVX A;  1KT1 A;  2AVP A;  2X6I A;  4JHK A;  4A3T A;  3G2W A;  3U4T A;  3R7R A;  1TJC A;  2WXL A;  1N54 A;  2J9Q A;  1HZ4 A;  3I4G A;  4I43 A;  3PS6 A;  2YIN A;  4ILG A;  4HVB A;  4XZ4 A;  4AM9 A;  4EPZ A;  4HFG A;  2CHX A;  1JWG A;  3RU0 A;  4EBA A;  3G2S A;  3NZU A;  4JEH A;  2DIW A;  4L23 A;  2PQN A;  3D9M A;  1JWF A;  1XGW A;  3CQC B;  1JPL A;  2IJG X;  2J49 A;  2UY1 B;  4JEU A;  4HOS A;  1HG2 A;  2XPZ A;  1MQS A;  3SZ7 A;  3D9L A;  2WXG A;  2WXQ A;  3MCX A;  4F3V A;  2XPY A;  4C0M A;  2WQ6 A;  1Y8M A;  4TV3 A;  3QWV A;  1Z3X A;  1X5B A;  4KT6 B;  3Q5M A;  3SNX A;  2DCP A;  4NAC A;  3PH0 C;  2XCB A;  4L1B A;  3KEZ A;  3CHR A;  2CG2 A;  1Z6T A;  5JJT A;  3CKB A;  3CVP A;  4U04 A;  3D9O A;  4R7L A;  2C2L A;  3CVY A;  2BTD A;  4FLB A;  1B89 A;  3PE3 A;  3L22 A;  5EX0 A;  4J8D A;  5AJL A;  5ANL A;  3MKQ A;  4I1M A;  1OWO A;  2E2E A;  2FUL A;  3PNL B;  3S7B A;  4GZ5 A;  1UJK A;  4AEZ C;  4EZJ A;  3JQ0 A;  4CGW A;  2ION A;  1NZN A;  3OXG A;  4KMO A;  3TGO A;  5FQ8 A;  5BT1 A;  4I6E A;  3TXM A;  4F7A A;  1E96 B;  3URZ A;  3T5V A;  1HH8 A;  3KAE A;  4HOU A;  4HS2 A;  2KM4 A;  5HQ8 A;  1E8W A;  1U3C A;  4J8F A;  5FWQ A;  2XEV A;  3FU5 A;  2NSZ A;  3ZPJ A;  2WXO A;  4FU3 A;  5FT9 A;  3CQG B;  3U66 A;  3S7D A;  5M72 A;  4NQ0 A;  4APO A;  3FU0 A;  2HYZ A;  2IFU A;  2LNI A;  4O6F A;  2L0T B;  4I9C A;  4WAF A;  4ANU A;  2VSX E;  4CT0 A;  2L9B A;  3PRE A;  4I2W A;  3CST A;  4GB9 A;  3UQ3 A;  3MX3 A;  1SQM A;  5BW8 C;  4FUL A;  2CFU A;  4ANV A;  3PUK A;  4DK5 A;  4LEU A;  1PY1 A;  2IU1 A;  3RO2 A;  3SI5 A;  4I17 A;  3UT7 A;  1TEZ A;  1QNF A;  2X6F A;  2LSV A;  3ASG A;  1OUV A;  3FEY A;  3TJP A;  2IF4 A;  4W9R A;  3EDT B;  4CDR A;  4IRU A;  5BNW A;  1UW4 B;  3UMV A;  3IKO B;  3QC1 A;  4G26 A;  1SZ9 A;  4GU5 A;  4HOQ A;  3S7J A;  5BUZ A;  3MKR A;  1E8X A;  3ZW3 A;  2YNQ A;  3HVE B;  3LS8 A;  3Q47 B;  4UWH A;  4U63 A;  3ML8 A;  2LSU A;  5AEN A;  2FEZ A;  3VTY A;  3CEQ A;  4TUU A;  4GCO A;  2AXV A;  3CVQ A;  1OWP A;  5FQ7 A;  4ANX A;  4J6I A;  3ZYM A;  2J08 A;  3R9A B;  3GZ1 A;  3CHQ A;  3CSF A;  2WQH A;  3FTU A;  1GW6 A;  4FP7 A;  3IBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...