1N4PA

Protein geranylgeranyltransferase type-i complexed with geranylgeranyl diphosphate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
total genus 127
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4pA00
3DSUA 3HXEA 1QBQA 3KSQA 2IEJA 3E30A 1D8DA 3Q7AA 2H6IA 1N4QA 1O1RA 1DCEA 1TN7A 1O1SA 1SA4A 4GTOA 1LTXA 3DRAA 1TN8A 1TNZA 3DSVA 1FT1A 1N95A 3PZ2A 3KSLA 1FPPA 3Q78A 4YDOA 3Q7FA 1D8EA 3E34A 3PZ1A 2BEDA 1SA5A 1N4SA 3C72A 4GTTA 3E33A 1LD8A 1TN6A 1X81A 2ZIRA 1JCRA 1TNYA 1TNBA 1KZPA 4GTQA 4GTSA 1N9AA 3HXCA 2H6GA 4GTVA 4GTPA 1JCSA 3HXBA 4LNGA 4GTRA 1MZCA 1LD7A 1FT2A 1N4RA 3PZ4A 3SFYA 3HXFA 3DPYA 3E37A 4L9PA 3PZ3A 4MBGA 2H6HA 1N94A 2ZISA 3E32A 3SFXA 3DSSA 2H6FA 3HXDA 4YDEA 1O5MA 3Q79A 3Q73A 3EUVA 1KZOA 1TNUA 1S64A 4GTMA 4EHMA 3Q75A 1N4PA 2R2LA 1NI1A 1NL4A 3DSWA 3EU5A 1O1TA 2F0YA 1TNOA 3DSTA 3DSXA 1JCQA 1S63A 4LNBA
chains in the Genus database with same CATH superfamily
3D9OA 2Y4TA 1WM5A 2DCPA 3RAUA 3KSQA 1EPUA 3V31A 4RVBA 3SBTB 3UKUG 2E0IA 2J09A 3EHNA 4ILHB 2RG8A 3CK8A 3ASDA 3T5XA 1Z3XA 4B8AA 3RRUA 3FUNA 4U0SA 3D9MA 4G26A 3JXJA 4K03A 3ULQA 4IYPA 3C72A 3UM0A 2X6IA 3NF1A 1MHQA 2ETBA 2ZIRA 5HKPA 2VYIA 4LNUD 4GTQA 2H6GA 4GTPA 5C1DA 3V79K 1QYMA 4G1TA 2JLBA 1HG2A 4F7AA 1UJJA 3ZXSA 3LJNA 2IF4A 5JJ7A 3CLJA 4Y6WA 4BT8A 1AWCB 4I6GA 3DXKG 4Q69A 4Q96A 4G11A 3L82A 2XEVA 4K5BA 2XPYA 5FZQA 4DRXE 3MV3B 5EKQD 3TG4A 4J8EA 4GPKA 4I2ZA 5FT9A 5CCLA 1FCHA 3FY4A 2Y0BG 4GZCA 5EYLA 4CYMD 4M7CA 1DCEA 3CKCA 2VGXB 3QWVA 4EPZA 2P2CP 2QZAA 3PZ2A 3IKOB 1FPPA 3UT7A 2L0IA 3UINC 1TYQG 3U4TA 4N2SA 5HQ8A 4EECA 1UN9A 4FJYA 1SQMA 5AQ9A 4RG6A 4JD2G 1PY1A 3ASGA 4ANVA 3HXCA 3ZYMA 4DX5D 4AY6A 2HO1A 1FT2A 4WUYA 5CBOA 5BT1A 3PS6A 3S2AA 3CHMA 3PUKA 3C5RA 2KBXA 3AS8A 1OCOE 2R05A 4MBGA 5CBNA 2ZISA 4N39A 4U7EB 2OCCE 5CRUA 2PNNA 1UN8A 3PH0C 2UY1B 3QJZA 3TWVA 2P9KG 2WXIA 1WY6A 2LSUA 3ZFWA 1BPOA 4FA6A 1KZOA 1YMPA 3SD5A 4TUMA 2WPVA 2IU1A 3UIPC 4U96D 5AJLA 3EIQC 1WDYA 5ENRD 4C0EA 2DZNA 3X2QE 1X5BA 1INZA 1QQEA 3ESLA 3FHEA 4UWFA 1GW6A 5H7PA 1OCCE 4BY6A 4XE0A 1HO8A 5T3RA 4XI0A 2IEJA 2VSOE 3FUDA 3JUEA 3ULEG 2Y4UA 3C98A 3GZ2A 3VLFA 2PL2A 2XEHA 3PDNA 1NFIE 1EF1C 2GRMA 3L08A 3NOCD 1K3ZD 3L54A 4NIKA 4GZ5A 2OOEA 4U63A 3RO2A 2LO6A 3OXGA 4JZYA 3FULA 2HR2A 2MOWA 1YA0A 2A5UA 4WWOA 1TN6A 2VSXE 2WXLA 3P2BA 3FFLA 2XPIA 3ASOE 4KZ0A 1MYOA 5CEAA 2XQ0A 4FULA 2QY7A 3CVYA 4EQFA 3PZ4A 4TXRA 3SNXA 1JWFA 4IN3B 3DPYA 2JABA 5FQ4A 4BTBA 3JYSA 3UT8A 2CHXA 3CV0A 4B93B 2V8SE 1E8WA 1O5MA 4FU3A 5JJ6A 4GYWA 4NURA 4LUNU 4KZCA 4DX6D 3BEEA 5B1BE 3FH7A 3MJWA 1IQUA 4CDNA 4AVXA 2R2LA 2NSZA 1E8ZA 4J7WA 1S70B 5AARA 5LOZA 4AEZC 4ACLA 4O60A 3AU4A 1WG0A 3HXEA 5T8IA 1QBQA 4HFGA 1L5JA 5KCMA 4CT0A 2WM9A 3ZNGA 1AP7A 2XHEA 3UPVA 1NA0A 1HF8A 1UJKA 1Y8MA 3QNKA 3RSEG 3DRAA 4A63B 2R5SA 3KAEA 4A55A 1U3CA 2ZXWE 4EZKA 3TAXA 3LS8A 3AJIA 3ML8A 4UQXA 1KLXA 3JCKC 4AXHA 3RRMB 5FQ6A 3ONLA 2MYOA 4TXQA 1JCRA 3TWUA 4WNDA 3FU5A 1MZCA 1OWOA 5E75A 4UWLA 3PE4A 3JQ0A 4U0UA 4K5CA 2XRYA 2J08A 4FP7A 2MHKA 3QK0A 1H6PA 3KEAA 3MV2B 2IFUA 4I6EA 3DEOA 2MRIA 3RRNB 4I43A 3CEQA 3DWLG 2J07A 3TWXA 2YHEA 2XS8A 4L1BA 4EZLA 1IQRA 3JQ1A 3FH5A 4Q94A 3PNTB 1E7VA 3AS5A 4GYOA 1SVXA 5M72A 5ENNA 3AAAC 3D9IA 1SZ9A 4GA1A 3D9JA 4UQZA 1ZB1A 3UI2A 4KXKB 3UM2A 3ASHA 2KZTA 4HOTA 5CERB 3OXLA 4JW1A 3TXNA 4C0MA 5AJDA 1D8EA 4GA2A 4NRHB 4J8SA 2ILRA 5B3SE 5HRYA 1KT0A 1X81A 3LY7A 5AQ7A 3TWSA 4HOUA 4GTVA 1PAQA 3RIBA 2IJGX 4UQYA 3AG3E 3W9GA 5ARFA 2Q7FA 5G55A 3CVLA 3U64A 3D9KA 3GZSA 3NZUA 4JEHA 5AAOA 3ZUVB 2BUGA 3AS4A 4JB8P 4JA9A 2AXVA 3Q73A 5KBAA 4JEUA 1N11A 3D3MA 4ATZD 3ZRHA 5KJKA 1UW4B 3MKRA 1TEZA 4WAFA 5ANLA 4LG6A 3Q15A 4HI8A 4UI9K 2EINE 3QOUA 3UMVA 4G24A 4WNGA 2IO3C 2XZDG 4D10C 3QKYA 4FHKA 2YNQA 1ELWA 1E8XA 1BI7B 3HVEA 2QYUA 3Q7AA 1N4QA 4O1PA 2VTBA 1NP7A 1ZBPA 4PS8A 3FP3A 2PM6A 2F37A 2XGMA 3LVRE 4L2YA 2DBAA 4GZDA 1WAO1 3CIAA 1H6OA 3ESKA 2LXLA 3Q5MA 4AJWA 4B89A 4BSXA 1SA5A 1IKND 3ABLE 3PZDA 4DI3A 2WQHA 4NACA 2E2EA 3UX4A 4GTSA 1N9AA 2HM8A 5KWDA 3C3RA 3SF4A 4AIFA 4XEIG 4GTRA 5ENOD 4BERA 5ENSD 3R9MA 4FC8A 5CEDB 3SI5A 4L9PA 1H2VC 4DX1A 4L23A 4DLQA 3L6AA 4U07A 4I6JA 4MRUA 3G2UA 5T4YA 5FZSA 4GTMA 2X6JA 3ZKJA 1DVPA 2J4BA 3C3QA 1RZ4A 2C2LA 2PQNA 2Y69E 2UWJG 2KZTB 4UWGA 2WXNA 3DSXA 1MX6A 3EHMA 2WXPA 2P9NG 1IXVA 3CVPA 3V2OA 2A4ZA 3FU3A 1ELKA 4DI4A 3ABKE 3UUXA 4ILIA 3ULYA 3IBEA 4IULA 3ZHEA 3PRZA 2GRNB 2HYZA 4CDMA 4XX5A 1V55E 1U2VG 4IRUA 5BW8C 3ZYKA 3NBNB 3PZ1A 4LERA 2WXOA 1N4SA 4GYYA 1BD8A 2VQ2A 4LRZA 4BETA 2FEZA 1K8KG 3JUIA 4MLPA 2B6CA 3CHOA 4KBQA 4CEMA 3FTSA 2DVWA 3CVUA 2BKKB 4XZ4A 3CVWA 5FWQA 3CK7A 5FIOA 4U8HA 4I9EA 3S7JA 2EIJE 3LVQE 3B7RL 5D0QD 4HLLA 2LXMA 3PREA 3CHQA 3DPDA 5A6CA 3UKRG 3W9FA 2WQ7A 5EIBE 4N3BA 4A1GA 3I4RB 3HVEB 3TWWA 4F6RD 1UOHA 4AY5A 4BTAA 3F6QA 4A3VA 1Z5SC 2VTBB 1KPSB 1NL4A 4PS3A 3SO8A 5BV1A 3SY2A 2P58C 4KT6B 4YDYA 4B94A 2KC7A 4JL0A 1W3BA 5D2MC 3ZGQA 3CQGB 1VDYA 3GZ1A 4F1PA 2Y1LE 5FQ8A 3VTXA 3CGHA 4DPRA 2AW6A 3SZ7A 5BUZA 1OT8A 5KJLA 3APDA 3WXXA 4J6IA 1MX2A 4ZHBA 4RG9A 5JHBA 2Y3AA 5JA4D 4N2QA 3AG4E 4HOQA 3EHQA 5AIJA 2DWZA 3CHRA 2YHCA 3E33A 3Q49B 1LD8A 3ASFA 4DX7D 3ZEFA 4EBAA 4G8LA 2HE0A 1QZ2A 5BV0A 3O48A 3HXBA 3GW4A 3UT4A 5AQAA 1Z6TA 2A5EA 1YCSB 4B8CB 4RSYA 3E32A 5ANRA 3LPZA 4YDEA 1V54E 2L6BA 2WXFA 3I5PA 3MKQA 3BQOA 4U0ZA 3TWRA 3CHPA 4GB9A 4GMJA 2WB2A 5KJMA 4C9BB 3ZHEB 3FUFA 3VTYA 1LF8A 2GRRB 4LNBA 4KMOA 2FBNA 4XKBA 4FHJA 3SBSA 1D8DA 1OCRE 2LAHA 5JJTA 2OV8A 2L9BA 1JPLA 2P9IG 1O1SA 2XPZA 3PNLB 2WQ6A 1TR4A 3PUJA 3UXGA 2ZGGA 5HI7A 2LAIA 2WXKA 3FU0A 3Q78A 4BX8A 3OXFA 4NQ0A 4N3CA 3T9KA 4GCNA 2WXHA 3CVNA 2QYJA 5J08A 4TXPA 3B7SA 2XEEA 2V4HC 1BLXB 3FUKA 4GTTA 2IOSA 4O6FA 1H6KA 5CCMA 3TXMA 2AWIA 3ENEA 3CVQA 3G2SA 3PEUB 1PC2A 3L22A 1LD7A 4OYSA 2X38A 3HG0D 3D9LA 5CECB 3AG1E 3E37A 5EDSA 3UIOC 2R03A 3B95A 4DJAA 3L16A 2EIKE 3SGHA 4KVOA 5FTPA 4HB5A 4WWPA 3ABME 2J8SD 1OUVA 3RK6A 3SFZA 2OEVA 4KYOB 2OVBA 2J4DA 4ME2A 2XRZA 4AV7A 1JWGA 1MJ0A 3ISMC 4DX2A 3PEVB 3HIZA 4WNEA 3DXMG 3FWVA 3T8MA 3EU9A 4GU5A 4R7LA 1Q2ZA 1QNFA 4JC8A 1TJCA 4MKTA 4BFRA 3LDZA 4U8VD 1KT1A 4L2LA 5E76A 3I4GA 5KJNA 4HRNA 3UQ3A 1OWLA 3R9AB 2ETAA 4JA7A 4EBAG 4HVBA 3O4ZA 2ZU6B 3FTVA 1N95A 2WMNA 5EX0A 4APOA 3E34A 4LEUA 3ZYQA 1OWMA 3ZU7B 3HHMA 3LYAA 4FJZA 2FO1E 4YDWA 4XI9A 1TNYA 4CRWA 3B7TA 3QARA 1IHGA 4M3OA 3CSFA 1MQSA 3RO3A 4G8KA 2NXPA 1BI8B 1E7UA 5G2NA 3ZW3A 3EIJA 2XZTG 3MKQB 4RQIA 3SFYA 4N3AA 3RU0A 4BWRA 2GRLA 2IO2C 3D9HA 3EHRA 4HQDA 4GAAA 4HRLA 1N94A 4N5CA 3DSSA 2CFUA 4DK5A 3Q79A 5LFAA 1E8YA 4CDRA 3UM3A 4HNAD 2R17C 3CVVA 1NI1A 2M63A 4L7TA 3DSWA 4I1OB 3FTUA 3ONKA 4OVUA 3P1UA 1JCQA 1P5QA 1BU9A 3NQPA 4W9RA 4PH4B 2ZGDA 2XGSA 2OEWA 3AG2E 1LTXA 3RJVA 5FJYA 2LUHA 1TN8A 1DCQA 3CK9A 3LXUX 5JMND 3DSVA 1H19A 2PM7A 3LJ3A 2R59A 1HE8A 5B1AE 4HORA 2J49A 1B89A 3E4BA 2KM4A 2V0PA 3BG0B 4JPSA 4QQIA 2IOLA 2OVFA 4CT4A 4HRMB 3G2TA 3MX3A 1JCSA 4RLYA 1H2UA 1N4RA 1XNFA 3QWPA 3TG5A 2GRQB 3BU8A 3PZ3A 2EQXA 3N71A 3SFXA 4YVQC 3URZA 3HXDA 3IEGA 2WMOA 4PDXA 4B0ZA 2CFZA 3QC1A 2WXMA 3TGOA 4A1SA 5FQ7A 3ZYLA 4FADA 2X6FA 3B7UX 5CMYA 2CG2A 4G2VA 2I1JA 4TRQA 5BXUA 1JUQA 3UTMA 2YINA 4P29A 2J9QA 3DSUA 4H7XA 3CHSA 1S0PA 3E30A 3MEKA 2AJAA 2WXRA 1O1RA 4AOFA 4J0UA 1OCZE 2GRPB 1TJFA 4GTOA 4K0RA 1D9SA 2KXPC 4ATGA 3APCA 2KCVA 2WVIA 3T5VA 3L9TA 5A7DB 2WXQA 3FEXA 1UG3A 2JEKA 3J5QB 2VGYA 2AXUA 3ASNE 4GPMA 5ARGA 2VSNA 2DYSE 3V2XA 2V5QC 2GW1A 3FUMA 1MX4A 4YNDA 5ENPD 3HXFA 1H2TC 2KATA 4GZ3A 4GZ6A 2NC9A 2XENA 4QFVA 2H6HA 2CG3A 3K9IA 4N5QA 3J5PA 3CQCB 2IQCA 3Q9UC 3R7RA 1TNUA 1N54A 1S64A 1Z3YA 1OWNA 2LNIA 1E96B 5BNWA 5EIDA 3S7BA 3T8KA 2F0YA 1TNOA 4V3IA 3FUEA 4URKA 2AVPA 2WXGA 4E6HA 1N0RA 2X6HA 3QAQA 5ENTD 5IY5E 3SHFA 2BTDA 2V4LA 4AM9A 4JHRA 5G04J 2I9CA 1OWPA 3FUIA 4CGWA 1A17A 4I9CA 1HFAA 1FT1A 3IHYA 4DUIA 5BPPA 1HG5A 4GA0A 4PUCA 5CHEE 1DC2A 4PS7A 4ABNA 5C2YA 5BXOA 3TL5A 4HBDA 2EILE 2XCCA 2WXJA 3B13A 5ENQD 1XGWA 2KCKA 4JHJA 4J8DA 3SQVA 3MGBA 1K1AA 2P9UG 3BG1B 2BF0X 3FTXA 3PVLA 3R7QA 2AXZA 5KNGA 4OAUC 4UWHA 4CGVA 2P9LG 4XIFA 2I6HA 4JVSA 3MYVA 3AU5A 1YYHA 2LSVA 4F3VA 5DBKA 1IYGA 4EHMA 2VGEA 5CMWA 4LSZE 2FULA 4JXTA 3EU5A 3LY8A 2CHWA 3QDNA 1Y6IA 5LX8A 2L0TB 3DSTA 5G05J 5EILA 3FTZA 2X6KA 3WG7E 2DIWA 3KD7A 1EYHA 4Y6CA 4MS6A 5G04C 3MA5A 5AENA 2VJ8A 4ANXA 3LY9A 2R02A 2H6IA 3HDXA 4LCTA 1TN7A 4KVMA 3G2VA 3QWWA 4O1OA 3ML9A 3I3NA 3PE3A 1NA3A 2PZIA 5D66A 1HZ4A 4YDOA 3FUJA 5J90A 3Q7FA 4TUUA 4HOSA 4CCAA 2BEDA 3DEPA 2BKGA 2V5FA 4ANWA 3CR3A 3OTNA 3L13A 1OY3D 5AN8A 4EZJA 4DLOA 3UM1A 1SW6A 4LNGA 3CSTA 3GYZA 3MZLB 3ZVVA 1A5EA 2EIME 4H7YA 2C0MA 3DBSA 2RKKA 4I2WA 1G3NB 3V30A 2H6FA 4K5AB 2VSYA 2XCBA 5LP0A 4APFA 3HRAA 4BESA 3TWTA 3FTWA 2C0LA 4UUCA 5G05C 3S7FA 4GCOA 3TWQA 3MCXA 3NOGD 4ILGA 5CRVA 5HS0A 2I1KA 3FEYA 3FU6A 1S63A 4I1MA 4I17A 5A23A 2RFMA 3NB2A 2GGFA 1EDUA 2L6JA 4WNFA 1HX8A 4CZ2D 2ONDA 2YQ8A 3Q9NC 5JHAA 3IHVA 2DZOA 3VLEA 3ZXPA 4UI9J 4G25A 1ELRA 1TNZA 3CKBA 2IY0C 3RKVA 1HU3A 4YVOA 4GMLA 5AQBA 4XKCA 1N0QA 1FVHA 4HI9A 5LCWJ 3BUAA 1SZAA 3B7BA 4ANUA 4E85A 4BSZB 4Z68A 3S7DA 4HLEA 3ZPJA 1KZPA 3FUHA 3HYMB 3VLDA 2QFCA 1K1BA 3FH8A 4BX9A 3U9WA 4I1AA 4HS2A 4J8YA 5EX3A 3NZSA 3OAWA 2I2OA 5FZRA 2PQRA 1RW2A 4UWKA 2B0OE 1H0AA 3Q75A 4JHKA 3ZIMA 4U04A 5DIZA 2P9SG 1O1TA 3FTYA 3KS2A 5ITZF 2DYRE 2F8YA 4J8FA 2FI7A 3D9PA 4ACKA 2RFAA 4UI9C 2GROB 1ZU2A 5FINA 3CVXA 4OVVA 3G2WA 1SA4A 5D0OD 1NZNA 1N52A 4OAVB 4X8QA 5LCWC 2CHZA 1HH8A 1HS6A 3KSLA 3EJNA 3EDTB 3IV0A 2FF4A 3KEZA 3IXEA 4FLHA 4G23A 3LEWA 3L17A 4AP2A 2XS1A 2P9PG 3LKUA 3Q47B 5KNHD 2F8XK 3LCAA 3APFA 4BEPA 2VGXA 1TNBA 4BT9A 1DNPA 3U66A 3FDHA 1OXJA 4FLBA 3NAWA 2X3MA 4F53A 4U95D 2XGOA 4C48B 4U8YD 4TV3A 2IONA 2RD0A 5AYWD 2FO7A 1E90A 3EUVA 1IHBA 1FVFA 4A3TA 3JXIA 1N4PA 2ETCA 2NYJA 3TJPA 3U3WA 4F1SA 3ZN3A 3D9NA 4HXIA 3QB2A 2KCLA 3C3OA 4WWNA 3Q4AB 1U3DA 1HXIA 5EN5D 2QC9A 5EYPF 2UY1A 4ZFHA 4GMRA
chains in the Genus database with same CATH topology
3DSUA 3HXEA 1QBQA 3KSQA 2IEJA 3E30A 1D8DA 3Q7AA 2H6IA 1N4QA 1O1RA 1DCEA 1TN7A 1O1SA 1SA4A 4GTOA 1LTXA 3DRAA 1TN8A 1TNZA 3DSVA 1FT1A 1N95A 3PZ2A 3KSLA 1FPPA 3Q78A 4YDOA 3Q7FA 1D8EA 3E34A 3PZ1A 2BEDA 1SA5A 1N4SA 3C72A 4GTTA 3E33A 1LD8A 1TN6A 1X81A 2ZIRA 1JCRA 1TNYA 1TNBA 1KZPA 4GTQA 4GTSA 1N9AA 3HXCA 2H6GA 4GTVA 4GTPA 1JCSA 3HXBA 4LNGA 4GTRA 1MZCA 1LD7A 1FT2A 1N4RA 3PZ4A 3SFYA 3HXFA 3DPYA 3E37A 4L9PA 3PZ3A 4MBGA 2H6HA 1N94A 2ZISA 3E32A 3SFXA 3DSSA 2H6FA 3HXDA 4YDEA 1O5MA 3Q79A 3Q73A 3EUVA 1KZOA 1TNUA 1S64A 4GTMA 4EHMA 3Q75A 1N4PA 2R2LA 1NI1A 1NL4A 3DSWA 3EU5A 1O1TA 2F0YA 1TNOA 3DSTA 3DSXA 1JCQA 1S63A 4LNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSU A;  3HXE A;  1QBQ A;  3KSQ A;  2IEJ A;  3E30 A;  1D8D A;  3Q7A A;  2H6I A;  1N4Q A;  1O1R A;  1DCE A;  1TN7 A;  1O1S A;  1SA4 A;  4GTO A;  1LTX A;  3DRA A;  1TN8 A;  1TNZ A;  3DSV A;  1FT1 A;  1N95 A;  3PZ2 A;  3KSL A;  1FPP A;  3Q78 A;  4YDO A;  3Q7F A;  1D8E A;  3E34 A;  3PZ1 A;  2BED A;  1SA5 A;  1N4S A;  3C72 A;  4GTT A;  3E33 A;  1LD8 A;  1TN6 A;  1X81 A;  2ZIR A;  1JCR A;  1TNY A;  1TNB A;  1KZP A;  4GTQ A;  4GTS A;  1N9A A;  3HXC A;  2H6G A;  4GTV A;  4GTP A;  1JCS A;  3HXB A;  4LNG A;  4GTR A;  1MZC A;  1LD7 A;  1FT2 A;  1N4R A;  3PZ4 A;  3SFY A;  3HXF A;  3DPY A;  3E37 A;  4L9P A;  3PZ3 A;  4MBG A;  2H6H A;  1N94 A;  2ZIS A;  3E32 A;  3SFX A;  3DSS A;  2H6F A;  3HXD A;  4YDE A;  1O5M A;  3Q79 A;  3Q73 A;  3EUV A;  1KZO A;  1TNU A;  1S64 A;  4GTM A;  4EHM A;  3Q75 A;  1N4P A;  2R2L A;  1NI1 A;  1NL4 A;  3DSW A;  3EU5 A;  1O1T A;  2F0Y A;  1TNO A;  3DST A;  3DSX A;  1JCQ A;  1S63 A;  4LNB A; 
#chains in the Genus database with same CATH topology
 3D9O A;  2Y4T A;  1WM5 A;  2DCP A;  3RAU A;  3KSQ A;  1EPU A;  3V31 A;  4RVB A;  3SBT B;  3UKU G;  2E0I A;  2J09 A;  3EHN A;  4ILH B;  2RG8 A;  3CK8 A;  3ASD A;  3T5X A;  1Z3X A;  4B8A A;  3RRU A;  3FUN A;  4U0S A;  3D9M A;  4G26 A;  3JXJ A;  4K03 A;  3ULQ A;  4IYP A;  3C72 A;  3UM0 A;  2X6I A;  3NF1 A;  1MHQ A;  2ETB A;  2ZIR A;  5HKP A;  2VYI A;  4LNU D;  4GTQ A;  2H6G A;  4GTP A;  5C1D A;  3V79 K;  1QYM A;  4G1T A;  2JLB A;  1HG2 A;  4F7A A;  1UJJ A;  3ZXS A;  3LJN A;  2IF4 A;  5JJ7 A;  3CLJ A;  4Y6W A;  4BT8 A;  1AWC B;  4I6G A;  3DXK G;  4Q69 A;  4Q96 A;  4G11 A;  3L82 A;  2XEV A;  4K5B A;  2XPY A;  5FZQ A;  4DRX E;  3MV3 B;  5EKQ D;  3TG4 A;  4J8E A;  4GPK A;  4I2Z A;  5FT9 A;  5CCL A;  1FCH A;  3FY4 A;  2Y0B G;  4GZC A;  5EYL A;  4CYM D;  4M7C A;  1DCE A;  3CKC A;  2VGX B;  3QWV A;  4EPZ A;  2P2C P;  2QZA A;  3PZ2 A;  3IKO B;  1FPP A;  3UT7 A;  2L0I A;  3UIN C;  1TYQ G;  3U4T A;  4N2S A;  5HQ8 A;  4EEC A;  1UN9 A;  4FJY A;  1SQM A;  5AQ9 A;  4RG6 A;  4JD2 G;  1PY1 A;  3ASG A;  4ANV A;  3HXC A;  3ZYM A;  4DX5 D;  4AY6 A;  2HO1 A;  1FT2 A;  4WUY A;  5CBO A;  5BT1 A;  3PS6 A;  3S2A A;  3CHM A;  3PUK A;  3C5R A;  2KBX A;  3AS8 A;  1OCO E;  2R05 A;  4MBG A;  5CBN A;  2ZIS A;  4N39 A;  4U7E B;  2OCC E;  5CRU A;  2PNN A;  1UN8 A;  3PH0 C;  2UY1 B;  3QJZ A;  3TWV A;  2P9K G;  2WXI A;  1WY6 A;  2LSU A;  3ZFW A;  1BPO A;  4FA6 A;  1KZO A;  1YMP A;  3SD5 A;  4TUM A;  2WPV A;  2IU1 A;  3UIP C;  4U96 D;  5AJL A;  3EIQ C;  1WDY A;  5ENR D;  4C0E A;  2DZN A;  3X2Q E;  1X5B A;  1INZ A;  1QQE A;  3ESL A;  3FHE A;  4UWF A;  1GW6 A;  5H7P A;  1OCC E;  4BY6 A;  4XE0 A;  1HO8 A;  5T3R A;  4XI0 A;  2IEJ A;  2VSO E;  3FUD A;  3JUE A;  3ULE G;  2Y4U A;  3C98 A;  3GZ2 A;  3VLF A;  2PL2 A;  2XEH A;  3PDN A;  1NFI E;  1EF1 C;  2GRM A;  3L08 A;  3NOC D;  1K3Z D;  3L54 A;  4NIK A;  4GZ5 A;  2OOE A;  4U63 A;  3RO2 A;  2LO6 A;  3OXG A;  4JZY A;  3FUL A;  2HR2 A;  2MOW A;  1YA0 A;  2A5U A;  4WWO A;  1TN6 A;  2VSX E;  2WXL A;  3P2B A;  3FFL A;  2XPI A;  3ASO E;  4KZ0 A;  1MYO A;  5CEA A;  2XQ0 A;  4FUL A;  2QY7 A;  3CVY A;  4EQF A;  3PZ4 A;  4TXR A;  3SNX A;  1JWF A;  4IN3 B;  3DPY A;  2JAB A;  5FQ4 A;  4BTB A;  3JYS A;  3UT8 A;  2CHX A;  3CV0 A;  4B93 B;  2V8S E;  1E8W A;  1O5M A;  4FU3 A;  5JJ6 A;  4GYW A;  4NUR A;  4LUN U;  4KZC A;  4DX6 D;  3BEE A;  5B1B E;  3FH7 A;  3MJW A;  1IQU A;  4CDN A;  4AVX A;  2R2L A;  2NSZ A;  1E8Z A;  4J7W A;  1S70 B;  5AAR A;  5LOZ A;  4AEZ C;  4ACL A;  4O60 A;  3AU4 A;  1WG0 A;  3HXE A;  5T8I A;  1QBQ A;  4HFG A;  1L5J A;  5KCM A;  4CT0 A;  2WM9 A;  3ZNG A;  1AP7 A;  2XHE A;  3UPV A;  1NA0 A;  1HF8 A;  1UJK A;  1Y8M A;  3QNK A;  3RSE G;  3DRA A;  4A63 B;  2R5S A;  3KAE A;  4A55 A;  1U3C A;  2ZXW E;  4EZK A;  3TAX A;  3LS8 A;  3AJI A;  3ML8 A;  4UQX A;  1KLX A;  3JCK C;  4AXH A;  3RRM B;  5FQ6 A;  3ONL A;  2MYO A;  4TXQ A;  1JCR A;  3TWU A;  4WND A;  3FU5 A;  1MZC A;  1OWO A;  5E75 A;  4UWL A;  3PE4 A;  3JQ0 A;  4U0U A;  4K5C A;  2XRY A;  2J08 A;  4FP7 A;  2MHK A;  3QK0 A;  1H6P A;  3KEA A;  3MV2 B;  2IFU A;  4I6E A;  3DEO A;  2MRI A;  3RRN B;  4I43 A;  3CEQ A;  3DWL G;  2J07 A;  3TWX A;  2YHE A;  2XS8 A;  4L1B A;  4EZL A;  1IQR A;  3JQ1 A;  3FH5 A;  4Q94 A;  3PNT B;  1E7V A;  3AS5 A;  4GYO A;  1SVX A;  5M72 A;  5ENN A;  3AAA C;  3D9I A;  1SZ9 A;  4GA1 A;  3D9J A;  4UQZ A;  1ZB1 A;  3UI2 A;  4KXK B;  3UM2 A;  3ASH A;  2KZT A;  4HOT A;  5CER B;  3OXL A;  4JW1 A;  3TXN A;  4C0M A;  5AJD A;  1D8E A;  4GA2 A;  4NRH B;  4J8S A;  2ILR A;  5B3S E;  5HRY A;  1KT0 A;  1X81 A;  3LY7 A;  5AQ7 A;  3TWS A;  4HOU A;  4GTV A;  1PAQ A;  3RIB A;  2IJG X;  4UQY A;  3AG3 E;  3W9G A;  5ARF A;  2Q7F A;  5G55 A;  3CVL A;  3U64 A;  3D9K A;  3GZS A;  3NZU A;  4JEH A;  5AAO A;  3ZUV B;  2BUG A;  3AS4 A;  4JB8 P;  4JA9 A;  2AXV A;  3Q73 A;  5KBA A;  4JEU A;  1N11 A;  3D3M A;  4ATZ D;  3ZRH A;  5KJK A;  1UW4 B;  3MKR A;  1TEZ A;  4WAF A;  5ANL A;  4LG6 A;  3Q15 A;  4HI8 A;  4UI9 K;  2EIN E;  3QOU A;  3UMV A;  4G24 A;  4WNG A;  2IO3 C;  2XZD G;  4D10 C;  3QKY A;  4FHK A;  2YNQ A;  1ELW A;  1E8X A;  1BI7 B;  3HVE A;  2QYU A;  3Q7A A;  1N4Q A;  4O1P A;  2VTB A;  1NP7 A;  1ZBP A;  4PS8 A;  3FP3 A;  2PM6 A;  2F37 A;  2XGM A;  3LVR E;  4L2Y A;  2DBA A;  4GZD A;  1WAO 1;  3CIA A;  1H6O A;  3ESK A;  2LXL A;  3Q5M A;  4AJW A;  4B89 A;  4BSX A;  1SA5 A;  1IKN D;  3ABL E;  3PZD A;  4DI3 A;  2WQH A;  4NAC A;  2E2E A;  3UX4 A;  4GTS A;  1N9A A;  2HM8 A;  5KWD A;  3C3R A;  3SF4 A;  4AIF A;  4XEI G;  4GTR A;  5ENO D;  4BER A;  5ENS D;  3R9M A;  4FC8 A;  5CED B;  3SI5 A;  4L9P A;  1H2V C;  4DX1 A;  4L23 A;  4DLQ A;  3L6A A;  4U07 A;  4I6J A;  4MRU A;  3G2U A;  5T4Y A;  5FZS A;  4GTM A;  2X6J A;  3ZKJ A;  1DVP A;  2J4B A;  3C3Q A;  1RZ4 A;  2C2L A;  2PQN A;  2Y69 E;  2UWJ G;  2KZT B;  4UWG A;  2WXN A;  3DSX A;  1MX6 A;  3EHM A;  2WXP A;  2P9N G;  1IXV A;  3CVP A;  3V2O A;  2A4Z A;  3FU3 A;  1ELK A;  4DI4 A;  3ABK E;  3UUX A;  4ILI A;  3ULY A;  3IBE A;  4IUL A;  3ZHE A;  3PRZ A;  2GRN B;  2HYZ A;  4CDM A;  4XX5 A;  1V55 E;  1U2V G;  4IRU A;  5BW8 C;  3ZYK A;  3NBN B;  3PZ1 A;  4LER A;  2WXO A;  1N4S A;  4GYY A;  1BD8 A;  2VQ2 A;  4LRZ A;  4BET A;  2FEZ A;  1K8K G;  3JUI A;  4MLP A;  2B6C A;  3CHO A;  4KBQ A;  4CEM A;  3FTS A;  2DVW A;  3CVU A;  2BKK B;  4XZ4 A;  3CVW A;  5FWQ A;  3CK7 A;  5FIO A;  4U8H A;  4I9E A;  3S7J A;  2EIJ E;  3LVQ E;  3B7R L;  5D0Q D;  4HLL A;  2LXM A;  3PRE A;  3CHQ A;  3DPD A;  5A6C A;  3UKR G;  3W9F A;  2WQ7 A;  5EIB E;  4N3B A;  4A1G A;  3I4R B;  3HVE B;  3TWW A;  4F6R D;  1UOH A;  4AY5 A;  4BTA A;  3F6Q A;  4A3V A;  1Z5S C;  2VTB B;  1KPS B;  1NL4 A;  4PS3 A;  3SO8 A;  5BV1 A;  3SY2 A;  2P58 C;  4KT6 B;  4YDY A;  4B94 A;  2KC7 A;  4JL0 A;  1W3B A;  5D2M C;  3ZGQ A;  3CQG B;  1VDY A;  3GZ1 A;  4F1P A;  2Y1L E;  5FQ8 A;  3VTX A;  3CGH A;  4DPR A;  2AW6 A;  3SZ7 A;  5BUZ A;  1OT8 A;  5KJL A;  3APD A;  3WXX A;  4J6I A;  1MX2 A;  4ZHB A;  4RG9 A;  5JHB A;  2Y3A A;  5JA4 D;  4N2Q A;  3AG4 E;  4HOQ A;  3EHQ A;  5AIJ A;  2DWZ A;  3CHR A;  2YHC A;  3E33 A;  3Q49 B;  1LD8 A;  3ASF A;  4DX7 D;  3ZEF A;  4EBA A;  4G8L A;  2HE0 A;  1QZ2 A;  5BV0 A;  3O48 A;  3HXB A;  3GW4 A;  3UT4 A;  5AQA A;  1Z6T A;  2A5E A;  1YCS B;  4B8C B;  4RSY A;  3E32 A;  5ANR A;  3LPZ A;  4YDE A;  1V54 E;  2L6B A;  2WXF A;  3I5P A;  3MKQ A;  3BQO A;  4U0Z A;  3TWR A;  3CHP A;  4GB9 A;  4GMJ A;  2WB2 A;  5KJM A;  4C9B B;  3ZHE B;  3FUF A;  3VTY A;  1LF8 A;  2GRR B;  4LNB A;  4KMO A;  2FBN A;  4XKB A;  4FHJ A;  3SBS A;  1D8D A;  1OCR E;  2LAH A;  5JJT A;  2OV8 A;  2L9B A;  1JPL A;  2P9I G;  1O1S A;  2XPZ A;  3PNL B;  2WQ6 A;  1TR4 A;  3PUJ A;  3UXG A;  2ZGG A;  5HI7 A;  2LAI A;  2WXK A;  3FU0 A;  3Q78 A;  4BX8 A;  3OXF A;  4NQ0 A;  4N3C A;  3T9K A;  4GCN A;  2WXH A;  3CVN A;  2QYJ A;  5J08 A;  4TXP A;  3B7S A;  2XEE A;  2V4H C;  1BLX B;  3FUK A;  4GTT A;  2IOS A;  4O6F A;  1H6K A;  5CCM A;  3TXM A;  2AWI A;  3ENE A;  3CVQ A;  3G2S A;  3PEU B;  1PC2 A;  3L22 A;  1LD7 A;  4OYS A;  2X38 A;  3HG0 D;  3D9L A;  5CEC B;  3AG1 E;  3E37 A;  5EDS A;  3UIO C;  2R03 A;  3B95 A;  4DJA A;  3L16 A;  2EIK E;  3SGH A;  4KVO A;  5FTP A;  4HB5 A;  4WWP A;  3ABM E;  2J8S D;  1OUV A;  3RK6 A;  3SFZ A;  2OEV A;  4KYO B;  2OVB A;  2J4D A;  4ME2 A;  2XRZ A;  4AV7 A;  1JWG A;  1MJ0 A;  3ISM C;  4DX2 A;  3PEV B;  3HIZ A;  4WNE A;  3DXM G;  3FWV A;  3T8M A;  3EU9 A;  4GU5 A;  4R7L A;  1Q2Z A;  1QNF A;  4JC8 A;  1TJC A;  4MKT A;  4BFR A;  3LDZ A;  4U8V D;  1KT1 A;  4L2L A;  5E76 A;  3I4G A;  5KJN A;  4HRN A;  3UQ3 A;  1OWL A;  3R9A B;  2ETA A;  4JA7 A;  4EBA G;  4HVB A;  3O4Z A;  2ZU6 B;  3FTV A;  1N95 A;  2WMN A;  5EX0 A;  4APO A;  3E34 A;  4LEU A;  3ZYQ A;  1OWM A;  3ZU7 B;  3HHM A;  3LYA A;  4FJZ A;  2FO1 E;  4YDW A;  4XI9 A;  1TNY A;  4CRW A;  3B7T A;  3QAR A;  1IHG A;  4M3O A;  3CSF A;  1MQS A;  3RO3 A;  4G8K A;  2NXP A;  1BI8 B;  1E7U A;  5G2N A;  3ZW3 A;  3EIJ A;  2XZT G;  3MKQ B;  4RQI A;  3SFY A;  4N3A A;  3RU0 A;  4BWR A;  2GRL A;  2IO2 C;  3D9H A;  3EHR A;  4HQD A;  4GAA A;  4HRL A;  1N94 A;  4N5C A;  3DSS A;  2CFU A;  4DK5 A;  3Q79 A;  5LFA A;  1E8Y A;  4CDR A;  3UM3 A;  4HNA D;  2R17 C;  3CVV A;  1NI1 A;  2M63 A;  4L7T A;  3DSW A;  4I1O B;  3FTU A;  3ONK A;  4OVU A;  3P1U A;  1JCQ A;  1P5Q A;  1BU9 A;  3NQP A;  4W9R A;  4PH4 B;  2ZGD A;  2XGS A;  2OEW A;  3AG2 E;  1LTX A;  3RJV A;  5FJY A;  2LUH A;  1TN8 A;  1DCQ A;  3CK9 A;  3LXU X;  5JMN D;  3DSV A;  1H19 A;  2PM7 A;  3LJ3 A;  2R59 A;  1HE8 A;  5B1A E;  4HOR A;  2J49 A;  1B89 A;  3E4B A;  2KM4 A;  2V0P A;  3BG0 B;  4JPS A;  4QQI A;  2IOL A;  2OVF A;  4CT4 A;  4HRM B;  3G2T A;  3MX3 A;  1JCS A;  4RLY A;  1H2U A;  1N4R A;  1XNF A;  3QWP A;  3TG5 A;  2GRQ B;  3BU8 A;  3PZ3 A;  2EQX A;  3N71 A;  3SFX A;  4YVQ C;  3URZ A;  3HXD A;  3IEG A;  2WMO A;  4PDX A;  4B0Z A;  2CFZ A;  3QC1 A;  2WXM A;  3TGO A;  4A1S A;  5FQ7 A;  3ZYL A;  4FAD A;  2X6F A;  3B7U X;  5CMY A;  2CG2 A;  4G2V A;  2I1J A;  4TRQ A;  5BXU A;  1JUQ A;  3UTM A;  2YIN A;  4P29 A;  2J9Q A;  3DSU A;  4H7X A;  3CHS A;  1S0P A;  3E30 A;  3MEK A;  2AJA A;  2WXR A;  1O1R A;  4AOF A;  4J0U A;  1OCZ E;  2GRP B;  1TJF A;  4GTO A;  4K0R A;  1D9S A;  2KXP C;  4ATG A;  3APC A;  2KCV A;  2WVI A;  3T5V A;  3L9T A;  5A7D B;  2WXQ A;  3FEX A;  1UG3 A;  2JEK A;  3J5Q B;  2VGY A;  2AXU A;  3ASN E;  4GPM A;  5ARG A;  2VSN A;  2DYS E;  3V2X A;  2V5Q C;  2GW1 A;  3FUM A;  1MX4 A;  4YND A;  5ENP D;  3HXF A;  1H2T C;  2KAT A;  4GZ3 A;  4GZ6 A;  2NC9 A;  2XEN A;  4QFV A;  2H6H A;  2CG3 A;  3K9I A;  4N5Q A;  3J5P A;  3CQC B;  2IQC A;  3Q9U C;  3R7R A;  1TNU A;  1N54 A;  1S64 A;  1Z3Y A;  1OWN A;  2LNI A;  1E96 B;  5BNW A;  5EID A;  3S7B A;  3T8K A;  2F0Y A;  1TNO A;  4V3I A;  3FUE A;  4URK A;  2AVP A;  2WXG A;  4E6H A;  1N0R A;  2X6H A;  3QAQ A;  5ENT D;  5IY5 E;  3SHF A;  2BTD A;  2V4L A;  4AM9 A;  4JHR A;  5G04 J;  2I9C A;  1OWP A;  3FUI A;  4CGW A;  1A17 A;  4I9C A;  1HFA A;  1FT1 A;  3IHY A;  4DUI A;  5BPP A;  1HG5 A;  4GA0 A;  4PUC A;  5CHE E;  1DC2 A;  4PS7 A;  4ABN A;  5C2Y A;  5BXO A;  3TL5 A;  4HBD A;  2EIL E;  2XCC A;  2WXJ A;  3B13 A;  5ENQ D;  1XGW A;  2KCK A;  4JHJ A;  4J8D A;  3SQV A;  3MGB A;  1K1A A;  2P9U G;  3BG1 B;  2BF0 X;  3FTX A;  3PVL A;  3R7Q A;  2AXZ A;  5KNG A;  4OAU C;  4UWH A;  4CGV A;  2P9L G;  4XIF A;  2I6H A;  4JVS A;  3MYV A;  3AU5 A;  1YYH A;  2LSV A;  4F3V A;  5DBK A;  1IYG A;  4EHM A;  2VGE A;  5CMW A;  4LSZ E;  2FUL A;  4JXT A;  3EU5 A;  3LY8 A;  2CHW A;  3QDN A;  1Y6I A;  5LX8 A;  2L0T B;  3DST A;  5G05 J;  5EIL A;  3FTZ A;  2X6K A;  3WG7 E;  2DIW A;  3KD7 A;  1EYH A;  4Y6C A;  4MS6 A;  5G04 C;  3MA5 A;  5AEN A;  2VJ8 A;  4ANX A;  3LY9 A;  2R02 A;  2H6I A;  3HDX A;  4LCT A;  1TN7 A;  4KVM A;  3G2V A;  3QWW A;  4O1O A;  3ML9 A;  3I3N A;  3PE3 A;  1NA3 A;  2PZI A;  5D66 A;  1HZ4 A;  4YDO A;  3FUJ A;  5J90 A;  3Q7F A;  4TUU A;  4HOS A;  4CCA A;  2BED A;  3DEP A;  2BKG A;  2V5F A;  4ANW A;  3CR3 A;  3OTN A;  3L13 A;  1OY3 D;  5AN8 A;  4EZJ A;  4DLO A;  3UM1 A;  1SW6 A;  4LNG A;  3CST A;  3GYZ A;  3MZL B;  3ZVV A;  1A5E A;  2EIM E;  4H7Y A;  2C0M A;  3DBS A;  2RKK A;  4I2W A;  1G3N B;  3V30 A;  2H6F A;  4K5A B;  2VSY A;  2XCB A;  5LP0 A;  4APF A;  3HRA A;  4BES A;  3TWT A;  3FTW A;  2C0L A;  4UUC A;  5G05 C;  3S7F A;  4GCO A;  3TWQ A;  3MCX A;  3NOG D;  4ILG A;  5CRV A;  5HS0 A;  2I1K A;  3FEY A;  3FU6 A;  1S63 A;  4I1M A;  4I17 A;  5A23 A;  2RFM A;  3NB2 A;  2GGF A;  1EDU A;  2L6J A;  4WNF A;  1HX8 A;  4CZ2 D;  2OND A;  2YQ8 A;  3Q9N C;  5JHA A;  3IHV A;  2DZO A;  3VLE A;  3ZXP A;  4UI9 J;  4G25 A;  1ELR A;  1TNZ A;  3CKB A;  2IY0 C;  3RKV A;  1HU3 A;  4YVO A;  4GML A;  5AQB A;  4XKC A;  1N0Q A;  1FVH A;  4HI9 A;  5LCW J;  3BUA A;  1SZA A;  3B7B A;  4ANU A;  4E85 A;  4BSZ B;  4Z68 A;  3S7D A;  4HLE A;  3ZPJ A;  1KZP A;  3FUH A;  3HYM B;  3VLD A;  2QFC A;  1K1B A;  3FH8 A;  4BX9 A;  3U9W A;  4I1A A;  4HS2 A;  4J8Y A;  5EX3 A;  3NZS A;  3OAW A;  2I2O A;  5FZR A;  2PQR A;  1RW2 A;  4UWK A;  2B0O E;  1H0A A;  3Q75 A;  4JHK A;  3ZIM A;  4U04 A;  5DIZ A;  2P9S G;  1O1T A;  3FTY A;  3KS2 A;  5ITZ F;  2DYR E;  2F8Y A;  4J8F A;  2FI7 A;  3D9P A;  4ACK A;  2RFA A;  4UI9 C;  2GRO B;  1ZU2 A;  5FIN A;  3CVX A;  4OVV A;  3G2W A;  1SA4 A;  5D0O D;  1NZN A;  1N52 A;  4OAV B;  4X8Q A;  5LCW C;  2CHZ A;  1HH8 A;  1HS6 A;  3KSL A;  3EJN A;  3EDT B;  3IV0 A;  2FF4 A;  3KEZ A;  3IXE A;  4FLH A;  4G23 A;  3LEW A;  3L17 A;  4AP2 A;  2XS1 A;  2P9P G;  3LKU A;  3Q47 B;  5KNH D;  2F8X K;  3LCA A;  3APF A;  4BEP A;  2VGX A;  1TNB A;  4BT9 A;  1DNP A;  3U66 A;  3FDH A;  1OXJ A;  4FLB A;  3NAW A;  2X3M A;  4F53 A;  4U95 D;  2XGO A;  4C48 B;  4U8Y D;  4TV3 A;  2ION A;  2RD0 A;  5AYW D;  2FO7 A;  1E90 A;  3EUV A;  1IHB A;  1FVF A;  4A3T A;  3JXI A;  1N4P A;  2ETC A;  2NYJ A;  3TJP A;  3U3W A;  4F1S A;  3ZN3 A;  3D9N A;  4HXI A;  3QB2 A;  2KCL A;  3C3O A;  4WWN A;  3Q4A B;  1U3D A;  1HXI A;  5EN5 D;  2QC9 A;  5EYP F;  2UY1 A;  4ZFH A;  4GMR A; 
#chains in the Genus database with same CATH homology
 3DSU A;  3HXE A;  1QBQ A;  3KSQ A;  2IEJ A;  3E30 A;  1D8D A;  3Q7A A;  2H6I A;  1N4Q A;  1O1R A;  1DCE A;  1TN7 A;  1O1S A;  1SA4 A;  4GTO A;  1LTX A;  3DRA A;  1TN8 A;  1TNZ A;  3DSV A;  1FT1 A;  1N95 A;  3PZ2 A;  3KSL A;  1FPP A;  3Q78 A;  4YDO A;  3Q7F A;  1D8E A;  3E34 A;  3PZ1 A;  2BED A;  1SA5 A;  1N4S A;  3C72 A;  4GTT A;  3E33 A;  1LD8 A;  1TN6 A;  1X81 A;  2ZIR A;  1JCR A;  1TNY A;  1TNB A;  1KZP A;  4GTQ A;  4GTS A;  1N9A A;  3HXC A;  2H6G A;  4GTV A;  4GTP A;  1JCS A;  3HXB A;  4LNG A;  4GTR A;  1MZC A;  1LD7 A;  1FT2 A;  1N4R A;  3PZ4 A;  3SFY A;  3HXF A;  3DPY A;  3E37 A;  4L9P A;  3PZ3 A;  4MBG A;  2H6H A;  1N94 A;  2ZIS A;  3E32 A;  3SFX A;  3DSS A;  2H6F A;  3HXD A;  4YDE A;  1O5M A;  3Q79 A;  3Q73 A;  3EUV A;  1KZO A;  1TNU A;  1S64 A;  4GTM A;  4EHM A;  3Q75 A;  1N4P A;  2R2L A;  1NI1 A;  1NL4 A;  3DSW A;  3EU5 A;  1O1T A;  2F0Y A;  1TNO A;  3DST A;  3DSX A;  1JCQ A;  1S63 A;  4LNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...