1N4PA

Protein geranylgeranyltransferase type-i complexed with geranylgeranyl diphosphate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 127
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4pA00
1JCQA 1FT1A 4L9PA 1S63A 1N9AA 1FPPA 3E30A 1JCSA 3PZ3A 3PZ2A 2R2LA 1S64A 3E37A 1MZCA 3DRAA 3DSSA 3E34A 2F0YA 1O5MA 1TNBA 3DSUA 1D8EA 1NL4A 3DPYA 2IEJA 4LNBA 3Q75A 4GTSA 1TNOA 1TNUA 1LTXA 1TNZA 1TNYA 1KZOA 4GTOA 1D8DA 1FT2A 3HXEA 3Q79A 3DSVA 3Q73A 3DSXA 4YDOA 1O1TA 4LNGA 1N4PA 4YDEA 1TN7A 4GTMA 1N4RA 3DSWA 1QBQA 1KZPA 2BEDA 1N95A 1O1RA 4MBGA 1LD7A 3Q78A 4GTRA 4GTVA 2H6HA 1JCRA 3SFYA 3E32A 1DCEA 3EUVA 1TN8A 4GTTA 1SA4A 1SA5A 2H6FA 2ZISA 2H6GA 3Q7FA 1O1SA 3KSQA 3PZ4A 3HXBA 4GTPA 4EHMA 1N4SA 3Q7AA 3HXCA 3HXFA 3C72A 2H6IA 1LD8A 1NI1A 3DSTA 1N4QA 3EU5A 3KSLA 3PZ1A 3SFXA 4GTQA 2ZIRA 3E33A 1TN6A 1N94A 3HXDA 1X81A
chains in the Genus database with same CATH superfamily
1JCQA 3UM3A 5AJLA 2PNNA 1H2UA 4AOFA 1O5MA 3HRAA 5KJLA 4GYWA 4HRLA 1IKND 4UWHA 1E96B 2IO3C 1UN9A 5BT1A 2IY0C 2ZU6B 5D66A 5CEDB 5EX3A 3FEXA 2NC9A 4TUMA 5KNHD 3V30A 4J8YA 5T8IA 4EBAA 4K0RA 1FCHA 3EHMA 3FU6A 3FDHA 4PUCA 3ZW3A 1N4RA 2VSOE 5FQ7A 3G2VA 3W9GA 3ESKA 4J8DA 3RSEG 4I9EA 1ZB1A 1TN8A 5ARGA 4DUIA 3Q9NC 3Q7FA 2DYRE 1SW6A 4YNDA 2KCLA 1K3ZD 1HFAA 2LXMA 2XGMA 3PZ4A 3FWVA 3G2TA 2QC9A 2I9CA 2UY1A 3EDTB 3RAUA 4UI9J 2EILE 4O1OA 4XX5A 5EKQD 3BG0B 1TN6A 3FUKA 3U9WA 2I1JA 3VLEA 4QFVA 3UPVA 1SVXA 3LVQE 5FTPA 4CEMA 5ENQD 3DRAA 5G04J 2R03A 2RD0A 2CFUA 3CVNA 4TXRA 1YYHA 4OVUA 3SBTB 3ZXPA 1N54A 1OUVA 3KAEA 4G11A 1FT2A 1OCZE 5EIBE 3O48A 3UXGA 2KCKA 5BUZA 3SFZA 3ASFA 3AU5A 2WXFA 2BKKB 5T3RA 5KJMA 5A6CA 2X3MA 2PQNA 1S70B 4H7XA 3O4ZA 2GRQB 3CIAA 5KWDA 3RK6A 1JCRA 1D9SA 4BSZB 4APFA 4GA1A 4PS7A 5JHBA 1O1SA 1WG0A 2ZXWE 3NAWA 3JYSA 5AQ9A 4JPSA 3V2XA 4XI9A 2FULA 4CT0A 2GROB 4GZCA 1OY3D 3V31A 4DX5D 3EU5A 3KSLA 3FUJA 3ZUVB 2R59A 1UG3A 3HDXA 4F6RD 4AV7A 3CKBA 4NQ0A 1U3DA 3RRUA 3CK8A 2WXJA 3AG4E 3APDA 2CHZA 2B0OE 3EHNA 3LJ3A 5KJNA 4ATZD 3ZRHA 4GCOA 2NSZA 4N5QA 5J90A 4LNBA 3AG1E 5ITZF 3BUAA 4KMOA 1KPSB 2WXIA 1K1AA 3L6AA 2HO1A 2XHEA 2XGSA 4K5CA 4LEUA 4I2WA 3UQ3A 3TWVA 3DSVA 4Q96A 3SI5A 4AM9A 4XI0A 1NZNA 3TWSA 5ANLA 1UOHA 2RFMA 3ZKJA 4CDNA 4XKCA 3FH8A 4U0UA 2OCCE 4UI9C 3D9OA 1SA4A 2WXOA 3FH5A 5HS0A 3TG5A 2DWZA 1YMPA 3FU0A 5B1AE 3D9LA 3CVXA 4BTAA 4FLHA 5G2NA 4BESA 2KCVA 1TYQG 4FADA 5JA4D 2P9KG 3ZHEB 1OWLA 4ANXA 3HXFA 1LD8A 1BU9A 5C1DA 4I9CA 3CVLA 2FI7A 2J8SD 2RFAA 4LRZA 4UWLA 2ZIRA 2KZTA 4RVBA 3APFA 5A7DB 5EX0A 1FT1A 4AEZC 3ZYLA 4AIFA 4DLQA 3D9IA 4GCNA 2X6FA 1IYGA 3UM0A 4ACLA 3E37A 1ELRA 2C0LA 1FVHA 1X5BA 3CK9A 4KXKB 1H6OA 5E75A 3V2OA 5AAOA 3NOGD 4GPMA 1LTXA 2IQCA 4FHKA 4WNFA 3DWLG 1Z5SC 2MRIA 4HS2A 2VJ8A 2ETCA 2MYOA 4DX6D 4GTMA 4CGVA 1BPOA 1HZ4A 3OAWA 4GMLA 4XZ4A 2XCBA 2XZTG 3E32A 4HFGA 5FT9A 2J9QA 2PM6A 2M63A 2DZNA 2WXNA 3P2BA 2CHWA 1W3BA 2X6IA 3TWRA 2EIJE 3LKUA 3S7JA 4N3CA 2WXHA 5ANRA 4DI3A 2ILRA 5AJDA 3R7RA 3KD7A 2DVWA 1OCRE 5G05J 3AU4A 3TWXA 3NOCD 4G24A 3G2UA 1X81A 3W9FA 2IOSA 1S63A 3ONLA 2VGXA 4G2VA 4MRUA 2VGEA 2QYJA 1IHGA 5FQ8A 4G8LA 1PAQA 2AJAA 4KT6B 1V55E 3PEUB 1KLXA 3FP3A 3Q75A 2A5EA 1YA0A 3LPZA 4RG6A 2VTBA 3QAQA 4KZCA 2CG2A 2VQ2A 1HF8A 3DEOA 5FQ6A 4AY5A 1N0QA 4EZJA 2DZOA 2QYUA 5C2YA 3UINC 5AQAA 1FVFA 4OAUC 2KATA 5ENOD 4U04A 1O1TA 3PEVB 2E2EA 4UI9K 1JPLA 5FINA 3V79K 1LD7A 2I1KA 4N2QA 1DNPA 1QQEA 2VSYA 4Y6CA 3EJNA 4F53A 3BEEA 2EQXA 3FTUA 2H6FA 4CDRA 4M7CA 2ZISA 2H6GA 2WXQA 1TR4A 2FF4A 3ZPJA 1Z3YA 3DBSA 4GZ3A 4O60A 1V54E 4EPZA 4GTPA 5B3SE 5ARFA 3CR3A 4PDXA 1MJ0A 1E8ZA 4WNGA 5ENNA 4RLYA 1HG2A 4CZ2D 4U7EB 3CLJA 3EU9A 3L82A 3LVRE 3B7BA 3SGHA 1BI7B 2XPZA 3IHVA 3UT8A 3QK0A 3AG2E 4HLEA 3CEQA 4JXTA 3HVEB 2YHCA 5D0QD 1UJKA 2R5SA 3MYVA 3ULEG 2LSVA 3RO3A 4I2ZA 1SQMA 4GMRA 5CECB 5LCWJ 4YVQC 2XEEA 4J8SA 4AY6A 5AQBA 3MJWA 4JHJA 4L7TA 1N52A 2C0MA 4GU5A 3HIZA 1Q2ZA 2R17C 4BT8A 4D10C 3AJIA 5CBNA 2LSUA 1BI8B 3S7BA 4J8FA 4X8QA 5CERB 3FUDA 3QNKA 4B8CB 2OV8A 3LCAA 4I1MA 4PS8A 1WM5A 3VLFA 2CG3A 1ZU2A 3ML8A 4UQZA 4LG6A 5T4YA 1ELWA 2OEWA 4WWOA 3C3OA 2LO6A 4HBDA 5G05C 3FUMA 4HNAD 2P9UG 1U3CA 3EIQC 2WXMA 2RG8A 4ZHBA 3PNLB 1NA3A 1NA0A 3S7DA 3ASHA 1RZ4A 3QWVA 4JD2G 3NBNB 1AWCB 3FH7A 3PNTB 3FEYA 3ABLE 2OVFA 3P1UA 4XKBA 4B93B 4WNEA 3UIPC 2JABA 5CMWA 1OWPA 2HE0A 1MHQA 3CSFA 4HOTA 3PH0C 5EYPF 5HKPA 4Q94A 3E34A 4URKA 3QOUA 1HO8A 1NL4A 3QJZA 2IJGX 4KVOA 5HI7A 2AXZA 1A5EA 5CRUA 3I3NA 3ABME 3ASGA 4ANUA 3BQOA 4A1SA 2WXRA 3FU5A 4F3VA 3C98A 3SHFA 2Y1LE 3NF1A 2V5QC 4KYOB 3HXEA 3MKQB 1N11A 3Q73A 4YDYA 3D3MA 5M72A 4U8VD 3CKCA 3R9MA 3ASOE 2J4DA 3R9AB 4BTBA 2C2LA 4ILHB 3LJNA 3LY7A 2GW1A 2GRNB 2BF0X 2VGYA 3UMVA 4MLPA 2L6BA 5ENPD 1PC2A 4A63B 2HM8A 2XS1A 2ETAA 4K03A 5D2MC 3VLDA 2GRMA 3FTVA 2FBNA 2AWIA 1LF8A 3OXLA 4U8HA 4L2LA 3L16A 3NZSA 1TEZA 4J8EA 3JCKC 2BTDA 3CSTA 4F1SA 1K1BA 4HRNA 3Q15A 2V8SE 3CHOA 4UWGA 3JQ0A 2P9SG 3QWWA 4HB5A 3SO8A 3EIJA 5LCWC 4P29A 4UUCA 1N9AA 3PZ3A 1Z6TA 2IF4A 4IYPA 3J5PA 4V3IA 3B13A 4NIKA 3CK7A 5JJTA 3ASDA 3LDZA 3AG3E 4BEPA 3FULA 3B95A 1TNUA 2P58C 3QDNA 5FWQA 1DVPA 3SF4A 2J07A 4CT4A 1OT8A 1AP7A 2LAIA 3OXGA 1N4PA 3BG1B 2ZGGA 2XENA 4ABNA 3NQPA 4OVVA 4JA7A 2GRRB 1E8YA 4GZ6A 1UN8A 3B7SA 4MBGA 5BPPA 3ZU7B 4AVXA 4N2SA 3MZLB 3EUVA 3TJPA 4APOA 2XEHA 4N39A 3VTYA 3L54A 5IY5E 5J08A 3E4BA 3SQVA 4K5BA 3ZXSA 4L1BA 3PZDA 4A55A 3FTXA 3UT4A 3D9JA 5CRVA 4CCAA 3X2QE 4MS6A 4GZ5A 5CCMA 4WAFA 4DX2A 4BFRA 2HYZA 2P9PG 2OEVA 4HRMB 2V4LA 3JUEA 2XPYA 5BV1A 1D8EA 5G04C 1INZA 4ILGA 3ISMC 3D9NA 1KT1A 2DCPA 5BXUA 2FO7A 4AP2A 4A3VA 1KT0A 4BSXA 1KZOA 1GW6A 3CV0A 3Q4AB 2P2CP 3QWPA 3CHRA 4GYOA 4WNDA 2J4BA 4U8YD 1KZPA 3PUJA 2BEDA 4I1AA 4HORA 4HI8A 2WQ6A 3TGOA 4IULA 4G25A 3SFYA 1QYMA 2OOEA 5E76A 2CHXA 5FIOA 2X6JA 2V4HC 4BERA 4LNUD 1DCQA 4M3OA 1UJJA 4EZKA 2CFZA 3FUNA 3K9IA 4O1PA 5KBAA 5ENRD 4JEUA 2LUHA 4JL0A 2ONDA 2XEVA 3F6QA 3DXKG 3VTXA 2Y69E 1JWGA 4I17A 4PS3A 2PL2A 2WVIA 1FPPA 1TJCA 3CQCB 1E90A 1HH8A 4O6FA 1OXJA 3J5QB 5FJYA 3ENEA 4YVOA 5KCMA 2UY1B 3L08A 3MGBA 1E7UA 3TWQA 4HOUA 3BU8A 2YINA 3ML9A 1TNZA 4LSZE 3RKVA 2LXLA 5KJKA 1HS6A 3NZUA 4GZDA 4FJYA 4U0SA 1WDYA 3UX4A 3PVLA 1IHBA 2WM9A 2MOWA 5JHAA 3FUFA 4QQIA 3RU0A 2GRLA 4GTRA 2A5UA 4GTVA 2WXGA 3D9MA 2Y3AA 3IXEA 2DBAA 3KSQA 4IRUA 4J0UA 2Q7FA 2BKGA 3LXUX 1PY1A 2KM4A 4KVMA 4XE0A 4ILIA 3MX3A 1E8WA 3OTNA 1HX8A 5HQ8A 3C72A 2ZGDA 4RSYA 3DSTA 4HOQA 1MX6A 2AXVA 3SFXA 3FHEA 4FULA 2Y0BG 2J49A 3CHQA 2XRYA 2I6HA 3RIBA 1VDYA 3IBEA 4TV3A 3LEWA 4EZLA 1Z3XA 4FHJA 2F8YA 5BV0A 3KEAA 3ZYKA 1OWOA 5JJ7A 3FFLA 1DC2A 1SZAA 2KC7A 4FP7A 3B7TA 1TNBA 4GPKA 3GYZA 4TRQA 4WWPA 4FJZA 1HXIA 2WB2A 3TXMA 3AS5A 4DLOA 3L9TA 4Q69A 5EYLA 4UQXA 4U96D 4U95D 3Q79A 2YHEA 1Y8MA 4YDOA 4AJWA 3GZ2A 1OCOE 4LNGA 3ZHEA 4TXQA 1JUQA 3CHMA 2I2OA 4R7LA 3TL5A 2P9LG 3I5PA 2WXKA 3U4TA 1O1RA 4JEHA 4B8AA 2IO2C 4N5CA 3TWUA 3T8MA 5LP0A 1XGWA 2QZAA 3I4GA 4FU3A 5LFAA 1WAO1 3WG7E 4E6HA 4C48B 3Q7AA 4EQFA 2AXUA 1NI1A 3SZ7A 3GZSA 2Y4TA 3ZN3A 3UM1A 2Y4UA 3QKYA 3LS8A 5EDSA 3B7UX 3D9KA 3MV3B 4F1PA 4KZ0A 4GB9A 5LOZA 1H2TC 3PZ2A 2IFUA 3RRNB 1IXVA 2X6HA 2XPIA 4I6EA 4HOSA 3JXIA 3CVUA 3ZIMA 5B1BE 3CVWA 1HG5A 4ANVA 4TXPA 1MQSA 3L17A 4K5AB 3MCXA 4TUUA 4XIFA 2KZTB 3GW4A 4NRHB 3ZNGA 3S7FA 3SNXA 2VYIA 1QNFA 4F7AA 1TN7A 4A3TA 3UKUG 3ZVVA 1MX4A 1JWFA 1YCSB 3R7QA 4FC8A 5DBKA 2FEZA 2XGOA 4E85A 2PQRA 3Q47B 1RW2A 2V0PA 4GMJA 1WY6A 1XNFA 2WQ7A 3PREA 4U0ZA 2NXPA 4JHKA 3AS4A 1G3NB 1N4SA 3HYMB 3SBSA 2GGFA 2IONA 4LERA 1HE8A 3KEZA 3E33A 2AVPA 5AYWD 1OWMA 2WMNA 4ATGA 2NYJA 4LUNU 3FTSA 3TWWA 5BW8C 1SZ9A 2IOLA 2F8XK 4HLLA 4BX9A 1MZCA 3DSSA 1EPUA 3ZGQA 3DSUA 3TAXA 4EBAG 3TG4A 4JW1A 5JJ6A 4DI4A 2J09A 3PDNA 3G2SA 1A17A 3KS2A 4FA6A 3EHQA 2XRZA 2EIKE 3T8KA 4C9BB 1D8DA 2WPVA 2DIWA 3G2WA 5EILA 4OYSA 4JHRA 5FZSA 2R05A 3QB2A 5EIDA 2EINE 2VGXB 3L13A 1NP7A 2GRPB 4YDWA 4BETA 4YDEA 3TWTA 2J08A 2UWJG 4DX7D 4G1TA 4DX1A 2FO1E 2AW6A 1DCEA 1K8KG 4B0ZA 5ENTD 4ZFHA 4GTTA 2VTBB 1P5QA 3CQGB 3HVEA 4LCTA 2DYSE 2YNQA 2IU1A 4HQDA 4JB8P 2R02A 3DEPA 2PM7A 3CHSA 3Q9UC 3UM2A 3HXCA 2H6IA 5FZRA 3L22A 3ESLA 4GYYA 3ZEFA 3FY4A 3ULQA 2RKKA 4DRXE 2MHKA 1E8XA 3MEKA 2V5FA 3U3WA 3ASNE 5AN8A 2WMOA 3C3RA 3E30A 1JCSA 5AARA 5JMND 2WXPA 4BWRA 3APCA 3T5XA 4RQIA 4G8KA 5KNGA 5CMYA 1H2VC 5CEAA 1OCCE 4KBQA 3URZA 4HVBA 3WXXA 3NB2A 4CYMD 3FU3A 3C3QA 2E0IA 1EDUA 3UT7A 4NACA 2KXPC 4J6IA 4G26A 2HR2A 4I6JA 2X38A 3DSWA 1QBQA 3Q5MA 2B6CA 2ETBA 4Z68A 3PS6A 4GA0A 3Q78A 4OAVB 4N3BA 5CHEE 3UUXA 3QC1A 3DXMG 4I1OB 4WUYA 5FZQA 1N0RA 3LYAA 3RRMB 1ELKA 3FTWA 4UWKA 1BD8A 3T9KA 4N3AA 3I4RB 4G23A 3MA5A 4Y6WA 3IHYA 1L5JA 1N94A 3PE4A 4U63A 4B94A 5FQ4A 4JA9A 2WQHA 2JEKA 3MKQA 3ZYQA 5LX8A 2XZDG 3D9HA 4JZYA 2R2LA 1S64A 1S0PA 4ACKA 1OWNA 3DPYA 3HHMA 3FUIA 4MKTA 1U2VG 4GTSA 3CVPA 1TNOA 2XCCA 3UIOC 1TNYA 4UWFA 3MKRA 3Q49B 4W9RA 3RJVA 3ULYA 4ANWA 2L0IA 3IV0A 3QARA 3UI2A 4C0EA 4GA2A 4C0MA 4PH4B 1BLXB 2KBXA 4H7YA 4I43A 5BXOA 3FUEA 1B89A 1HU3A 3OXFA 3MV2B 4BX8A 5H7PA 3CVYA 4HI9A 5D0OD 1N95A 3ABKE 4WWNA 4BY6A 5AIJA 3CVVA 4JVSA 3T5VA 2H6HA 4XEIG 4L23A 2P9IG 1SA5A 5AQ7A 3UTMA 3CGHA 2F37A 2A4ZA 2PZIA 3D9PA 3JUIA 4DJAA 3HXBA 1IQUA 1IQRA 5G55A 3SD5A 4GAAA 5ENSD 4EHMA 5AENA 4L2YA 4DPRA 2VSNA 1Y6IA 4ME2A 5CCLA 3PZ1A 3U66A 2LAHA 5HRYA 1H19A 3HG0D 3HXDA 3EHRA 2LNIA 4L9PA 2L9BA 4A1GA 5A23A 1QZ2A 2BUGA 2EIME 1MX2A 3ZYMA 2L0TB 3FTZA 2X6KA 2F0YA 4UQYA 1NFIE 4B89A 4NURA 1MYOA 3FTYA 5CBOA 2WXLA 4CGWA 2IEJA 2QFCA 3GZ1A 3JXJA 3C5RA 3DPDA 1E7VA 2XS8A 3ONKA 4GTOA 5DIZA 2OVBA 3CVQA 5EN5D 3U64A 3DSXA 4CDMA 3IEGA 4RG9A 4U07A 1TJFA 3FUHA 4JC8A 2YQ8A 1H6PA 2P9NG 1EF1C 1UW4B 3RO2A 3N71A 3ZFWA 3CHPA 4IN3B 2XQ0A 3UKRG 3PE3A 1EYHA 4FLBA 4J7WA 3TXNA 3LY9A 4DK5A 2QY7A 3AS8A 3SY2A 2JLBA 4CRWA 3IKOB 4EECA 4AXHA 1N4QA 4BT9A 2L6JA 2VSXE 1ZBPA 3PRZA 3PUKA 3JQ1A 1H0AA 3AAAC 4I6GA 3LY8A 4HXIA 3B7RL 5BNWA 4GTQA 3S2AA 1H6KA
chains in the Genus database with same CATH topology
1JCQA 1FT1A 4L9PA 1S63A 1N9AA 1FPPA 3E30A 1JCSA 3PZ3A 3PZ2A 2R2LA 1S64A 3E37A 1MZCA 3DRAA 3DSSA 3E34A 2F0YA 1O5MA 1TNBA 3DSUA 1D8EA 1NL4A 3DPYA 2IEJA 4LNBA 3Q75A 4GTSA 1TNOA 1TNUA 1LTXA 1TNZA 1TNYA 1KZOA 4GTOA 1D8DA 1FT2A 3HXEA 3Q79A 3DSVA 3Q73A 3DSXA 4YDOA 1O1TA 4LNGA 1N4PA 4YDEA 1TN7A 4GTMA 1N4RA 3DSWA 1QBQA 1KZPA 2BEDA 1N95A 1O1RA 4MBGA 1LD7A 3Q78A 4GTRA 4GTVA 2H6HA 1JCRA 3SFYA 3E32A 1DCEA 3EUVA 1TN8A 4GTTA 1SA4A 1SA5A 2H6FA 2ZISA 2H6GA 3Q7FA 1O1SA 3KSQA 3PZ4A 3HXBA 4GTPA 4EHMA 1N4SA 3Q7AA 3HXCA 3HXFA 3C72A 2H6IA 1LD8A 1NI1A 3DSTA 1N4QA 3EU5A 3KSLA 3PZ1A 3SFXA 4GTQA 2ZIRA 3E33A 1TN6A 1N94A 3HXDA 1X81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCQ A;  1FT1 A;  4L9P A;  1S63 A;  1N9A A;  1FPP A;  3E30 A;  1JCS A;  3PZ3 A;  3PZ2 A;  2R2L A;  1S64 A;  3E37 A;  1MZC A;  3DRA A;  3DSS A;  3E34 A;  2F0Y A;  1O5M A;  1TNB A;  3DSU A;  1D8E A;  1NL4 A;  3DPY A;  2IEJ A;  4LNB A;  3Q75 A;  4GTS A;  1TNO A;  1TNU A;  1LTX A;  1TNZ A;  1TNY A;  1KZO A;  4GTO A;  1D8D A;  1FT2 A;  3HXE A;  3Q79 A;  3DSV A;  3Q73 A;  3DSX A;  4YDO A;  1O1T A;  4LNG A;  1N4P A;  4YDE A;  1TN7 A;  4GTM A;  1N4R A;  3DSW A;  1QBQ A;  1KZP A;  2BED A;  1N95 A;  1O1R A;  4MBG A;  1LD7 A;  3Q78 A;  4GTR A;  4GTV A;  2H6H A;  1JCR A;  3SFY A;  3E32 A;  1DCE A;  3EUV A;  1TN8 A;  4GTT A;  1SA4 A;  1SA5 A;  2H6F A;  2ZIS A;  2H6G A;  3Q7F A;  1O1S A;  3KSQ A;  3PZ4 A;  3HXB A;  4GTP A;  4EHM A;  1N4S A;  3Q7A A;  3HXC A;  3HXF A;  3C72 A;  2H6I A;  1LD8 A;  1NI1 A;  3DST A;  1N4Q A;  3EU5 A;  3KSL A;  3PZ1 A;  3SFX A;  4GTQ A;  2ZIR A;  3E33 A;  1TN6 A;  1N94 A;  3HXD A;  1X81 A; 
#chains in the Genus database with same CATH topology
 1JCQ A;  3UM3 A;  5AJL A;  2PNN A;  1H2U A;  4AOF A;  1O5M A;  3HRA A;  5KJL A;  4GYW A;  4HRL A;  1IKN D;  4UWH A;  1E96 B;  2IO3 C;  1UN9 A;  5BT1 A;  2IY0 C;  2ZU6 B;  5D66 A;  5CED B;  5EX3 A;  3FEX A;  2NC9 A;  4TUM A;  5KNH D;  3V30 A;  4J8Y A;  5T8I A;  4EBA A;  4K0R A;  1FCH A;  3EHM A;  3FU6 A;  3FDH A;  4PUC A;  3ZW3 A;  1N4R A;  2VSO E;  5FQ7 A;  3G2V A;  3W9G A;  3ESK A;  4J8D A;  3RSE G;  4I9E A;  1ZB1 A;  1TN8 A;  5ARG A;  4DUI A;  3Q9N C;  3Q7F A;  2DYR E;  1SW6 A;  4YND A;  2KCL A;  1K3Z D;  1HFA A;  2LXM A;  2XGM A;  3PZ4 A;  3FWV A;  3G2T A;  2QC9 A;  2I9C A;  2UY1 A;  3EDT B;  3RAU A;  4UI9 J;  2EIL E;  4O1O A;  4XX5 A;  5EKQ D;  3BG0 B;  1TN6 A;  3FUK A;  3U9W A;  2I1J A;  3VLE A;  4QFV A;  3UPV A;  1SVX A;  3LVQ E;  5FTP A;  4CEM A;  5ENQ D;  3DRA A;  5G04 J;  2R03 A;  2RD0 A;  2CFU A;  3CVN A;  4TXR A;  1YYH A;  4OVU A;  3SBT B;  3ZXP A;  1N54 A;  1OUV A;  3KAE A;  4G11 A;  1FT2 A;  1OCZ E;  5EIB E;  3O48 A;  3UXG A;  2KCK A;  5BUZ A;  3SFZ A;  3ASF A;  3AU5 A;  2WXF A;  2BKK B;  5T3R A;  5KJM A;  5A6C A;  2X3M A;  2PQN A;  1S70 B;  4H7X A;  3O4Z A;  2GRQ B;  3CIA A;  5KWD A;  3RK6 A;  1JCR A;  1D9S A;  4BSZ B;  4APF A;  4GA1 A;  4PS7 A;  5JHB A;  1O1S A;  1WG0 A;  2ZXW E;  3NAW A;  3JYS A;  5AQ9 A;  4JPS A;  3V2X A;  4XI9 A;  2FUL A;  4CT0 A;  2GRO B;  4GZC A;  1OY3 D;  3V31 A;  4DX5 D;  3EU5 A;  3KSL A;  3FUJ A;  3ZUV B;  2R59 A;  1UG3 A;  3HDX A;  4F6R D;  4AV7 A;  3CKB A;  4NQ0 A;  1U3D A;  3RRU A;  3CK8 A;  2WXJ A;  3AG4 E;  3APD A;  2CHZ A;  2B0O E;  3EHN A;  3LJ3 A;  5KJN A;  4ATZ D;  3ZRH A;  4GCO A;  2NSZ A;  4N5Q A;  5J90 A;  4LNB A;  3AG1 E;  5ITZ F;  3BUA A;  4KMO A;  1KPS B;  2WXI A;  1K1A A;  3L6A A;  2HO1 A;  2XHE A;  2XGS A;  4K5C A;  4LEU A;  4I2W A;  3UQ3 A;  3TWV A;  3DSV A;  4Q96 A;  3SI5 A;  4AM9 A;  4XI0 A;  1NZN A;  3TWS A;  5ANL A;  1UOH A;  2RFM A;  3ZKJ A;  4CDN A;  4XKC A;  3FH8 A;  4U0U A;  2OCC E;  4UI9 C;  3D9O A;  1SA4 A;  2WXO A;  3FH5 A;  5HS0 A;  3TG5 A;  2DWZ A;  1YMP A;  3FU0 A;  5B1A E;  3D9L A;  3CVX A;  4BTA A;  4FLH A;  5G2N A;  4BES A;  2KCV A;  1TYQ G;  4FAD A;  5JA4 D;  2P9K G;  3ZHE B;  1OWL A;  4ANX A;  3HXF A;  1LD8 A;  1BU9 A;  5C1D A;  4I9C A;  3CVL A;  2FI7 A;  2J8S D;  2RFA A;  4LRZ A;  4UWL A;  2ZIR A;  2KZT A;  4RVB A;  3APF A;  5A7D B;  5EX0 A;  1FT1 A;  4AEZ C;  3ZYL A;  4AIF A;  4DLQ A;  3D9I A;  4GCN A;  2X6F A;  1IYG A;  3UM0 A;  4ACL A;  3E37 A;  1ELR A;  2C0L A;  1FVH A;  1X5B A;  3CK9 A;  4KXK B;  1H6O A;  5E75 A;  3V2O A;  5AAO A;  3NOG D;  4GPM A;  1LTX A;  2IQC A;  4FHK A;  4WNF A;  3DWL G;  1Z5S C;  2MRI A;  4HS2 A;  2VJ8 A;  2ETC A;  2MYO A;  4DX6 D;  4GTM A;  4CGV A;  1BPO A;  1HZ4 A;  3OAW A;  4GML A;  4XZ4 A;  2XCB A;  2XZT G;  3E32 A;  4HFG A;  5FT9 A;  2J9Q A;  2PM6 A;  2M63 A;  2DZN A;  2WXN A;  3P2B A;  2CHW A;  1W3B A;  2X6I A;  3TWR A;  2EIJ E;  3LKU A;  3S7J A;  4N3C A;  2WXH A;  5ANR A;  4DI3 A;  2ILR A;  5AJD A;  3R7R A;  3KD7 A;  2DVW A;  1OCR E;  5G05 J;  3AU4 A;  3TWX A;  3NOC D;  4G24 A;  3G2U A;  1X81 A;  3W9F A;  2IOS A;  1S63 A;  3ONL A;  2VGX A;  4G2V A;  4MRU A;  2VGE A;  2QYJ A;  1IHG A;  5FQ8 A;  4G8L A;  1PAQ A;  2AJA A;  4KT6 B;  1V55 E;  3PEU B;  1KLX A;  3FP3 A;  3Q75 A;  2A5E A;  1YA0 A;  3LPZ A;  4RG6 A;  2VTB A;  3QAQ A;  4KZC A;  2CG2 A;  2VQ2 A;  1HF8 A;  3DEO A;  5FQ6 A;  4AY5 A;  1N0Q A;  4EZJ A;  2DZO A;  2QYU A;  5C2Y A;  3UIN C;  5AQA A;  1FVF A;  4OAU C;  2KAT A;  5ENO D;  4U04 A;  1O1T A;  3PEV B;  2E2E A;  4UI9 K;  1JPL A;  5FIN A;  3V79 K;  1LD7 A;  2I1K A;  4N2Q A;  1DNP A;  1QQE A;  2VSY A;  4Y6C A;  3EJN A;  4F53 A;  3BEE A;  2EQX A;  3FTU A;  2H6F A;  4CDR A;  4M7C A;  2ZIS A;  2H6G A;  2WXQ A;  1TR4 A;  2FF4 A;  3ZPJ A;  1Z3Y A;  3DBS A;  4GZ3 A;  4O60 A;  1V54 E;  4EPZ A;  4GTP A;  5B3S E;  5ARF A;  3CR3 A;  4PDX A;  1MJ0 A;  1E8Z A;  4WNG A;  5ENN A;  4RLY A;  1HG2 A;  4CZ2 D;  4U7E B;  3CLJ A;  3EU9 A;  3L82 A;  3LVR E;  3B7B A;  3SGH A;  1BI7 B;  2XPZ A;  3IHV A;  3UT8 A;  3QK0 A;  3AG2 E;  4HLE A;  3CEQ A;  4JXT A;  3HVE B;  2YHC A;  5D0Q D;  1UJK A;  2R5S A;  3MYV A;  3ULE G;  2LSV A;  3RO3 A;  4I2Z A;  1SQM A;  4GMR A;  5CEC B;  5LCW J;  4YVQ C;  2XEE A;  4J8S A;  4AY6 A;  5AQB A;  3MJW A;  4JHJ A;  4L7T A;  1N52 A;  2C0M A;  4GU5 A;  3HIZ A;  1Q2Z A;  2R17 C;  4BT8 A;  4D10 C;  3AJI A;  5CBN A;  2LSU A;  1BI8 B;  3S7B A;  4J8F A;  4X8Q A;  5CER B;  3FUD A;  3QNK A;  4B8C B;  2OV8 A;  3LCA A;  4I1M A;  4PS8 A;  1WM5 A;  3VLF A;  2CG3 A;  1ZU2 A;  3ML8 A;  4UQZ A;  4LG6 A;  5T4Y A;  1ELW A;  2OEW A;  4WWO A;  3C3O A;  2LO6 A;  4HBD A;  5G05 C;  3FUM A;  4HNA D;  2P9U G;  1U3C A;  3EIQ C;  2WXM A;  2RG8 A;  4ZHB A;  3PNL B;  1NA3 A;  1NA0 A;  3S7D A;  3ASH A;  1RZ4 A;  3QWV A;  4JD2 G;  3NBN B;  1AWC B;  3FH7 A;  3PNT B;  3FEY A;  3ABL E;  2OVF A;  3P1U A;  4XKB A;  4B93 B;  4WNE A;  3UIP C;  2JAB A;  5CMW A;  1OWP A;  2HE0 A;  1MHQ A;  3CSF A;  4HOT A;  3PH0 C;  5EYP F;  5HKP A;  4Q94 A;  3E34 A;  4URK A;  3QOU A;  1HO8 A;  1NL4 A;  3QJZ A;  2IJG X;  4KVO A;  5HI7 A;  2AXZ A;  1A5E A;  5CRU A;  3I3N A;  3ABM E;  3ASG A;  4ANU A;  3BQO A;  4A1S A;  2WXR A;  3FU5 A;  4F3V A;  3C98 A;  3SHF A;  2Y1L E;  3NF1 A;  2V5Q C;  4KYO B;  3HXE A;  3MKQ B;  1N11 A;  3Q73 A;  4YDY A;  3D3M A;  5M72 A;  4U8V D;  3CKC A;  3R9M A;  3ASO E;  2J4D A;  3R9A B;  4BTB A;  2C2L A;  4ILH B;  3LJN A;  3LY7 A;  2GW1 A;  2GRN B;  2BF0 X;  2VGY A;  3UMV A;  4MLP A;  2L6B A;  5ENP D;  1PC2 A;  4A63 B;  2HM8 A;  2XS1 A;  2ETA A;  4K03 A;  5D2M C;  3VLD A;  2GRM A;  3FTV A;  2FBN A;  2AWI A;  1LF8 A;  3OXL A;  4U8H A;  4L2L A;  3L16 A;  3NZS A;  1TEZ A;  4J8E A;  3JCK C;  2BTD A;  3CST A;  4F1S A;  1K1B A;  4HRN A;  3Q15 A;  2V8S E;  3CHO A;  4UWG A;  3JQ0 A;  2P9S G;  3QWW A;  4HB5 A;  3SO8 A;  3EIJ A;  5LCW C;  4P29 A;  4UUC A;  1N9A A;  3PZ3 A;  1Z6T A;  2IF4 A;  4IYP A;  3J5P A;  4V3I A;  3B13 A;  4NIK A;  3CK7 A;  5JJT A;  3ASD A;  3LDZ A;  3AG3 E;  4BEP A;  3FUL A;  3B95 A;  1TNU A;  2P58 C;  3QDN A;  5FWQ A;  1DVP A;  3SF4 A;  2J07 A;  4CT4 A;  1OT8 A;  1AP7 A;  2LAI A;  3OXG A;  1N4P A;  3BG1 B;  2ZGG A;  2XEN A;  4ABN A;  3NQP A;  4OVV A;  4JA7 A;  2GRR B;  1E8Y A;  4GZ6 A;  1UN8 A;  3B7S A;  4MBG A;  5BPP A;  3ZU7 B;  4AVX A;  4N2S A;  3MZL B;  3EUV A;  3TJP A;  4APO A;  2XEH A;  4N39 A;  3VTY A;  3L54 A;  5IY5 E;  5J08 A;  3E4B A;  3SQV A;  4K5B A;  3ZXS A;  4L1B A;  3PZD A;  4A55 A;  3FTX A;  3UT4 A;  3D9J A;  5CRV A;  4CCA A;  3X2Q E;  4MS6 A;  4GZ5 A;  5CCM A;  4WAF A;  4DX2 A;  4BFR A;  2HYZ A;  2P9P G;  2OEV A;  4HRM B;  2V4L A;  3JUE A;  2XPY A;  5BV1 A;  1D8E A;  5G04 C;  1INZ A;  4ILG A;  3ISM C;  3D9N A;  1KT1 A;  2DCP A;  5BXU A;  2FO7 A;  4AP2 A;  4A3V A;  1KT0 A;  4BSX A;  1KZO A;  1GW6 A;  3CV0 A;  3Q4A B;  2P2C P;  3QWP A;  3CHR A;  4GYO A;  4WND A;  2J4B A;  4U8Y D;  1KZP A;  3PUJ A;  2BED A;  4I1A A;  4HOR A;  4HI8 A;  2WQ6 A;  3TGO A;  4IUL A;  4G25 A;  3SFY A;  1QYM A;  2OOE A;  5E76 A;  2CHX A;  5FIO A;  2X6J A;  2V4H C;  4BER A;  4LNU D;  1DCQ A;  4M3O A;  1UJJ A;  4EZK A;  2CFZ A;  3FUN A;  3K9I A;  4O1P A;  5KBA A;  5ENR D;  4JEU A;  2LUH A;  4JL0 A;  2OND A;  2XEV A;  3F6Q A;  3DXK G;  3VTX A;  2Y69 E;  1JWG A;  4I17 A;  4PS3 A;  2PL2 A;  2WVI A;  1FPP A;  1TJC A;  3CQC B;  1E90 A;  1HH8 A;  4O6F A;  1OXJ A;  3J5Q B;  5FJY A;  3ENE A;  4YVO A;  5KCM A;  2UY1 B;  3L08 A;  3MGB A;  1E7U A;  3TWQ A;  4HOU A;  3BU8 A;  2YIN A;  3ML9 A;  1TNZ A;  4LSZ E;  3RKV A;  2LXL A;  5KJK A;  1HS6 A;  3NZU A;  4GZD A;  4FJY A;  4U0S A;  1WDY A;  3UX4 A;  3PVL A;  1IHB A;  2WM9 A;  2MOW A;  5JHA A;  3FUF A;  4QQI A;  3RU0 A;  2GRL A;  4GTR A;  2A5U A;  4GTV A;  2WXG A;  3D9M A;  2Y3A A;  3IXE A;  2DBA A;  3KSQ A;  4IRU A;  4J0U A;  2Q7F A;  2BKG A;  3LXU X;  1PY1 A;  2KM4 A;  4KVM A;  4XE0 A;  4ILI A;  3MX3 A;  1E8W A;  3OTN A;  1HX8 A;  5HQ8 A;  3C72 A;  2ZGD A;  4RSY A;  3DST A;  4HOQ A;  1MX6 A;  2AXV A;  3SFX A;  3FHE A;  4FUL A;  2Y0B G;  2J49 A;  3CHQ A;  2XRY A;  2I6H A;  3RIB A;  1VDY A;  3IBE A;  4TV3 A;  3LEW A;  4EZL A;  1Z3X A;  4FHJ A;  2F8Y A;  5BV0 A;  3KEA A;  3ZYK A;  1OWO A;  5JJ7 A;  3FFL A;  1DC2 A;  1SZA A;  2KC7 A;  4FP7 A;  3B7T A;  1TNB A;  4GPK A;  3GYZ A;  4TRQ A;  4WWP A;  4FJZ A;  1HXI A;  2WB2 A;  3TXM A;  3AS5 A;  4DLO A;  3L9T A;  4Q69 A;  5EYL A;  4UQX A;  4U96 D;  4U95 D;  3Q79 A;  2YHE A;  1Y8M A;  4YDO A;  4AJW A;  3GZ2 A;  1OCO E;  4LNG A;  3ZHE A;  4TXQ A;  1JUQ A;  3CHM A;  2I2O A;  4R7L A;  3TL5 A;  2P9L G;  3I5P A;  2WXK A;  3U4T A;  1O1R A;  4JEH A;  4B8A A;  2IO2 C;  4N5C A;  3TWU A;  3T8M A;  5LP0 A;  1XGW A;  2QZA A;  3I4G A;  4FU3 A;  5LFA A;  1WAO 1;  3WG7 E;  4E6H A;  4C48 B;  3Q7A A;  4EQF A;  2AXU A;  1NI1 A;  3SZ7 A;  3GZS A;  2Y4T A;  3ZN3 A;  3UM1 A;  2Y4U A;  3QKY A;  3LS8 A;  5EDS A;  3B7U X;  3D9K A;  3MV3 B;  4F1P A;  4KZ0 A;  4GB9 A;  5LOZ A;  1H2T C;  3PZ2 A;  2IFU A;  3RRN B;  1IXV A;  2X6H A;  2XPI A;  4I6E A;  4HOS A;  3JXI A;  3CVU A;  3ZIM A;  5B1B E;  3CVW A;  1HG5 A;  4ANV A;  4TXP A;  1MQS A;  3L17 A;  4K5A B;  3MCX A;  4TUU A;  4XIF A;  2KZT B;  3GW4 A;  4NRH B;  3ZNG A;  3S7F A;  3SNX A;  2VYI A;  1QNF A;  4F7A A;  1TN7 A;  4A3T A;  3UKU G;  3ZVV A;  1MX4 A;  1JWF A;  1YCS B;  3R7Q A;  4FC8 A;  5DBK A;  2FEZ A;  2XGO A;  4E85 A;  2PQR A;  3Q47 B;  1RW2 A;  2V0P A;  4GMJ A;  1WY6 A;  1XNF A;  2WQ7 A;  3PRE A;  4U0Z A;  2NXP A;  4JHK A;  3AS4 A;  1G3N B;  1N4S A;  3HYM B;  3SBS A;  2GGF A;  2ION A;  4LER A;  1HE8 A;  3KEZ A;  3E33 A;  2AVP A;  5AYW D;  1OWM A;  2WMN A;  4ATG A;  2NYJ A;  4LUN U;  3FTS A;  3TWW A;  5BW8 C;  1SZ9 A;  2IOL A;  2F8X K;  4HLL A;  4BX9 A;  1MZC A;  3DSS A;  1EPU A;  3ZGQ A;  3DSU A;  3TAX A;  4EBA G;  3TG4 A;  4JW1 A;  5JJ6 A;  4DI4 A;  2J09 A;  3PDN A;  3G2S A;  1A17 A;  3KS2 A;  4FA6 A;  3EHQ A;  2XRZ A;  2EIK E;  3T8K A;  4C9B B;  1D8D A;  2WPV A;  2DIW A;  3G2W A;  5EIL A;  4OYS A;  4JHR A;  5FZS A;  2R05 A;  3QB2 A;  5EID A;  2EIN E;  2VGX B;  3L13 A;  1NP7 A;  2GRP B;  4YDW A;  4BET A;  4YDE A;  3TWT A;  2J08 A;  2UWJ G;  4DX7 D;  4G1T A;  4DX1 A;  2FO1 E;  2AW6 A;  1DCE A;  1K8K G;  4B0Z A;  5ENT D;  4ZFH A;  4GTT A;  2VTB B;  1P5Q A;  3CQG B;  3HVE A;  4LCT A;  2DYS E;  2YNQ A;  2IU1 A;  4HQD A;  4JB8 P;  2R02 A;  3DEP A;  2PM7 A;  3CHS A;  3Q9U C;  3UM2 A;  3HXC A;  2H6I A;  5FZR A;  3L22 A;  3ESL A;  4GYY A;  3ZEF A;  3FY4 A;  3ULQ A;  2RKK A;  4DRX E;  2MHK A;  1E8X A;  3MEK A;  2V5F A;  3U3W A;  3ASN E;  5AN8 A;  2WMO A;  3C3R A;  3E30 A;  1JCS A;  5AAR A;  5JMN D;  2WXP A;  4BWR A;  3APC A;  3T5X A;  4RQI A;  4G8K A;  5KNG A;  5CMY A;  1H2V C;  5CEA A;  1OCC E;  4KBQ A;  3URZ A;  4HVB A;  3WXX A;  3NB2 A;  4CYM D;  3FU3 A;  3C3Q A;  2E0I A;  1EDU A;  3UT7 A;  4NAC A;  2KXP C;  4J6I A;  4G26 A;  2HR2 A;  4I6J A;  2X38 A;  3DSW A;  1QBQ A;  3Q5M A;  2B6C A;  2ETB A;  4Z68 A;  3PS6 A;  4GA0 A;  3Q78 A;  4OAV B;  4N3B A;  5CHE E;  3UUX A;  3QC1 A;  3DXM G;  4I1O B;  4WUY A;  5FZQ A;  1N0R A;  3LYA A;  3RRM B;  1ELK A;  3FTW A;  4UWK A;  1BD8 A;  3T9K A;  4N3A A;  3I4R B;  4G23 A;  3MA5 A;  4Y6W A;  3IHY A;  1L5J A;  1N94 A;  3PE4 A;  4U63 A;  4B94 A;  5FQ4 A;  4JA9 A;  2WQH A;  2JEK A;  3MKQ A;  3ZYQ A;  5LX8 A;  2XZD G;  3D9H A;  4JZY A;  2R2L A;  1S64 A;  1S0P A;  4ACK A;  1OWN A;  3DPY A;  3HHM A;  3FUI A;  4MKT A;  1U2V G;  4GTS A;  3CVP A;  1TNO A;  2XCC A;  3UIO C;  1TNY A;  4UWF A;  3MKR A;  3Q49 B;  4W9R A;  3RJV A;  3ULY A;  4ANW A;  2L0I A;  3IV0 A;  3QAR A;  3UI2 A;  4C0E A;  4GA2 A;  4C0M A;  4PH4 B;  1BLX B;  2KBX A;  4H7Y A;  4I43 A;  5BXO A;  3FUE A;  1B89 A;  1HU3 A;  3OXF A;  3MV2 B;  4BX8 A;  5H7P A;  3CVY A;  4HI9 A;  5D0O D;  1N95 A;  3ABK E;  4WWN A;  4BY6 A;  5AIJ A;  3CVV A;  4JVS A;  3T5V A;  2H6H A;  4XEI G;  4L23 A;  2P9I G;  1SA5 A;  5AQ7 A;  3UTM A;  3CGH A;  2F37 A;  2A4Z A;  2PZI A;  3D9P A;  3JUI A;  4DJA A;  3HXB A;  1IQU A;  1IQR A;  5G55 A;  3SD5 A;  4GAA A;  5ENS D;  4EHM A;  5AEN A;  4L2Y A;  4DPR A;  2VSN A;  1Y6I A;  4ME2 A;  5CCL A;  3PZ1 A;  3U66 A;  2LAH A;  5HRY A;  1H19 A;  3HG0 D;  3HXD A;  3EHR A;  2LNI A;  4L9P A;  2L9B A;  4A1G A;  5A23 A;  1QZ2 A;  2BUG A;  2EIM E;  1MX2 A;  3ZYM A;  2L0T B;  3FTZ A;  2X6K A;  2F0Y A;  4UQY A;  1NFI E;  4B89 A;  4NUR A;  1MYO A;  3FTY A;  5CBO A;  2WXL A;  4CGW A;  2IEJ A;  2QFC A;  3GZ1 A;  3JXJ A;  3C5R A;  3DPD A;  1E7V A;  2XS8 A;  3ONK A;  4GTO A;  5DIZ A;  2OVB A;  3CVQ A;  5EN5 D;  3U64 A;  3DSX A;  4CDM A;  3IEG A;  4RG9 A;  4U07 A;  1TJF A;  3FUH A;  4JC8 A;  2YQ8 A;  1H6P A;  2P9N G;  1EF1 C;  1UW4 B;  3RO2 A;  3N71 A;  3ZFW A;  3CHP A;  4IN3 B;  2XQ0 A;  3UKR G;  3PE3 A;  1EYH A;  4FLB A;  4J7W A;  3TXN A;  3LY9 A;  4DK5 A;  2QY7 A;  3AS8 A;  3SY2 A;  2JLB A;  4CRW A;  3IKO B;  4EEC A;  4AXH A;  1N4Q A;  4BT9 A;  2L6J A;  2VSX E;  1ZBP A;  3PRZ A;  3PUK A;  3JQ1 A;  1H0A A;  3AAA C;  4I6G A;  3LY8 A;  4HXI A;  3B7R L;  5BNW A;  4GTQ A;  3S2A A;  1H6K A; 
#chains in the Genus database with same CATH homology
 1JCQ A;  1FT1 A;  4L9P A;  1S63 A;  1N9A A;  1FPP A;  3E30 A;  1JCS A;  3PZ3 A;  3PZ2 A;  2R2L A;  1S64 A;  3E37 A;  1MZC A;  3DRA A;  3DSS A;  3E34 A;  2F0Y A;  1O5M A;  1TNB A;  3DSU A;  1D8E A;  1NL4 A;  3DPY A;  2IEJ A;  4LNB A;  3Q75 A;  4GTS A;  1TNO A;  1TNU A;  1LTX A;  1TNZ A;  1TNY A;  1KZO A;  4GTO A;  1D8D A;  1FT2 A;  3HXE A;  3Q79 A;  3DSV A;  3Q73 A;  3DSX A;  4YDO A;  1O1T A;  4LNG A;  1N4P A;  4YDE A;  1TN7 A;  4GTM A;  1N4R A;  3DSW A;  1QBQ A;  1KZP A;  2BED A;  1N95 A;  1O1R A;  4MBG A;  1LD7 A;  3Q78 A;  4GTR A;  4GTV A;  2H6H A;  1JCR A;  3SFY A;  3E32 A;  1DCE A;  3EUV A;  1TN8 A;  4GTT A;  1SA4 A;  1SA5 A;  2H6F A;  2ZIS A;  2H6G A;  3Q7F A;  1O1S A;  3KSQ A;  3PZ4 A;  3HXB A;  4GTP A;  4EHM A;  1N4S A;  3Q7A A;  3HXC A;  3HXF A;  3C72 A;  2H6I A;  1LD8 A;  1NI1 A;  3DST A;  1N4Q A;  3EU5 A;  3KSL A;  3PZ1 A;  3SFX A;  4GTQ A;  2ZIR A;  3E33 A;  1TN6 A;  1N94 A;  3HXD A;  1X81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...