2ILRA

Crystal structure of human fanconi anemia protein e c-terminal domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
261
structure length
249
Chain Sequence
AESLELPKAIQDQLPRLQQLLKTLEEAPPVELQLLHECSPSQMDLLCAQLQLPQLSDLGLLRLCTWLLALSPDLSLSNATVLTRSLFLGRILSLTSSASRLLTTALTSFAAKYTYPVCSALLDPVLQAPGTGPAQTELLCCLVKMESLEPDAQVLMLGQILELPWKEETFLVLQSLLERQVEMTPEKFSVLMEKLCKTTSMAYAKLMLTVMTKYQANITETQRLGLAMALEPNTTFLRKSLKAALKHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fanconi anemia group E protein
publication title Insights into Fanconi Anaemia from the structure of human FANCE
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 98
structure length 249
sequence length 261
ec nomenclature
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11510 FA_FANCE Fanconi Anaemia group E protein FANCE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.480 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ilrA00
2ILRA
chains in the Genus database with same CATH superfamily
3B7RL 3RRNB 3L16A 5G04J 1N0RA 2ETAA 5BPPA 1TN8A 2ETCA 3ONLA 4EBAG 3SO8A 3FUNA 2R2LA 3G2SA 4UWGA 1OY3D 3PRZA 2XEEA 4DI4A 2WXMA 1K8KG 1V55E 3FHEA 4XI0A 2VGEA 1NA0A 5J08A 4HLLA 2P58C 3URZA 2QZAA 5CECB 1Z3YA 4B89A 3JUIA 4OYSA 3RSEG 3EHRA 3ZW3A 3FULA 5A23A 3SF4A 2J08A 2ZIRA 5CCMA 2IY0C 2IONA 2KCVA 4DLOA 5M72A 4I2WA 4MRUA 5HRYA 3ESKA 2WVIA 4YVQC 3FTWA 1S64A 2C0LA 4DX7D 2F37A 4XEIG 3T5XA 1HH8A 1HE8A 1D9SA 4KZCA 4PDXA 3GZSA 4JZYA 4E6HA 1H2VC 4L7TA 1V54E 1HXIA 3HIZA 4B8AA 3LPZA 3HG0D 4XX5A 3EHQA 2ETBA 5E75A 4F1PA 3CVLA 3EHMA 3N71A 3FH8A 1QYMA 3ESLA 3Q5MA 3RJVA 3LS8A 3CHMA 3DPDA 2WXHA 3PE3A 3ZFWA 4CZ2D 3CVPA 3UIPC 4BEPA 4JEUA 3QWVA 3Q49B 1EYHA 3UXGA 4FLHA 4GCNA 3U3WA 5FT9A 5FQ8A 4IRUA 4J6IA 2H6FA 1WM5A 2L9BA 3ZKJA 2ILRA 2V4LA 4KZ0A 3DSTA 4I1OB 3OTNA 4B93B 4C0MA 3PUKA 1AP7A 3SD5A 2DIWA 3EIQC 4GPKA 3DSVA 4ZHBA 4O60A 4AM9A 3CV0A 4XIFA 4U04A 3T8MA 2UWJG 2XGSA 4X8QA 2GRQB 3T8KA 3DEOA 3IKOB 3ZPJA 3BUAA 2IO3C 2NYJA 2DZOA 3Q73A 3HVEB 3KSLA 3NF1A 4PS8A 4CGWA 2AWIA 4J8YA 3RO3A 4WNGA 3RRMB 1KZPA 2HR2A 4HI8A 3FTXA 3LJNA 2EQXA 1JCQA 2CG3A 5FQ7A 3BQOA 2XCCA 4FULA 5CEDB 2AW6A 4GTRA 4UWFA 1ELRA 3E33A 2AXVA 3UTMA 3D9PA 2WXIA 5ITZF 1BD8A 1SVXA 2RG8A 4AIFA 2OVFA 3Q75A 1O1TA 1MX4A 5JJTA 4YDWA 1H0AA 4XKBA 4LNGA 4L1BA 4DJAA 3ZXPA 4ANXA 1MZCA 2PL2A 3LXUX 2WXNA 3CHRA 4U0ZA 3AJIA 2RKKA 3B7SA 1E7VA 2IF4A 3Q79A 5HS0A 5T3RA 4AP2A 2RD0A 2IQCA 3MCXA 3NOGD 2KXPC 3C3OA 4I9CA 5C1DA 1DVPA 4HI9A 1O1RA 5EKQD 4N2SA 4YDOA 1OUVA 4JPSA 4LRZA 5LX8A 3UIOC 1NI1A 5HQ8A 4YDYA 4FADA 1FCHA 4N5QA 3EHNA 2L0TB 4XZ4A 1FVFA 3Q4AB 4MKTA 5IY5E 4FHKA 4J8DA 4UWLA 4WUYA 3Q7AA 3WG7E 3B7UX 4MBGA 2UY1B 4U07A 2PQNA 1OT8A 5J90A 4B8CB 4N2QA 3ZHEB 3ML9A 4AV7A 3D9MA 4ANUA 4GTTA 2CFUA 2LXMA 3FU3A 4GZ6A 3CVXA 4XKCA 2VQ2A 4CGVA 4JL0A 3V2OA 5EYPF 2X6KA 1D8DA 2IO2C 3MJWA 3CVVA 2WQ6A 3R7QA 1UJKA 2WM9A 4TV3A 1Z5SC 3K9IA 3B7BA 2KBXA 4ILIA 2VGXA 3DEPA 4JHRA 3S7FA 4HORA 4GPMA 4L9PA 3PZ4A 2R5SA 4XE0A 3EUVA 4HQDA 3D9IA 2R02A 2VTBA 2Y4TA 2X38A 4GMLA 3ZYQA 1H19A 1NFIE 5ENOD 4ME2A 3AAAC 2P9LG 2XRZA 2GW1A 3CVNA 1INZA 4K5CA 1TNUA 3V2XA 4Q96A 5FWQA 2YHCA 3GZ2A 5T4YA 3EJNA 3ZN3A 4EZKA 1TNBA 4FLBA 4P29A 3TXMA 2MOWA 2AJAA 4BWRA 3HXFA 1SA4A 3I3NA 3U64A 4HOTA 3CR3A 1BI7B 1YCSB 2GRPB 2A4ZA 5B1AE 1ZU2A 3G2UA 4RG9A 1N4PA 2DYSE 3IV0A 2OVBA 5FZQA 2I2OA 4UUCA 3CIAA 3VLFA 4NQ0A 2R03A 1UG3A 5A6CA 3ULEG 3FTUA 2ZGDA 4K5AB 5FINA 5H7PA 4EQFA 3CSFA 1NP7A 3FH7A 4DX5D 4O6FA 3FUKA 5D0QD 3DBSA 2FI7A 2ONDA 3QWPA 4HLEA 1HF8A 4I1MA 5JHBA 4GZ3A 1N54A 5CERB 2XZTG 4G24A 3Q7FA 3L9TA 4HRLA 3B13A 2XENA 2CFZA 2NC9A 5AJDA 4HRNA 3FTYA 2R05A 4WNFA 1DCQA 3PUJA 3ASHA 3SQVA 5CHEE 3TWXA 1H2TC 3OXLA 4FJYA 2RFMA 3DXKG 3BG0B 1HZ4A 1TNZA 5EX0A 3R7RA 4BSXA 5FQ6A 4KT6B 1UN9A 3ABME 3CKBA 5C2YA 4PS3A 3C98A 2Y4UA 1UW4B 4L2YA 2WPVA 3FFLA 4DRXE 3MKRA 2OCCE 3FUEA 3V31A 4IULA 5JMND 2F8XK 2VSYA 3E30A 1Q2ZA 2CHZA 4HOSA 2P9NG 3UINC 1KLXA 1JCSA 3L82A 5B1BE 1ELWA 1NL4A 3LY7A 1MX2A 4WNDA 4UQYA 3AG3E 4WNEA 4F6RD 3PDNA 4G26A 5ANLA 4N3AA 4HBDA 1IYGA 5ENNA 2A5EA 3CVWA 3FEYA 2PZIA 4YNDA 3FWVA 3FH5A 3IHYA 2V0PA 4BT9A 2EIKE 1JPLA 5HI7A 3JYSA 3ZRHA 1KT1A 5AARA 1OCCE 2GROB 3CHPA 1TJCA 5ARFA 5BXOA 3JQ0A 4U8YD 4EZJA 5KNHD 3PS6A 2YNQA 5LCWC 4AVXA 2WQHA 5ARGA 3HXDA 3D3MA 3PZDA 4LSZE 1H6OA 3AG2E 2PM6A 5JJ6A 3TWSA 3E4BA 3CK9A 2Y69E 3SZ7A 3TWVA 4DX6D 3HDXA 3FUMA 2KCLA 2KZTB 3VLDA 2JEKA 3R9AB 5CRVA 5FZSA 4O1PA 3CKCA 4ILHB 3D9OA 3X2QE 2FF4A 3CQGB 3EIJA 4M7CA 4G1TA 5HKPA 1N0QA 5EDSA 1IKND 1YA0A 4MS6A 3C5RA 1EF1C 3NOCD 3MV2B 3UM2A 2XRYA 2WXLA 4CDRA 4A55A 2LNIA 4GCOA 3I5PA 2OOEA 1OXJA 2XGOA 2E0IA 3NAWA 1XNFA 5ENQD 4ZFHA 3UMVA 3QB2A 1U3CA 4O1OA 4BY6A 3JXJA 5LFAA 5BT1A 4Q94A 4WWPA 3QK0A 4LUNU 4EZLA 4BTBA 4MLPA 2PQRA 3CEQA 3ABKE 2R59A 4KVOA 2XS1A 2I6HA 3CK8A 3DWLG 3ASFA 2IEJA 4EBAA 3O48A 3CK7A 2M63A 2GRLA 3UT7A 1TN6A 1FT1A 2VSOE 3DXMG 1S0PA 3GZ1A 1G3NB 3RK6A 4DX2A 3Q47B 2OEWA 5EIBE 1SW6A 3LCAA 4WWOA 3IBEA 3UPVA 3P1UA 3ZIMA 4A1SA 3S2AA 3VTYA 4UQXA 2AVPA 5ANRA 3E37A 4JB8P 3UM0A 3QWWA 5T8IA 3UM1A 2P9KG 3U9WA 3FUJA 3NZUA 3QC1A 4GZDA 4JA7A 5BV0A 4H7YA 3SFZA 4NACA 1Z6TA 3ZUVB 5CBNA 3AG1E 4YDEA 1GW6A 2WXRA 4GTVA 3MKQA 2FBNA 1JCRA 3TWRA 3EDTB 3JQ1A 3CHQA 1ZB1A 2J8SD 3RO2A 4GYYA 3HRAA 1A17A 4TUMA 1HS6A 4FC8A 2ZU6B 2QC9A 2WB2A 3LYAA 3UUXA 2V4HC 3KEZA 3TXNA 3KS2A 3TG5A 5D0OD 2AXUA 3RRUA 1SA5A 4FA6A 3TWQA 2QFCA 4NIKA 4APFA 1K3ZD 2PNNA 4F3VA 1ELKA 2BEDA 3FU0A 4CYMD 1TR4A 4BSZB 3QJZA 1W3BA 4ACKA 2JABA 2IJGX 2EIME 4CT4A 2QYJA 3LEWA 5CCLA 4PH4B 3S7JA 2BKKB 3FP3A 2BTDA 5FQ4A 4ANVA 1E8WA 3APCA 1TYQG 4LNBA 4GZCA 1BLXB 5AIJA 3ENEA 3AS5A 3R9MA 1LTXA 4XI9A 3TGOA 3G2WA 3FTVA 3D9NA 1BU9A 4DLQA 2XEHA 1FT2A 1HG2A 4FJZA 4BETA 3MEKA 4G23A 2V5FA 4URKA 2WMOA 2L6BA 3CVQA 5BW8C 2KATA 5CBOA 5BV1A 1TN7A 3ZEFA 3D9HA 3UX4A 3JCKC 3UQ3A 4HFGA 3QNKA 2KM4A 5LOZA 3RIBA 1S70B 2J4DA 2P9PG 4RLYA 3TJPA 3IEGA 3NBNB 3WXXA 4Y6CA 1H6PA 5EX3A 1UOHA 5G55A 4CEMA 1JWFA 3SI5A 3MV3B 1Y8MA 3CSTA 1O1SA 2WXPA 5KWDA 1N4SA 3CQCB 4KXKB 5BUZA 4HXIA 4LERA 4J8SA 4BT8A 4AXHA 5KJKA 2LAIA 2LO6A 4HRMB 4G25A 4KMOA 2FULA 5ENPD 4UQZA 4HB5A 3MGBA 5G05C 3ABLE 2H6IA 5KNGA 1RW2A 4OAUC 3FU6A 5G05J 3P2BA 2MHKA 1U3DA 2VJ8A 1X81A 3OAWA 2WMNA 2V5QC 4QQIA 3GYZA 3SFXA 4FP7A 5ENRD 4PUCA 3TWWA 2P2CP 3LVQE 5KBAA 1P5QA 5FTPA 2BUGA 4TUUA 4EECA 3L17A 4RVBA 3LVRE 4GZ5A 3SY2A 1MQSA 1BI8B 4AJWA 4Q69A 2PM7A 3QKYA 3I4RB 1EPUA 5A7DB 3UI2A 1OCOE 1TNOA 5CEAA 4L23A 3APFA 4EPZA 1OWNA 5EIDA 4K03A 3TL5A 4U95D 1S63A 1E8XA 1N52A 5AAOA 1WG0A 1IHBA 3MX3A 3KSQA 3D9KA 4TXPA 4KVMA 1YMPA 3IHVA 1Y6IA 3JUEA 4BX9A 1JUQA 2CHXA 2V8SE 3Q15A 5BNWA 2J07A 1NZNA 2F0YA 3HVEA 2AXZA 2P9IG 3BG1B 1LD8A 5ENTD 2GRNB 3SHFA 2J09A 4I1AA 2BKGA 2F8YA 4C0EA 4UWKA 3VTXA 4TRQA 3TWTA 1TEZA 4R7LA 3CHOA 2XS8A 5AENA 1WAO1 4FHJA 1QBQA 3PREA 3FU5A 4NRHB 4UI9K 2VGXB 3HYMB 3BEEA 4PS7A 4AY6A 3APDA 3L13A 1SZ9A 1TJFA 5G04C 2Y0BG 3ONKA 3DSXA 2JLBA 1MHQA 5KJMA 3MA5A 3NQPA 3EU9A 4B94A 5AYWD 3ZGQA 2VSXE 2VTBB 1X5BA 2GRRB 4CCAA 2EIJE 5AQ9A 3FUDA 5AJLA 3AU5A 3C3QA 1FPPA 5EYLA 4ABNA 1HO8A 5LP0A 1HG5A 4U7EB 3B7TA 3PNLB 3OXFA 1E96B 4WAFA 4U0UA 3SBSA 5KCMA 1SZAA 5D2MC 4ILGA 3AS4A 1RZ4A 2XCBA 4JHJA 2XEVA 3CGHA 3UM3A 3L6AA 3ASGA 3G2VA 4KYOB 5FJYA 4GYWA 2WXQA 5G2NA 5LCWJ 5KJLA 2LXLA 1WDYA 4JVSA 4I6EA 4N5CA 1IXVA 4F1SA 3U4TA 4I9EA 3L22A 2FO7A 1DC2A 4G8LA 3KD7A 2BF0X 1FVHA 4DI3A 2UY1A 1UN8A 3S7DA 5JA4D 2YINA 3FUFA 3ZHEA 2IOLA 3NZSA 3DRAA 4Y6WA 4GTSA 4I43A 5E76A 1K1AA 3SGHA 4WWNA 4QFVA 4UWHA 3PH0C 3QOUA 5CMWA 3HXBA 3ULQA 5KJNA 3QARA 2R17C 4G8KA 2WXGA 2WXKA 3U66A 3UKRG 4NURA 5AQAA 4K5BA 3VLEA 3HXEA 3DSSA 4U8HA 3C3RA 4EHMA 4I6GA 4AY5A 4V3IA 1B89A 3GW4A 1OCZE 1PC2A 1H2UA 4OVUA 3B95A 3PZ1A 4ATZD 4ANWA 2NXPA 4GMJA 4A3VA 4HVBA 2QYUA 4APOA 2XHEA 3RKVA 1KPSB 3PE4A 4J0UA 3PZ2A 4A1GA 3FUIA 2KC7A 2C2LA 3J5QB 2J4BA 4KBQA 1U2VG 3FEXA 2VYIA 3DSUA 1KT0A 2LAHA 3IXEA 4AOFA 4BESA 1E7UA 3ML8A 3MYVA 2EINE 1HU3A 2OV8A 5JHAA 1IQUA 3D9JA 4J8FA 1QNFA 3LKUA 4JEHA 2A5UA 1OWMA 4GA1A 4GTPA 2J49A 4CRWA 2WXFA 5DBKA 2I1JA 4Z68A 1L5JA 4GTMA 1XGWA 3J5PA 2VGYA 4N3BA 1HFAA 4DK5A 3ASNE 2P9SG 2X6IA 5D66A 2CG2A 4LCTA 2EILE 3Q9NC 3LY9A 2CHWA 4GU5A 2HYZA 4G11A 3QDNA 5B3SE 3NB2A 4JXTA 2DYRE 3LDZA 1E8YA 3FTSA 2LSUA 2Y1LE 3UKUG 2YQ8A 3QAQA 4L2LA 4GTQA 3ULYA 3W9GA 2XPYA 5AN8A 3V30A 1E8ZA 2H6HA 3TWUA 1QQEA 4C48B 5CMYA 2YHEA 1N4RA 4HS2A 4CDNA 5AQ7A 1BPOA 2Y3AA 4G2VA 4J7WA 2HO1A 1JWGA 2I9CA 4D10C 2I1KA 1MJ0A 4I2ZA 4TXQA 1Z3XA 4RG6A 1D8EA 2FEZA 3DSWA 4RSYA 2X6FA 3FTZA 1N11A 5FZRA 2MRIA 4LEUA 3CVUA 2L6JA 2XQ0A 4N3CA 1H6KA 4JD2G 2QY7A 4IYPA 1LF8A 2ZISA 3PEUB 4A3TA 4M3OA 1MX6A 4IN3B 3S7BA 3PEVB 5EILA 3FUHA 4GAAA 4DPRA 3ASDA 4JHKA 3F6QA 3ASOE 4A63B 3LY8A 1N4QA 4GA2A 2XPIA 4GA0A 3KAEA 3E34A 3ZVVA 2DZNA 1N94A 3L08A 2DBAA 3LJ3A 1LD7A 4I6JA 4U63A 1A5EA 4E85A 2KCKA 4HOQA 1KZOA 2H6GA 1O5MA 4B0ZA 3FY4A 4HOUA 1MYOA 4J8EA 2B0OE 4JC8A 2GGFA 2P9UG 3DPYA 4HNAD 2WQ7A 4DUIA 3KEAA 3ZYMA 4GB9A 2E2EA 2XGMA 3Q78A 4JA9A 3SNXA 3T5VA 4OAVB 2WXJA 3AS8A 4OVVA 5JJ7A 3CHSA 3ISMC 2FO1E 4RQIA 4CT0A 3HHMA 4W9RA 2OEVA 2NSZA 4I17A 2L0IA 2DVWA 4K0RA 3AU4A 5BXUA 1E90A 2LUHA 4BERA 2KZTA 2HM8A 1QZ2A 2J9QA 3JXIA 3MKQB 3T9KA 4AEZC 1WY6A 4BFRA 4ACLA 2ZGGA 1UJJA 3UT4A 4LNUD 2HE0A 4BX8A 2IFUA 1EDUA 3L54A 4TXRA 3ZYLA 3C72A 3MZLB 4DX1A 3E32A 2X6JA 3RU0A 3D9LA 1OWLA 3G2TA 2B6CA 1PY1A 2X6HA 1IQRA 2ZXWE 4UI9C 1IHGA 1AWCB 3V79K 2DCPA 2Q7FA 3SFYA 3OXGA 1K1BA 2IOSA 1YYHA 3CVYA 2DWZA 4UI9J 5CRUA 4GYOA 4U96D 2XZDG 4C9BB 5AQBA 5ENSD 3CLJA 5FIOA 1ZBPA 4N39A 1NA3A 4GMRA 3Q9UC 3EU5A 1DCEA 3AG4E 1VDYA 2GRMA 3HXCA 3SBTB 2X3MA 1PAQA 2VSNA 1OWOA 2C0MA 5DIZA 4BTAA 3TG4A 2WXOA 5EN5D 1DNPA 4YVOA 2XPZA 1N9AA 4ATGA 3I4GA 4H7XA 3W9FA 3ZXSA 4F53A 4FU3A 4LG6A 3ZNGA 2MYOA 4JW1A 1SQMA 3ZYKA 2LSVA 2RFAA 1OWPA 2IU1A 3UT8A 1TNYA 3TAXA 4F7AA 3PVLA 3PNTB 1N95A 3PZ3A 4U0SA 4U8VD 1OCRE 3ZU7B 3RAUA 4GTOA 3FDHA 3BU8A 1HX8A 3O4ZA 4CDMA
chains in the Genus database with same CATH topology
3VLEA 3CR3A 4APFA 3B7RL 4U8HA 3RRNB 4F3VA 1ELKA 3FU0A 3L16A 5G04J 4I6GA 5BPPA 2A4ZA 4AY5A 3QJZA 1W3BA 4ACKA 1ZU2A 3G2UA 2IJGX 4CT4A 4V3IA 3ONLA 4EBAG 1B89A 4RG9A 3FUNA 3GW4A 1PC2A 3LEWA 1H2UA 4OVUA 3G2SA 4UWGA 5CCLA 3IV0A 4PH4B 2OVBA 3S7JA 5FZQA 2I2OA 3PRZA 3CIAA 3VLFA 4ANWA 3FP3A 4NQ0A 2BTDA 2NXPA 4GMJA 4A3VA 5FQ4A 4DI4A 2WXMA 1UG3A 4ANVA 4HVBA 1E8WA 5A6CA 4APOA 3APCA 2XHEA 4GZCA 3FHEA 3FTUA 4XI0A 3RKVA 3PE4A 4J0UA 4A1GA 5AIJA 1NA0A 2C2LA 2KC7A 3FUIA 5J08A 2P58C 3ENEA 3AS5A 2J4BA 4KBQA 3FEXA 2VYIA 3URZA 1KT0A 1Z3YA 4B89A 2LAHA 3CSFA 4EQFA 3JUIA 1NP7A 4AOFA 4XI9A 1E7UA 4OYSA 3FH7A 3TGOA 3G2WA 3FTVA 3ML8A 3ZW3A 3FULA 3D9NA 3FUKA 3MYVA 4O6FA 5D0QD 4DLQA 3SF4A 5A23A 1HG2A 3DBSA 2FI7A 1HU3A 2J08A 2ONDA 2OV8A 3QWPA 4FJZA 4HLEA 5CCMA 1HF8A 3MEKA 5JHAA 4G23A 1IQUA 3D9JA 2V5FA 1QNFA 4I1MA 3LKUA 4J8FA 4JEHA 2A5UA 5JHBA 2IONA 2KCVA 4URKA 1OWMA 2WMOA 4GA1A 4DLOA 3CVQA 2J49A 4GZ3A 1N54A 5M72A 5BW8C 4CRWA 4I2WA 4G24A 4MRUA 2KATA 2WXFA 5DBKA 2I1JA 5BV1A 3ESKA 3B13A 2WVIA 2CFZA 4YVQC 2NC9A 3FTWA 3ZEFA 1L5JA 2C0LA 3UX4A 3JCKC 1XGWA 5AJDA 3T5XA 3UQ3A 1HH8A 1HE8A 4HFGA 3FTYA 3QNKA 4KZCA 2VGYA 4N3BA 4PDXA 3GZSA 2KM4A 4JZYA 5LOZA 3RIBA 4E6HA 4WNFA 1HFAA 1H2VC 4L7TA 4DK5A 2X6IA 2CG2A 4LCTA 2J4DA 3PUJA 3TJPA 1HXIA 3ASHA 3LY9A 3HIZA 4B8AA 3IEGA 5CHEE 3WXXA 3LPZA 4Y6CA 2CHWA 1H2TC 3OXLA 4FJYA 4GU5A 2HYZA 4XX5A 5EX3A 3BG0B 5E75A 4G11A 3CVLA 3EHMA 3N71A 3FH8A 3QDNA 1JWFA 5G55A 3SI5A 4CEMA 1HZ4A 3ESLA 3MV3B 3Q5MA 1Y8MA 3RJVA 3LS8A 4JXTA 3CHMA 3DPDA 5EX0A 2WXHA 3PE3A 3R7RA 3CSTA 3LDZA 3ZFWA 1E8YA 3FTSA 2LSUA 2WXPA 5FQ6A 4BSXA 2YQ8A 3CVPA 3QAQA 1UN9A 4KT6B 4L2LA 3CQCB 4KXKB 3CKBA 4JEUA 5C2YA 3QWVA 2XPYA 3Q49B 4PS3A 1EYHA 4FLHA 4GCNA 3C98A 1E8ZA 2Y4UA 4HXIA 4LERA 5FT9A 5BUZA 5FQ8A 3U3WA 4IRUA 4J8SA 1UW4B 4J6IA 4L2YA 4AXHA 4BT8A 5KJKA 1QQEA 1WM5A 2L9BA 2LAIA 2ILRA 2LO6A 2V4LA 2WPVA 4KZ0A 5CMYA 2YHEA 4I1OB 3FFLA 4G25A 4KMOA 2FULA 3OTNA 3MKRA 3FUEA 4HS2A 4UQZA 4CDNA 4IULA 1BPOA 2VSYA 4C0MA 3MGBA 3PUKA 2Y3AA 4G2VA 5G05C 2CHZA 4HOSA 2HO1A 3SD5A 1JWGA 1KLXA 2DIWA 3EIQC 4GPKA 2I9CA 3FU6A 4D10C 2I1KA 4AM9A 3CV0A 4XIFA 1ELWA 3LY7A 4U04A 4I2ZA 5G05J 3P2BA 4WNDA 3T8MA 1Z3XA 4RG6A 4UQYA 2MHKA 4WNEA 2FEZA 2UWJG 2XGSA 2X6FA 3FTZA 1U3DA 4RSYA 5FZRA 2VJ8A 3PDNA 4G26A 2MRIA 3IKOB 3OAWA 5ANLA 3ZPJA 2WMNA 4N3AA 4HOTA 1IYGA 3GYZA 4FP7A 3HVEB 4LEUA 3NF1A 4PS8A 3CVUA 4PUCA 2L6JA 5ENNA 4CGWA 2XQ0A 3LVQE 4N3CA 3FEYA 3CVWA 2PZIA 1H6KA 4YNDA 2AWIA 2QY7A 3RO3A 1P5QA 3FWVA 5FTPA 2BUGA 3FH5A 4IYPA 4WNGA 3IHYA 2V0PA 4TUUA 4EECA 3RRMB 1LF8A 3L17A 4BT9A 4RVBA 3LVRE 3PEUB 4A3TA 2HR2A 1JPLA 5HI7A 4M3OA 3JYSA 4GZ5A 1MQSA 3ZRHA 4AJWA 1KT1A 4IN3B 3S7BA 3FTXA 2EQXA 1TJCA 3CHPA 3PEVB 5ARFA 2CG3A 5FQ7A 3FUHA 3JQ0A 4GAAA 2XCCA 4DPRA 4FULA 3ASDA 4JHKA 4EZJA 4Q69A 3PS6A 2PM7A 3LY8A 2YNQA 5LCWC 3QKYA 4GA2A 4AVXA 2XPIA 4GA0A 2AW6A 2WQHA 1EPUA 3I4RB 3KAEA 5A7DB 5ARGA 4UWFA 3ZVVA 1ELRA 3D3MA 3PZDA 2AXVA 3D9PA 2WXIA 3L08A 3APFA 2DBAA 3LJ3A 4I6JA 4L23A 2PM6A 4U63A 4EPZA 5JJ6A 1OWNA 3E4BA 3CK9A 4K03A 3TL5A 3SZ7A 4E85A 2KCKA 1E8XA 2RG8A 1N52A 4AIFA 2OVFA 4HOQA 3HDXA 3FUMA 3MX3A 2KCLA 2KZTB 3D9KA 3VLDA 4KVMA 5JJTA 3IHVA 1H0AA 4XKBA 2JEKA 4L1BA 4B0ZA 4DJAA 3FY4A 3R9AB 1Y6IA 4HOUA 5FZSA 4J8EA 4ANXA 3CKCA 4ILHB 1JUQA 4BX9A 2V8SE 2CHXA 4JC8A 3Q15A 2PL2A 3D9OA 5BNWA 2J07A 2WXNA 2FF4A 3CHRA 3LXUX 4U0ZA 1NZNA 2GGFA 3CQGB 3EIJA 3HVEA 2AXZA 3B7SA 3BG1B 1E7VA 2IF4A 4G1TA 2WQ7A 3SHFA 2J09A 5EDSA 4I1AA 5T3RA 4AP2A 1YA0A 3ZYMA 4MS6A 4GB9A 2RD0A 4UWKA 4C0EA 2IQCA 3VTXA 3MCXA 4TRQA 1EF1C 1TEZA 2E2EA 4R7LA 3CHOA 3MV2B 2XGMA 2XRYA 2WXLA 4I9CA 4JA9A 4CDRA 5C1DA 1DVPA 4A55A 5AENA 3SNXA 5EKQD 1WAO1 2LNIA 4GCOA 4N2SA 3T5VA 4FHJA 3I5PA 2OOEA 3PREA 2XGOA 1OUVA 4JPSA 4LRZA 5LX8A 2E0IA 3FU5A 2WXJA 4NRHB 1XNFA 4UI9K 3UMVA 3AS8A 3QB2A 1U3CA 4OVVA 2VGXB 3HYMB 5JJ7A 3BEEA 3CHSA 4PS7A 4BY6A 5LFAA 5BT1A 5HQ8A 4Q94A 4AY6A 3APDA 4WWPA 3L13A 1SZ9A 4CT0A 1TJFA 5G04C 4FADA 1FCHA 3QK0A 4LUNU 4EZLA 3EHNA 2L0TB 3ONKA 3HHMA 4W9RA 4BTBA 2JLBA 1MHQA 4MLPA 2NSZA 4XZ4A 2PQRA 4I17A 2L0IA 5KJMA 4K0RA 3MA5A 3CEQA 3NQPA 1FVFA 3AU4A 3Q4AB 1E90A 4B94A 5AYWD 2R59A 4KVOA 3ZGQA 4MKTA 2VSXE 4FHKA 2VTBB 4J8DA 4UWLA 2I6HA 1X5BA 2KZTA 3B7UX 3CK8A 4WUYA 2HM8A 1QZ2A 2J9QA 2UY1B 3ASFA 4CCAA 4U07A 2PQNA 4EBAA 3MKQB 4AEZC 5J90A 1WY6A 3FUDA 4B8CB 4BFRA 3O48A 4N2QA 3CK7A 3ML9A 3ZHEB 4ACLA 5AJLA 4AV7A 2M63A 2GRLA 3AU5A 3D9MA 3UT7A 1UJJA 3UT4A 4ABNA 4BX8A 1HO8A 1EDUA 2IFUA 3L54A 3ZYLA 4ANUA 2CFUA 3MZLB 5LP0A 1HG5A 2X6JA 2VSOE 3FU3A 4GZ6A 3B7TA 3PNLB 3OXFA 3RU0A 3CVXA 3D9LA 2VQ2A 1E96B 1OWLA 3G2TA 1S0PA 3GZ1A 4JL0A 4XKCA 3RK6A 4CGVA 1PY1A 4WAFA 2X6HA 3Q47B 4U0UA 3SBSA 2X6KA 1IQRA 3LCAA 4UI9C 3MJWA 4WWOA 5KCMA 2WQ6A 3CVVA 1IHGA 1SZAA 3R7QA 1UJKA 2DCPA 4ILGA 3AS4A 3IBEA 3UPVA 2WM9A 2Q7FA 3P1UA 3ZIMA 4TV3A 2XCBA 3OXGA 4JHJA 2XEVA 3CGHA 3K9IA 3S2AA 3L6AA 4A1SA 3ASGA 2IOSA 3VTYA 4ILIA 3CVYA 3G2VA 4KYOB 4UI9J 2VGXA 4JHRA 5FJYA 4GYWA 2WXQA 4GYOA 5G2NA 4UQXA 3S7FA 4C9BB 5KJLA 5LCWJ 4HORA 2AVPA 3CLJA 5ANRA 4JVSA 3QWWA 4I6EA 1ZBPA 4N39A 1NA3A 4N5CA 5T8IA 2R5SA 1VDYA 3U9WA 4F1SA 2GRMA 4XE0A 3U4TA 3FUJA 3NZUA 3QC1A 4I9EA 3L22A 2FO7A 3D9IA 3SBTB 2X3MA 4GZDA 4JA7A 1PAQA 2VSNA 5BV0A 1OWOA 2C0MA 3KD7A 4H7YA 3SFZA 2VTBA 2BF0X 1FVHA 4NACA 4DI3A 5DIZA 1Z6TA 1UN8A 2UY1A 3S7DA 2Y4TA 3TG4A 4BTAA 2WXOA 1GW6A 2WXRA 1DNPA 3MKQA 2FBNA 2X38A 2YINA 3FUFA 4YVOA 2XPZA 4GMLA 2IOLA 3EDTB 3ZHEA 3ZYQA 1H19A 3JQ1A 4ATGA 3NZSA 3I4GA 3CHQA 4H7XA 4Y6WA 4ME2A 4I43A 3RO2A 5E76A 3ZXSA 3SGHA 4WWNA 4F53A 4FU3A 4QFVA 2XRZA 2GW1A 3CVNA 4GYYA 4UWHA 4JW1A 3PH0C 1INZA 1A17A 3QOUA 1SQMA 3ZYKA 5CMWA 2LSVA 1HS6A 4FC8A 2ZU6B 3ULQA 4Q96A 5FWQA 2YHCA 2WB2A 1OWPA 2IU1A 3UT8A 4F7AA 3TAXA 3LYAA 3GZ2A 3UUXA 5KJNA 3QARA 5T4YA 2R17C 3PVLA 3KEZA 3EJNA 3ZN3A 4EZKA 3PNTB 4FLBA 3TXNA 2WXGA 3KS2A 4P29A 4U0SA 2WXKA 3TXMA 3U66A 2MOWA 4BWRA 3TG5A 5D0OD 2AXUA 4NURA 3RRUA 3I3NA 3FDHA 3U64A 1HX8A 3O4ZA 4FA6A 2QFCA 4CDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ILR A; 
#chains in the Genus database with same CATH topology
 3B7R L;  3RRN B;  3L16 A;  5G04 J;  1N0R A;  2ETA A;  5BPP A;  1TN8 A;  2ETC A;  3ONL A;  4EBA G;  3SO8 A;  3FUN A;  2R2L A;  3G2S A;  4UWG A;  1OY3 D;  3PRZ A;  2XEE A;  4DI4 A;  2WXM A;  1K8K G;  1V55 E;  3FHE A;  4XI0 A;  2VGE A;  1NA0 A;  5J08 A;  4HLL A;  2P58 C;  3URZ A;  2QZA A;  5CEC B;  1Z3Y A;  4B89 A;  3JUI A;  4OYS A;  3RSE G;  3EHR A;  3ZW3 A;  3FUL A;  5A23 A;  3SF4 A;  2J08 A;  2ZIR A;  5CCM A;  2IY0 C;  2ION A;  2KCV A;  4DLO A;  5M72 A;  4I2W A;  4MRU A;  5HRY A;  3ESK A;  2WVI A;  4YVQ C;  3FTW A;  1S64 A;  2C0L A;  4DX7 D;  2F37 A;  4XEI G;  3T5X A;  1HH8 A;  1HE8 A;  1D9S A;  4KZC A;  4PDX A;  3GZS A;  4JZY A;  4E6H A;  1H2V C;  4L7T A;  1V54 E;  1HXI A;  3HIZ A;  4B8A A;  3LPZ A;  3HG0 D;  4XX5 A;  3EHQ A;  2ETB A;  5E75 A;  4F1P A;  3CVL A;  3EHM A;  3N71 A;  3FH8 A;  1QYM A;  3ESL A;  3Q5M A;  3RJV A;  3LS8 A;  3CHM A;  3DPD A;  2WXH A;  3PE3 A;  3ZFW A;  4CZ2 D;  3CVP A;  3UIP C;  4BEP A;  4JEU A;  3QWV A;  3Q49 B;  1EYH A;  3UXG A;  4FLH A;  4GCN A;  3U3W A;  5FT9 A;  5FQ8 A;  4IRU A;  4J6I A;  2H6F A;  1WM5 A;  2L9B A;  3ZKJ A;  2ILR A;  2V4L A;  4KZ0 A;  3DST A;  4I1O B;  3OTN A;  4B93 B;  4C0M A;  3PUK A;  1AP7 A;  3SD5 A;  2DIW A;  3EIQ C;  4GPK A;  3DSV A;  4ZHB A;  4O60 A;  4AM9 A;  3CV0 A;  4XIF A;  4U04 A;  3T8M A;  2UWJ G;  2XGS A;  4X8Q A;  2GRQ B;  3T8K A;  3DEO A;  3IKO B;  3ZPJ A;  3BUA A;  2IO3 C;  2NYJ A;  2DZO A;  3Q73 A;  3HVE B;  3KSL A;  3NF1 A;  4PS8 A;  4CGW A;  2AWI A;  4J8Y A;  3RO3 A;  4WNG A;  3RRM B;  1KZP A;  2HR2 A;  4HI8 A;  3FTX A;  3LJN A;  2EQX A;  1JCQ A;  2CG3 A;  5FQ7 A;  3BQO A;  2XCC A;  4FUL A;  5CED B;  2AW6 A;  4GTR A;  4UWF A;  1ELR A;  3E33 A;  2AXV A;  3UTM A;  3D9P A;  2WXI A;  5ITZ F;  1BD8 A;  1SVX A;  2RG8 A;  4AIF A;  2OVF A;  3Q75 A;  1O1T A;  1MX4 A;  5JJT A;  4YDW A;  1H0A A;  4XKB A;  4LNG A;  4L1B A;  4DJA A;  3ZXP A;  4ANX A;  1MZC A;  2PL2 A;  3LXU X;  2WXN A;  3CHR A;  4U0Z A;  3AJI A;  2RKK A;  3B7S A;  1E7V A;  2IF4 A;  3Q79 A;  5HS0 A;  5T3R A;  4AP2 A;  2RD0 A;  2IQC A;  3MCX A;  3NOG D;  2KXP C;  3C3O A;  4I9C A;  5C1D A;  1DVP A;  4HI9 A;  1O1R A;  5EKQ D;  4N2S A;  4YDO A;  1OUV A;  4JPS A;  4LRZ A;  5LX8 A;  3UIO C;  1NI1 A;  5HQ8 A;  4YDY A;  4FAD A;  1FCH A;  4N5Q A;  3EHN A;  2L0T B;  4XZ4 A;  1FVF A;  3Q4A B;  4MKT A;  5IY5 E;  4FHK A;  4J8D A;  4UWL A;  4WUY A;  3Q7A A;  3WG7 E;  3B7U X;  4MBG A;  2UY1 B;  4U07 A;  2PQN A;  1OT8 A;  5J90 A;  4B8C B;  4N2Q A;  3ZHE B;  3ML9 A;  4AV7 A;  3D9M A;  4ANU A;  4GTT A;  2CFU A;  2LXM A;  3FU3 A;  4GZ6 A;  3CVX A;  4XKC A;  2VQ2 A;  4CGV A;  4JL0 A;  3V2O A;  5EYP F;  2X6K A;  1D8D A;  2IO2 C;  3MJW A;  3CVV A;  2WQ6 A;  3R7Q A;  1UJK A;  2WM9 A;  4TV3 A;  1Z5S C;  3K9I A;  3B7B A;  2KBX A;  4ILI A;  2VGX A;  3DEP A;  4JHR A;  3S7F A;  4HOR A;  4GPM A;  4L9P A;  3PZ4 A;  2R5S A;  4XE0 A;  3EUV A;  4HQD A;  3D9I A;  2R02 A;  2VTB A;  2Y4T A;  2X38 A;  4GML A;  3ZYQ A;  1H19 A;  1NFI E;  5ENO D;  4ME2 A;  3AAA C;  2P9L G;  2XRZ A;  2GW1 A;  3CVN A;  1INZ A;  4K5C A;  1TNU A;  3V2X A;  4Q96 A;  5FWQ A;  2YHC A;  3GZ2 A;  5T4Y A;  3EJN A;  3ZN3 A;  4EZK A;  1TNB A;  4FLB A;  4P29 A;  3TXM A;  2MOW A;  2AJA A;  4BWR A;  3HXF A;  1SA4 A;  3I3N A;  3U64 A;  4HOT A;  3CR3 A;  1BI7 B;  1YCS B;  2GRP B;  2A4Z A;  5B1A E;  1ZU2 A;  3G2U A;  4RG9 A;  1N4P A;  2DYS E;  3IV0 A;  2OVB A;  5FZQ A;  2I2O A;  4UUC A;  3CIA A;  3VLF A;  4NQ0 A;  2R03 A;  1UG3 A;  5A6C A;  3ULE G;  3FTU A;  2ZGD A;  4K5A B;  5FIN A;  5H7P A;  4EQF A;  3CSF A;  1NP7 A;  3FH7 A;  4DX5 D;  4O6F A;  3FUK A;  5D0Q D;  3DBS A;  2FI7 A;  2OND A;  3QWP A;  4HLE A;  1HF8 A;  4I1M A;  5JHB A;  4GZ3 A;  1N54 A;  5CER B;  2XZT G;  4G24 A;  3Q7F A;  3L9T A;  4HRL A;  3B13 A;  2XEN A;  2CFZ A;  2NC9 A;  5AJD A;  4HRN A;  3FTY A;  2R05 A;  4WNF A;  1DCQ A;  3PUJ A;  3ASH A;  3SQV A;  5CHE E;  3TWX A;  1H2T C;  3OXL A;  4FJY A;  2RFM A;  3DXK G;  3BG0 B;  1HZ4 A;  1TNZ A;  5EX0 A;  3R7R A;  4BSX A;  5FQ6 A;  4KT6 B;  1UN9 A;  3ABM E;  3CKB A;  5C2Y A;  4PS3 A;  3C98 A;  2Y4U A;  1UW4 B;  4L2Y A;  2WPV A;  3FFL A;  4DRX E;  3MKR A;  2OCC E;  3FUE A;  3V31 A;  4IUL A;  5JMN D;  2F8X K;  2VSY A;  3E30 A;  1Q2Z A;  2CHZ A;  4HOS A;  2P9N G;  3UIN C;  1KLX A;  1JCS A;  3L82 A;  5B1B E;  1ELW A;  1NL4 A;  3LY7 A;  1MX2 A;  4WND A;  4UQY A;  3AG3 E;  4WNE A;  4F6R D;  3PDN A;  4G26 A;  5ANL A;  4N3A A;  4HBD A;  1IYG A;  5ENN A;  2A5E A;  3CVW A;  3FEY A;  2PZI A;  4YND A;  3FWV A;  3FH5 A;  3IHY A;  2V0P A;  4BT9 A;  2EIK E;  1JPL A;  5HI7 A;  3JYS A;  3ZRH A;  1KT1 A;  5AAR A;  1OCC E;  2GRO B;  3CHP A;  1TJC A;  5ARF A;  5BXO A;  3JQ0 A;  4U8Y D;  4EZJ A;  5KNH D;  3PS6 A;  2YNQ A;  5LCW C;  4AVX A;  2WQH A;  5ARG A;  3HXD A;  3D3M A;  3PZD A;  4LSZ E;  1H6O A;  3AG2 E;  2PM6 A;  5JJ6 A;  3TWS A;  3E4B A;  3CK9 A;  2Y69 E;  3SZ7 A;  3TWV A;  4DX6 D;  3HDX A;  3FUM A;  2KCL A;  2KZT B;  3VLD A;  2JEK A;  3R9A B;  5CRV A;  5FZS A;  4O1P A;  3CKC A;  4ILH B;  3D9O A;  3X2Q E;  2FF4 A;  3CQG B;  3EIJ A;  4M7C A;  4G1T A;  5HKP A;  1N0Q A;  5EDS A;  1IKN D;  1YA0 A;  4MS6 A;  3C5R A;  1EF1 C;  3NOC D;  3MV2 B;  3UM2 A;  2XRY A;  2WXL A;  4CDR A;  4A55 A;  2LNI A;  4GCO A;  3I5P A;  2OOE A;  1OXJ A;  2XGO A;  2E0I A;  3NAW A;  1XNF A;  5ENQ D;  4ZFH A;  3UMV A;  3QB2 A;  1U3C A;  4O1O A;  4BY6 A;  3JXJ A;  5LFA A;  5BT1 A;  4Q94 A;  4WWP A;  3QK0 A;  4LUN U;  4EZL A;  4BTB A;  4MLP A;  2PQR A;  3CEQ A;  3ABK E;  2R59 A;  4KVO A;  2XS1 A;  2I6H A;  3CK8 A;  3DWL G;  3ASF A;  2IEJ A;  4EBA A;  3O48 A;  3CK7 A;  2M63 A;  2GRL A;  3UT7 A;  1TN6 A;  1FT1 A;  2VSO E;  3DXM G;  1S0P A;  3GZ1 A;  1G3N B;  3RK6 A;  4DX2 A;  3Q47 B;  2OEW A;  5EIB E;  1SW6 A;  3LCA A;  4WWO A;  3IBE A;  3UPV A;  3P1U A;  3ZIM A;  4A1S A;  3S2A A;  3VTY A;  4UQX A;  2AVP A;  5ANR A;  3E37 A;  4JB8 P;  3UM0 A;  3QWW A;  5T8I A;  3UM1 A;  2P9K G;  3U9W A;  3FUJ A;  3NZU A;  3QC1 A;  4GZD A;  4JA7 A;  5BV0 A;  4H7Y A;  3SFZ A;  4NAC A;  1Z6T A;  3ZUV B;  5CBN A;  3AG1 E;  4YDE A;  1GW6 A;  2WXR A;  4GTV A;  3MKQ A;  2FBN A;  1JCR A;  3TWR A;  3EDT B;  3JQ1 A;  3CHQ A;  1ZB1 A;  2J8S D;  3RO2 A;  4GYY A;  3HRA A;  1A17 A;  4TUM A;  1HS6 A;  4FC8 A;  2ZU6 B;  2QC9 A;  2WB2 A;  3LYA A;  3UUX A;  2V4H C;  3KEZ A;  3TXN A;  3KS2 A;  3TG5 A;  5D0O D;  2AXU A;  3RRU A;  1SA5 A;  4FA6 A;  3TWQ A;  2QFC A;  4NIK A;  4APF A;  1K3Z D;  2PNN A;  4F3V A;  1ELK A;  2BED A;  3FU0 A;  4CYM D;  1TR4 A;  4BSZ B;  3QJZ A;  1W3B A;  4ACK A;  2JAB A;  2IJG X;  2EIM E;  4CT4 A;  2QYJ A;  3LEW A;  5CCL A;  4PH4 B;  3S7J A;  2BKK B;  3FP3 A;  2BTD A;  5FQ4 A;  4ANV A;  1E8W A;  3APC A;  1TYQ G;  4LNB A;  4GZC A;  1BLX B;  5AIJ A;  3ENE A;  3AS5 A;  3R9M A;  1LTX A;  4XI9 A;  3TGO A;  3G2W A;  3FTV A;  3D9N A;  1BU9 A;  4DLQ A;  2XEH A;  1FT2 A;  1HG2 A;  4FJZ A;  4BET A;  3MEK A;  4G23 A;  2V5F A;  4URK A;  2WMO A;  2L6B A;  3CVQ A;  5BW8 C;  2KAT A;  5CBO A;  5BV1 A;  1TN7 A;  3ZEF A;  3D9H A;  3UX4 A;  3JCK C;  3UQ3 A;  4HFG A;  3QNK A;  2KM4 A;  5LOZ A;  3RIB A;  1S70 B;  2J4D A;  2P9P G;  4RLY A;  3TJP A;  3IEG A;  3NBN B;  3WXX A;  4Y6C A;  1H6P A;  5EX3 A;  1UOH A;  5G55 A;  4CEM A;  1JWF A;  3SI5 A;  3MV3 B;  1Y8M A;  3CST A;  1O1S A;  2WXP A;  5KWD A;  1N4S A;  3CQC B;  4KXK B;  5BUZ A;  4HXI A;  4LER A;  4J8S A;  4BT8 A;  4AXH A;  5KJK A;  2LAI A;  2LO6 A;  4HRM B;  4G25 A;  4KMO A;  2FUL A;  5ENP D;  4UQZ A;  4HB5 A;  3MGB A;  5G05 C;  3ABL E;  2H6I A;  5KNG A;  1RW2 A;  4OAU C;  3FU6 A;  5G05 J;  3P2B A;  2MHK A;  1U3D A;  2VJ8 A;  1X81 A;  3OAW A;  2WMN A;  2V5Q C;  4QQI A;  3GYZ A;  3SFX A;  4FP7 A;  5ENR D;  4PUC A;  3TWW A;  2P2C P;  3LVQ E;  5KBA A;  1P5Q A;  5FTP A;  2BUG A;  4TUU A;  4EEC A;  3L17 A;  4RVB A;  3LVR E;  4GZ5 A;  3SY2 A;  1MQS A;  1BI8 B;  4AJW A;  4Q69 A;  2PM7 A;  3QKY A;  3I4R B;  1EPU A;  5A7D B;  3UI2 A;  1OCO E;  1TNO A;  5CEA A;  4L23 A;  3APF A;  4EPZ A;  1OWN A;  5EID A;  4K03 A;  3TL5 A;  4U95 D;  1S63 A;  1E8X A;  1N52 A;  5AAO A;  1WG0 A;  1IHB A;  3MX3 A;  3KSQ A;  3D9K A;  4TXP A;  4KVM A;  1YMP A;  3IHV A;  1Y6I A;  3JUE A;  4BX9 A;  1JUQ A;  2CHX A;  2V8S E;  3Q15 A;  5BNW A;  2J07 A;  1NZN A;  2F0Y A;  3HVE A;  2AXZ A;  2P9I G;  3BG1 B;  1LD8 A;  5ENT D;  2GRN B;  3SHF A;  2J09 A;  4I1A A;  2BKG A;  2F8Y A;  4C0E A;  4UWK A;  3VTX A;  4TRQ A;  3TWT A;  1TEZ A;  4R7L A;  3CHO A;  2XS8 A;  5AEN A;  1WAO 1;  4FHJ A;  1QBQ A;  3PRE A;  3FU5 A;  4NRH B;  4UI9 K;  2VGX B;  3HYM B;  3BEE A;  4PS7 A;  4AY6 A;  3APD A;  3L13 A;  1SZ9 A;  1TJF A;  5G04 C;  2Y0B G;  3ONK A;  3DSX A;  2JLB A;  1MHQ A;  5KJM A;  3MA5 A;  3NQP A;  3EU9 A;  4B94 A;  5AYW D;  3ZGQ A;  2VSX E;  2VTB B;  1X5B A;  2GRR B;  4CCA A;  2EIJ E;  5AQ9 A;  3FUD A;  5AJL A;  3AU5 A;  3C3Q A;  1FPP A;  5EYL A;  4ABN A;  1HO8 A;  5LP0 A;  1HG5 A;  4U7E B;  3B7T A;  3PNL B;  3OXF A;  1E96 B;  4WAF A;  4U0U A;  3SBS A;  5KCM A;  1SZA A;  5D2M C;  4ILG A;  3AS4 A;  1RZ4 A;  2XCB A;  4JHJ A;  2XEV A;  3CGH A;  3UM3 A;  3L6A A;  3ASG A;  3G2V A;  4KYO B;  5FJY A;  4GYW A;  2WXQ A;  5G2N A;  5LCW J;  5KJL A;  2LXL A;  1WDY A;  4JVS A;  4I6E A;  4N5C A;  1IXV A;  4F1S A;  3U4T A;  4I9E A;  3L22 A;  2FO7 A;  1DC2 A;  4G8L A;  3KD7 A;  2BF0 X;  1FVH A;  4DI3 A;  2UY1 A;  1UN8 A;  3S7D A;  5JA4 D;  2YIN A;  3FUF A;  3ZHE A;  2IOL A;  3NZS A;  3DRA A;  4Y6W A;  4GTS A;  4I43 A;  5E76 A;  1K1A A;  3SGH A;  4WWN A;  4QFV A;  4UWH A;  3PH0 C;  3QOU A;  5CMW A;  3HXB A;  3ULQ A;  5KJN A;  3QAR A;  2R17 C;  4G8K A;  2WXG A;  2WXK A;  3U66 A;  3UKR G;  4NUR A;  5AQA A;  4K5B A;  3VLE A;  3HXE A;  3DSS A;  4U8H A;  3C3R A;  4EHM A;  4I6G A;  4AY5 A;  4V3I A;  1B89 A;  3GW4 A;  1OCZ E;  1PC2 A;  1H2U A;  4OVU A;  3B95 A;  3PZ1 A;  4ATZ D;  4ANW A;  2NXP A;  4GMJ A;  4A3V A;  4HVB A;  2QYU A;  4APO A;  2XHE A;  3RKV A;  1KPS B;  3PE4 A;  4J0U A;  3PZ2 A;  4A1G A;  3FUI A;  2KC7 A;  2C2L A;  3J5Q B;  2J4B A;  4KBQ A;  1U2V G;  3FEX A;  2VYI A;  3DSU A;  1KT0 A;  2LAH A;  3IXE A;  4AOF A;  4BES A;  1E7U A;  3ML8 A;  3MYV A;  2EIN E;  1HU3 A;  2OV8 A;  5JHA A;  1IQU A;  3D9J A;  4J8F A;  1QNF A;  3LKU A;  4JEH A;  2A5U A;  1OWM A;  4GA1 A;  4GTP A;  2J49 A;  4CRW A;  2WXF A;  5DBK A;  2I1J A;  4Z68 A;  1L5J A;  4GTM A;  1XGW A;  3J5P A;  2VGY A;  4N3B A;  1HFA A;  4DK5 A;  3ASN E;  2P9S G;  2X6I A;  5D66 A;  2CG2 A;  4LCT A;  2EIL E;  3Q9N C;  3LY9 A;  2CHW A;  4GU5 A;  2HYZ A;  4G11 A;  3QDN A;  5B3S E;  3NB2 A;  4JXT A;  2DYR E;  3LDZ A;  1E8Y A;  3FTS A;  2LSU A;  2Y1L E;  3UKU G;  2YQ8 A;  3QAQ A;  4L2L A;  4GTQ A;  3ULY A;  3W9G A;  2XPY A;  5AN8 A;  3V30 A;  1E8Z A;  2H6H A;  3TWU A;  1QQE A;  4C48 B;  5CMY A;  2YHE A;  1N4R A;  4HS2 A;  4CDN A;  5AQ7 A;  1BPO A;  2Y3A A;  4G2V A;  4J7W A;  2HO1 A;  1JWG A;  2I9C A;  4D10 C;  2I1K A;  1MJ0 A;  4I2Z A;  4TXQ A;  1Z3X A;  4RG6 A;  1D8E A;  2FEZ A;  3DSW A;  4RSY A;  2X6F A;  3FTZ A;  1N11 A;  5FZR A;  2MRI A;  4LEU A;  3CVU A;  2L6J A;  2XQ0 A;  4N3C A;  1H6K A;  4JD2 G;  2QY7 A;  4IYP A;  1LF8 A;  2ZIS A;  3PEU B;  4A3T A;  4M3O A;  1MX6 A;  4IN3 B;  3S7B A;  3PEV B;  5EIL A;  3FUH A;  4GAA A;  4DPR A;  3ASD A;  4JHK A;  3F6Q A;  3ASO E;  4A63 B;  3LY8 A;  1N4Q A;  4GA2 A;  2XPI A;  4GA0 A;  3KAE A;  3E34 A;  3ZVV A;  2DZN A;  1N94 A;  3L08 A;  2DBA A;  3LJ3 A;  1LD7 A;  4I6J A;  4U63 A;  1A5E A;  4E85 A;  2KCK A;  4HOQ A;  1KZO A;  2H6G A;  1O5M A;  4B0Z A;  3FY4 A;  4HOU A;  1MYO A;  4J8E A;  2B0O E;  4JC8 A;  2GGF A;  2P9U G;  3DPY A;  4HNA D;  2WQ7 A;  4DUI A;  3KEA A;  3ZYM A;  4GB9 A;  2E2E A;  2XGM A;  3Q78 A;  4JA9 A;  3SNX A;  3T5V A;  4OAV B;  2WXJ A;  3AS8 A;  4OVV A;  5JJ7 A;  3CHS A;  3ISM C;  2FO1 E;  4RQI A;  4CT0 A;  3HHM A;  4W9R A;  2OEV A;  2NSZ A;  4I17 A;  2L0I A;  2DVW A;  4K0R A;  3AU4 A;  5BXU A;  1E90 A;  2LUH A;  4BER A;  2KZT A;  2HM8 A;  1QZ2 A;  2J9Q A;  3JXI A;  3MKQ B;  3T9K A;  4AEZ C;  1WY6 A;  4BFR A;  4ACL A;  2ZGG A;  1UJJ A;  3UT4 A;  4LNU D;  2HE0 A;  4BX8 A;  2IFU A;  1EDU A;  3L54 A;  4TXR A;  3ZYL A;  3C72 A;  3MZL B;  4DX1 A;  3E32 A;  2X6J A;  3RU0 A;  3D9L A;  1OWL A;  3G2T A;  2B6C A;  1PY1 A;  2X6H A;  1IQR A;  2ZXW E;  4UI9 C;  1IHG A;  1AWC B;  3V79 K;  2DCP A;  2Q7F A;  3SFY A;  3OXG A;  1K1B A;  2IOS A;  1YYH A;  3CVY A;  2DWZ A;  4UI9 J;  5CRU A;  4GYO A;  4U96 D;  2XZD G;  4C9B B;  5AQB A;  5ENS D;  3CLJ A;  5FIO A;  1ZBP A;  4N39 A;  1NA3 A;  4GMR A;  3Q9U C;  3EU5 A;  1DCE A;  3AG4 E;  1VDY A;  2GRM A;  3HXC A;  3SBT B;  2X3M A;  1PAQ A;  2VSN A;  1OWO A;  2C0M A;  5DIZ A;  4BTA A;  3TG4 A;  2WXO A;  5EN5 D;  1DNP A;  4YVO A;  2XPZ A;  1N9A A;  4ATG A;  3I4G A;  4H7X A;  3W9F A;  3ZXS A;  4F53 A;  4FU3 A;  4LG6 A;  3ZNG A;  2MYO A;  4JW1 A;  1SQM A;  3ZYK A;  2LSV A;  2RFA A;  1OWP A;  2IU1 A;  3UT8 A;  1TNY A;  3TAX A;  4F7A A;  3PVL A;  3PNT B;  1N95 A;  3PZ3 A;  4U0S A;  4U8V D;  1OCR E;  3ZU7 B;  3RAU A;  4GTO A;  3FDH A;  3BU8 A;  1HX8 A;  3O4Z A;  4CDM A; 
#chains in the Genus database with same CATH homology
 3VLE A;  3CR3 A;  4APF A;  3B7R L;  4U8H A;  3RRN B;  4F3V A;  1ELK A;  3FU0 A;  3L16 A;  5G04 J;  4I6G A;  5BPP A;  2A4Z A;  4AY5 A;  3QJZ A;  1W3B A;  4ACK A;  1ZU2 A;  3G2U A;  2IJG X;  4CT4 A;  4V3I A;  3ONL A;  4EBA G;  1B89 A;  4RG9 A;  3FUN A;  3GW4 A;  1PC2 A;  3LEW A;  1H2U A;  4OVU A;  3G2S A;  4UWG A;  5CCL A;  3IV0 A;  4PH4 B;  2OVB A;  3S7J A;  5FZQ A;  2I2O A;  3PRZ A;  3CIA A;  3VLF A;  4ANW A;  3FP3 A;  4NQ0 A;  2BTD A;  2NXP A;  4GMJ A;  4A3V A;  5FQ4 A;  4DI4 A;  2WXM A;  1UG3 A;  4ANV A;  4HVB A;  1E8W A;  5A6C A;  4APO A;  3APC A;  2XHE A;  4GZC A;  3FHE A;  3FTU A;  4XI0 A;  3RKV A;  3PE4 A;  4J0U A;  4A1G A;  5AIJ A;  1NA0 A;  2C2L A;  2KC7 A;  3FUI A;  5J08 A;  2P58 C;  3ENE A;  3AS5 A;  2J4B A;  4KBQ A;  3FEX A;  2VYI A;  3URZ A;  1KT0 A;  1Z3Y A;  4B89 A;  2LAH A;  3CSF A;  4EQF A;  3JUI A;  1NP7 A;  4AOF A;  4XI9 A;  1E7U A;  4OYS A;  3FH7 A;  3TGO A;  3G2W A;  3FTV A;  3ML8 A;  3ZW3 A;  3FUL A;  3D9N A;  3FUK A;  3MYV A;  4O6F A;  5D0Q D;  4DLQ A;  3SF4 A;  5A23 A;  1HG2 A;  3DBS A;  2FI7 A;  1HU3 A;  2J08 A;  2OND A;  2OV8 A;  3QWP A;  4FJZ A;  4HLE A;  5CCM A;  1HF8 A;  3MEK A;  5JHA A;  4G23 A;  1IQU A;  3D9J A;  2V5F A;  1QNF A;  4I1M A;  3LKU A;  4J8F A;  4JEH A;  2A5U A;  5JHB A;  2ION A;  2KCV A;  4URK A;  1OWM A;  2WMO A;  4GA1 A;  4DLO A;  3CVQ A;  2J49 A;  4GZ3 A;  1N54 A;  5M72 A;  5BW8 C;  4CRW A;  4I2W A;  4G24 A;  4MRU A;  2KAT A;  2WXF A;  5DBK A;  2I1J A;  5BV1 A;  3ESK A;  3B13 A;  2WVI A;  2CFZ A;  4YVQ C;  2NC9 A;  3FTW A;  3ZEF A;  1L5J A;  2C0L A;  3UX4 A;  3JCK C;  1XGW A;  5AJD A;  3T5X A;  3UQ3 A;  1HH8 A;  1HE8 A;  4HFG A;  3FTY A;  3QNK A;  4KZC A;  2VGY A;  4N3B A;  4PDX A;  3GZS A;  2KM4 A;  4JZY A;  5LOZ A;  3RIB A;  4E6H A;  4WNF A;  1HFA A;  1H2V C;  4L7T A;  4DK5 A;  2X6I A;  2CG2 A;  4LCT A;  2J4D A;  3PUJ A;  3TJP A;  1HXI A;  3ASH A;  3LY9 A;  3HIZ A;  4B8A A;  3IEG A;  5CHE E;  3WXX A;  3LPZ A;  4Y6C A;  2CHW A;  1H2T C;  3OXL A;  4FJY A;  4GU5 A;  2HYZ A;  4XX5 A;  5EX3 A;  3BG0 B;  5E75 A;  4G11 A;  3CVL A;  3EHM A;  3N71 A;  3FH8 A;  3QDN A;  1JWF A;  5G55 A;  3SI5 A;  4CEM A;  1HZ4 A;  3ESL A;  3MV3 B;  3Q5M A;  1Y8M A;  3RJV A;  3LS8 A;  4JXT A;  3CHM A;  3DPD A;  5EX0 A;  2WXH A;  3PE3 A;  3R7R A;  3CST A;  3LDZ A;  3ZFW A;  1E8Y A;  3FTS A;  2LSU A;  2WXP A;  5FQ6 A;  4BSX A;  2YQ8 A;  3CVP A;  3QAQ A;  1UN9 A;  4KT6 B;  4L2L A;  3CQC B;  4KXK B;  3CKB A;  4JEU A;  5C2Y A;  3QWV A;  2XPY A;  3Q49 B;  4PS3 A;  1EYH A;  4FLH A;  4GCN A;  3C98 A;  1E8Z A;  2Y4U A;  4HXI A;  4LER A;  5FT9 A;  5BUZ A;  5FQ8 A;  3U3W A;  4IRU A;  4J8S A;  1UW4 B;  4J6I A;  4L2Y A;  4AXH A;  4BT8 A;  5KJK A;  1QQE A;  1WM5 A;  2L9B A;  2LAI A;  2ILR A;  2LO6 A;  2V4L A;  2WPV A;  4KZ0 A;  5CMY A;  2YHE A;  4I1O B;  3FFL A;  4G25 A;  4KMO A;  2FUL A;  3OTN A;  3MKR A;  3FUE A;  4HS2 A;  4UQZ A;  4CDN A;  4IUL A;  1BPO A;  2VSY A;  4C0M A;  3MGB A;  3PUK A;  2Y3A A;  4G2V A;  5G05 C;  2CHZ A;  4HOS A;  2HO1 A;  3SD5 A;  1JWG A;  1KLX A;  2DIW A;  3EIQ C;  4GPK A;  2I9C A;  3FU6 A;  4D10 C;  2I1K A;  4AM9 A;  3CV0 A;  4XIF A;  1ELW A;  3LY7 A;  4U04 A;  4I2Z A;  5G05 J;  3P2B A;  4WND A;  3T8M A;  1Z3X A;  4RG6 A;  4UQY A;  2MHK A;  4WNE A;  2FEZ A;  2UWJ G;  2XGS A;  2X6F A;  3FTZ A;  1U3D A;  4RSY A;  5FZR A;  2VJ8 A;  3PDN A;  4G26 A;  2MRI A;  3IKO B;  3OAW A;  5ANL A;  3ZPJ A;  2WMN A;  4N3A A;  4HOT A;  1IYG A;  3GYZ A;  4FP7 A;  3HVE B;  4LEU A;  3NF1 A;  4PS8 A;  3CVU A;  4PUC A;  2L6J A;  5ENN A;  4CGW A;  2XQ0 A;  3LVQ E;  4N3C A;  3FEY A;  3CVW A;  2PZI A;  1H6K A;  4YND A;  2AWI A;  2QY7 A;  3RO3 A;  1P5Q A;  3FWV A;  5FTP A;  2BUG A;  3FH5 A;  4IYP A;  4WNG A;  3IHY A;  2V0P A;  4TUU A;  4EEC A;  3RRM B;  1LF8 A;  3L17 A;  4BT9 A;  4RVB A;  3LVR E;  3PEU B;  4A3T A;  2HR2 A;  1JPL A;  5HI7 A;  4M3O A;  3JYS A;  4GZ5 A;  1MQS A;  3ZRH A;  4AJW A;  1KT1 A;  4IN3 B;  3S7B A;  3FTX A;  2EQX A;  1TJC A;  3CHP A;  3PEV B;  5ARF A;  2CG3 A;  5FQ7 A;  3FUH A;  3JQ0 A;  4GAA A;  2XCC A;  4DPR A;  4FUL A;  3ASD A;  4JHK A;  4EZJ A;  4Q69 A;  3PS6 A;  2PM7 A;  3LY8 A;  2YNQ A;  5LCW C;  3QKY A;  4GA2 A;  4AVX A;  2XPI A;  4GA0 A;  2AW6 A;  2WQH A;  1EPU A;  3I4R B;  3KAE A;  5A7D B;  5ARG A;  4UWF A;  3ZVV A;  1ELR A;  3D3M A;  3PZD A;  2AXV A;  3D9P A;  2WXI A;  3L08 A;  3APF A;  2DBA A;  3LJ3 A;  4I6J A;  4L23 A;  2PM6 A;  4U63 A;  4EPZ A;  5JJ6 A;  1OWN A;  3E4B A;  3CK9 A;  4K03 A;  3TL5 A;  3SZ7 A;  4E85 A;  2KCK A;  1E8X A;  2RG8 A;  1N52 A;  4AIF A;  2OVF A;  4HOQ A;  3HDX A;  3FUM A;  3MX3 A;  2KCL A;  2KZT B;  3D9K A;  3VLD A;  4KVM A;  5JJT A;  3IHV A;  1H0A A;  4XKB A;  2JEK A;  4L1B A;  4B0Z A;  4DJA A;  3FY4 A;  3R9A B;  1Y6I A;  4HOU A;  5FZS A;  4J8E A;  4ANX A;  3CKC A;  4ILH B;  1JUQ A;  4BX9 A;  2V8S E;  2CHX A;  4JC8 A;  3Q15 A;  2PL2 A;  3D9O A;  5BNW A;  2J07 A;  2WXN A;  2FF4 A;  3CHR A;  3LXU X;  4U0Z A;  1NZN A;  2GGF A;  3CQG B;  3EIJ A;  3HVE A;  2AXZ A;  3B7S A;  3BG1 B;  1E7V A;  2IF4 A;  4G1T A;  2WQ7 A;  3SHF A;  2J09 A;  5EDS A;  4I1A A;  5T3R A;  4AP2 A;  1YA0 A;  3ZYM A;  4MS6 A;  4GB9 A;  2RD0 A;  4UWK A;  4C0E A;  2IQC A;  3VTX A;  3MCX A;  4TRQ A;  1EF1 C;  1TEZ A;  2E2E A;  4R7L A;  3CHO A;  3MV2 B;  2XGM A;  2XRY A;  2WXL A;  4I9C A;  4JA9 A;  4CDR A;  5C1D A;  1DVP A;  4A55 A;  5AEN A;  3SNX A;  5EKQ D;  1WAO 1;  2LNI A;  4GCO A;  4N2S A;  3T5V A;  4FHJ A;  3I5P A;  2OOE A;  3PRE A;  2XGO A;  1OUV A;  4JPS A;  4LRZ A;  5LX8 A;  2E0I A;  3FU5 A;  2WXJ A;  4NRH B;  1XNF A;  4UI9 K;  3UMV A;  3AS8 A;  3QB2 A;  1U3C A;  4OVV A;  2VGX B;  3HYM B;  5JJ7 A;  3BEE A;  3CHS A;  4PS7 A;  4BY6 A;  5LFA A;  5BT1 A;  5HQ8 A;  4Q94 A;  4AY6 A;  3APD A;  4WWP A;  3L13 A;  1SZ9 A;  4CT0 A;  1TJF A;  5G04 C;  4FAD A;  1FCH A;  3QK0 A;  4LUN U;  4EZL A;  3EHN A;  2L0T B;  3ONK A;  3HHM A;  4W9R A;  4BTB A;  2JLB A;  1MHQ A;  4MLP A;  2NSZ A;  4XZ4 A;  2PQR A;  4I17 A;  2L0I A;  5KJM A;  4K0R A;  3MA5 A;  3CEQ A;  3NQP A;  1FVF A;  3AU4 A;  3Q4A B;  1E90 A;  4B94 A;  5AYW D;  2R59 A;  4KVO A;  3ZGQ A;  4MKT A;  2VSX E;  4FHK A;  2VTB B;  4J8D A;  4UWL A;  2I6H A;  1X5B A;  2KZT A;  3B7U X;  3CK8 A;  4WUY A;  2HM8 A;  1QZ2 A;  2J9Q A;  2UY1 B;  3ASF A;  4CCA A;  4U07 A;  2PQN A;  4EBA A;  3MKQ B;  4AEZ C;  5J90 A;  1WY6 A;  3FUD A;  4B8C B;  4BFR A;  3O48 A;  4N2Q A;  3CK7 A;  3ML9 A;  3ZHE B;  4ACL A;  5AJL A;  4AV7 A;  2M63 A;  2GRL A;  3AU5 A;  3D9M A;  3UT7 A;  1UJJ A;  3UT4 A;  4ABN A;  4BX8 A;  1HO8 A;  1EDU A;  2IFU A;  3L54 A;  3ZYL A;  4ANU A;  2CFU A;  3MZL B;  5LP0 A;  1HG5 A;  2X6J A;  2VSO E;  3FU3 A;  4GZ6 A;  3B7T A;  3PNL B;  3OXF A;  3RU0 A;  3CVX A;  3D9L A;  2VQ2 A;  1E96 B;  1OWL A;  3G2T A;  1S0P A;  3GZ1 A;  4JL0 A;  4XKC A;  3RK6 A;  4CGV A;  1PY1 A;  4WAF A;  2X6H A;  3Q47 B;  4U0U A;  3SBS A;  2X6K A;  1IQR A;  3LCA A;  4UI9 C;  3MJW A;  4WWO A;  5KCM A;  2WQ6 A;  3CVV A;  1IHG A;  1SZA A;  3R7Q A;  1UJK A;  2DCP A;  4ILG A;  3AS4 A;  3IBE A;  3UPV A;  2WM9 A;  2Q7F A;  3P1U A;  3ZIM A;  4TV3 A;  2XCB A;  3OXG A;  4JHJ A;  2XEV A;  3CGH A;  3K9I A;  3S2A A;  3L6A A;  4A1S A;  3ASG A;  2IOS A;  3VTY A;  4ILI A;  3CVY A;  3G2V A;  4KYO B;  4UI9 J;  2VGX A;  4JHR A;  5FJY A;  4GYW A;  2WXQ A;  4GYO A;  5G2N A;  4UQX A;  3S7F A;  4C9B B;  5KJL A;  5LCW J;  4HOR A;  2AVP A;  3CLJ A;  5ANR A;  4JVS A;  3QWW A;  4I6E A;  1ZBP A;  4N39 A;  1NA3 A;  4N5C A;  5T8I A;  2R5S A;  1VDY A;  3U9W A;  4F1S A;  2GRM A;  4XE0 A;  3U4T A;  3FUJ A;  3NZU A;  3QC1 A;  4I9E A;  3L22 A;  2FO7 A;  3D9I A;  3SBT B;  2X3M A;  4GZD A;  4JA7 A;  1PAQ A;  2VSN A;  5BV0 A;  1OWO A;  2C0M A;  3KD7 A;  4H7Y A;  3SFZ A;  2VTB A;  2BF0 X;  1FVH A;  4NAC A;  4DI3 A;  5DIZ A;  1Z6T A;  1UN8 A;  2UY1 A;  3S7D A;  2Y4T A;  3TG4 A;  4BTA A;  2WXO A;  1GW6 A;  2WXR A;  1DNP A;  3MKQ A;  2FBN A;  2X38 A;  2YIN A;  3FUF A;  4YVO A;  2XPZ A;  4GML A;  2IOL A;  3EDT B;  3ZHE A;  3ZYQ A;  1H19 A;  3JQ1 A;  4ATG A;  3NZS A;  3I4G A;  3CHQ A;  4H7X A;  4Y6W A;  4ME2 A;  4I43 A;  3RO2 A;  5E76 A;  3ZXS A;  3SGH A;  4WWN A;  4F53 A;  4FU3 A;  4QFV A;  2XRZ A;  2GW1 A;  3CVN A;  4GYY A;  4UWH A;  4JW1 A;  3PH0 C;  1INZ A;  1A17 A;  3QOU A;  1SQM A;  3ZYK A;  5CMW A;  2LSV A;  1HS6 A;  4FC8 A;  2ZU6 B;  3ULQ A;  4Q96 A;  5FWQ A;  2YHC A;  2WB2 A;  1OWP A;  2IU1 A;  3UT8 A;  4F7A A;  3TAX A;  3LYA A;  3GZ2 A;  3UUX A;  5KJN A;  3QAR A;  5T4Y A;  2R17 C;  3PVL A;  3KEZ A;  3EJN A;  3ZN3 A;  4EZK A;  3PNT B;  4FLB A;  3TXN A;  2WXG A;  3KS2 A;  4P29 A;  4U0S A;  2WXK A;  3TXM A;  3U66 A;  2MOW A;  4BWR A;  3TG5 A;  5D0O D;  2AXU A;  4NUR A;  3RRU A;  3I3N A;  3FDH A;  3U64 A;  1HX8 A;  3O4Z A;  4FA6 A;  2QFC A;  4CDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...