2ILRA

Crystal structure of human fanconi anemia protein e c-terminal domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
261
structure length
249
Chain Sequence
AESLELPKAIQDQLPRLQQLLKTLEEAPPVELQLLHECSPSQMDLLCAQLQLPQLSDLGLLRLCTWLLALSPDLSLSNATVLTRSLFLGRILSLTSSASRLLTTALTSFAAKYTYPVCSALLDPVLQAPGTGPAQTELLCCLVKMESLEPDAQVLMLGQILELPWKEETFLVLQSLLERQVEMTPEKFSVLMEKLCKTTSMAYAKLMLTVMTKYQANITETQRLGLAMALEPNTTFLRKSLKAALKHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oncoprotein
molecule keywords Fanconi anemia group E protein
publication title Insights into Fanconi Anaemia from the structure of human FANCE
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 249
sequence length 261
ec nomenclature
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11510 FA_FANCE Fanconi Anaemia group E protein FANCE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.480 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ilrA00
2ILRA
chains in the Genus database with same CATH superfamily
2VTBB 3D3MA 3ABKE 2L0TB 4WWOA 3D9LA 2GROB 5G05J 2J07A 3C5RA 2GW1A 1N54A 3LEWA 4I6GA 3HYMB 1HZ4A 2ZGDA 5LP0A 1U3DA 2XCCA 2KCVA 4BSZB 2XHEA 2HM8A 2OOEA 4GTVA 5C1DA 5FIOA 3I4GA 3B7BA 3ESKA 2C0MA 3UTMA 3SY2A 2UWJG 3RRUA 2AVPA 5EKQD 2GRMA 4BWRA 4GA2A 5BW8C 3MKRA 2DWZA 4GA1A 1LF8A 4UUCA 3NQPA 1OY3D 4X8QA 3UT4A 3JUEA 4J8SA 4GTMA 1BI8B 4XE0A 4GZ5A 2RG8A 3BG1B 3CKCA 3RK6A 3FUHA 1FPPA 3ONLA 3ZVVA 3LS8A 2FO7A 2XGMA 4LCTA 2FEZA 1HS6A 1D9SA 2GRLA 3D9NA 3O48A 2F0YA 2H6FA 2LXMA 5EX0A 3IEGA 4GZDA 4CCAA 5FTPA 2GGFA 3TXMA 3ZYLA 1Z3YA 1D8EA 2VGYA 2R5SA 4GU5A 2KM4A 3QARA 5G2NA 4GAAA 2LSVA 4HORA 1H6OA 5CEAA 4TXPA 5IY5E 1Z3XA 4J0UA 3L54A 3LY9A 5KBAA 1BU9A 1EYHA 2AW6A 2WXHA 4FHJA 5HS0A 4APOA 4G26A 4C0MA 2P9LG 1OCOE 3HXEA 4K5AB 2V8SE 1IKND 4HFGA 2VJ8A 2P9PG 4LG6A 5C2YA 1D8DA 4B8CB 3PNLB 2VGEA 4JXTA 2ZIRA 4F3VA 3J5QB 4YDOA 2VYIA 4BFRA 3G2VA 5BNWA 4WUYA 5DIZA 2P9IG 2IQCA 2WXNA 4M7CA 4F1SA 2IJGX 1E7UA 3EIJA 1E8ZA 5J08A 1Y6IA 5EX3A 4G8LA 1SA4A 1XGWA 3HHMA 4A1GA 3HXCA 2EQXA 5ITZF 3CIAA 3EUVA 5CHEE 4HVBA 1N95A 3VLFA 2H6IA 1H6KA 2FBNA 3MV2B 5EIDA 3ZN3A 2LSUA 4G25A 5FZQA 3VTXA 1TNZA 4WNDA 2NSZA 3ZGQA 1K3ZD 1KLXA 2I6HA 1TEZA 4JW1A 3DSWA 3FTUA 3FU3A 5CMWA 4N5CA 3DSSA 2VSOE 1YA0A 5BV1A 4TUUA 3X2QE 4GYOA 4HQDA 2ILRA 1TNUA 2KXPC 2IONA 3APFA 3NB2A 4DX5D 5AARA 2LO6A 5A6CA 2NC9A 3D9OA 3ZXPA 4XIFA 2F37A 1L5JA 4GTSA 3FWVA 3B7UX 5BUZA 3IV0A 4FLHA 4A3VA 1MHQA 2OVFA 4O60A 3U64A 4ABNA 3CVXA 4U04A 1V54E 5J90A 4JA7A 5ANRA 2P9SG 2L0IA 3MEKA 3DSVA 3AS5A 5BV0A 3FH5A 2R02A 2XPZA 4B8AA 1NA3A 3V79K 3MV3B 4JD2G 1H2UA 2E0IA 2B6CA 3S7DA 4JPSA 1K1BA 2ETAA 4F7AA 3DPDA 3FTWA 4DRXE 2HE0A 3VLEA 4JVSA 3SBTB 2LXLA 2NYJA 2WXQA 5A23A 5HQ8A 3URZA 4F6RD 3C3OA 2X38A 5T8IA 1LD7A 4CYMD 1DVPA 3K9IA 1ELWA 4RSYA 2PM6A 3ZXSA 2IO3C 3QDNA 4TRQA 4WNGA 4ACKA 3E30A 1ELRA 1IHGA 4CDRA 4FP7A 3T9KA 1SW6A 1N9AA 5CEDB 5LOZA 2EIJE 3T5VA 1Z6TA 1Y8MA 3DEOA 2WB2A 3ZUVB 2LAHA 4HI9A 3QNKA 3OXLA 3ASNE 1PY1A 1G3NB 3UI2A 2UY1A 2DVWA 2WXKA 2HYZA 4CGWA 2I2OA 4GCNA 4ANVA 4CEMA 5AN8A 4IN3B 4U8YD 1EF1C 2I9CA 5AENA 1A17A 5ENPD 1PC2A 4NACA 3AS8A 4A55A 4NURA 2DYRE 4KZ0A 3EHRA 5CRUA 2C2LA 5AQAA 5M72A 2DZNA 4RLYA 2PM7A 3SF4A 5JMND 3JXJA 4Y6WA 3Q15A 2XGOA 3SNXA 3TG4A 3TGOA 3DXKG 3EHQA 3S7FA 1LTXA 3S7BA 3TJPA 4C48B 4WWPA 3V2XA 3L08A 3ML9A 3D9JA 3E33A 2X3MA 4J8DA 4N3BA 5D0OD 3SGHA 1HG2A 1OXJA 3SD5A 4JB8P 4DUIA 3RO3A 5E76A 1BD8A 2MHKA 2R2LA 3HG0D 4GCOA 3ZEFA 3CHPA 2BKKB 3N71A 1E96B 3NBNB 1B89A 4BTAA 2HO1A 1YMPA 2CFUA 3CR3A 4HI8A 4JC8A 4LNUD 4IYPA 4U96D 4UI9C 4JEUA 4UQYA 3PZ3A 4BSXA 5EIBE 1H6PA 4O6FA 4AY6A 3FHEA 3G2TA 4KZCA 4J8YA 2XGSA 3IHYA 5HKPA 3UINC 2X6IA 4UWFA 2VQ2A 3W9GA 3MGBA 5LCWJ 4CGVA 3HXFA 1IXVA 2R17C 3DXMG 4HRLA 4TV3A 4GYYA 4R7LA 1JUQA 3DEPA 1OWLA 3CVNA 2P9NG 3PS6A 4UI9K 3MKQB 2H6HA 3UT8A 2Y4UA 3LCAA 3HRAA 4UWLA 3PEUB 4EZKA 3SBSA 5JA4D 4N5QA 2B0OE 4XKBA 3KD7A 5CECB 1OCRE 4I6EA 1S63A 1PAQA 3CVPA 3T8MA 3AS4A 1KT0A 3LJ3A 1N4QA 4XI0A 4I1AA 2QYUA 4B93B 3S2AA 3LJNA 3Q79A 4CRWA 3RSEG 3PZDA 3DPYA 4KXKB 3CGHA 2LUHA 2RFAA 5A7DB 3HVEB 1E8YA 3E4BA 4N3AA 4I1MA 2OVBA 3CK8A 2BKGA 4UQZA 4AIFA 4N2QA 4DK5A 1E90A 4H7XA 5ENRD 3LVRE 3FUKA 4F53A 5G55A 4FLBA 4KT6B 4LSZE 3GYZA 3PNTB 3FULA 3KS2A 4KYOB 1N4SA 2WPVA 2R03A 3UXGA 2DIWA 3U4TA 1WY6A 5FQ6A 1HE8A 1XNFA 1V55E 4I1OB 4A3TA 4IRUA 2OEWA 1ELKA 5H7PA 5B1AE 4BEPA 4GYWA 1HO8A 3SO8A 4AOFA 5FWQA 3ASGA 4A1SA 5FQ8A 1LD8A 1QZ2A 3WG7E 3SI5A 4AV7A 3QOUA 3WXXA 1KT1A 4ZFHA 5FQ7A 4GZCA 3JQ1A 2XZDG 2YHCA 3EU9A 5D66A 4DX6D 3C98A 5CBNA 4PS8A 4K0RA 3ZRHA 3FH8A 3HXBA 1S70B 1QYMA 4ATZD 4J6IA 3RU0A 5T3RA 1H2TC 2J08A 3AAAC 5AQ9A 2QFCA 2DCPA 4K03A 2A4ZA 4DJAA 3MX3A 4ME2A 4N39A 3Q5MA 2WXPA 4GTOA 5ENSD 3ZPJA 3BEEA 3FUEA 2RFMA 2MRIA 3CQGB 2PQRA 2V4LA 2XS1A 4K5BA 1WG0A 3NZSA 3Q9UC 4FHKA 4G1TA 1HU3A 4B94A 4HRMB 4ANXA 1ZU2A 3JXIA 2J09A 3GZ2A 1IQRA 3AG3E 4PS3A 3U66A 2Y3AA 3EJNA 2VGXA 4APFA 5BXOA 1Z5SC 4MS6A 5KJNA 3TWUA 2R05A 5CCLA 4GPKA 3QWPA 4UQXA 2RD0A 4G11A 3CSFA 3ABME 3MZLB 2AWIA 3U3WA 3RO2A 4BY6A 3FY4A 4KMOA 2ZGGA 1OWNA 4Q94A 2IO2C 5CRVA 2KBXA 3Q4AB 4HBDA 3LDZA 1FT2A 4Z68A 2JLBA 3TWRA 1N11A 2KCKA 5ARGA 2KZTA 3JYSA 3ENEA 1IQUA 4XX5A 3SQVA 2OCCE 2IOSA 3ASHA 3ZYKA 3FUJA 5EILA 5EYLA 3MA5A 4AXHA 4HOQA 4B89A 3DBSA 3IBEA 5AAOA 4U8HA 4HOUA 3ABLE 4NRHB 1UG3A 1NL4A 3UT7A 1UN8A 5EDSA 4HOTA 1X5BA 1N52A 1WDYA 3NAWA 3LPZA 4FADA 1K1AA 4ATGA 3TWTA 4P29A 3D9KA 2FULA 3HXDA 3PUKA 4LNBA 2OV8A 4BTBA 1O1TA 2QYJA 3AG1E 3OAWA 1FVFA 4CT0A 2XS8A 5ENOD 3B7TA 2X6HA 2J8SD 3P2BA 1TJFA 2XPIA 4K5CA 4PUCA 4U0SA 3DSUA 2YQ8A 3CVVA 1X81A 1AWCB 3UIPC 4OVVA 3FEYA 4UWKA 5HI7A 2YINA 3E37A 4QQIA 2V0PA 5BT1A 3EIQC 4Q69A 2FI7A 4I2ZA 4YDYA 4DLOA 1DCQA 3FUIA 3CVUA 3CHQA 4N3CA 5JJ6A 3OXGA 3FU6A 5HRYA 5KJLA 4M3OA 2QC9A 2XCBA 4EZJA 2WXJA 2WQ6A 2BUGA 3I3NA 4YVOA 3PRZA 4XI9A 3ML8A 3MCXA 4GMLA 1UJJA 3LKUA 1FT1A 3HIZA 4DLQA 1YCSB 3CEQA 1OCCE 2AXVA 3FTZA 4TXQA 1NFIE 3UIOC 2V5FA 3Q49B 2XRZA 4AP2A 1SZ9A 4KBQA 2WQHA 1BPOA 2GRRB 5FZRA 3O4ZA 5CCMA 3BQOA 3CVWA 3PZ4A 4KVMA 4O1PA 3UQ3A 2VSNA 3E34A 4FU3A 1MX4A 4XEIG 4ANWA 4ANUA 4G23A 2QZAA 2DBAA 2CHXA 4U0UA 3CHOA 3BU8A 4E85A 1MZCA 3LY8A 5AIJA 3CVLA 2J4BA 2I1KA 3GZ1A 2P2CP 3PE4A 2V5QC 3ZW3A 5KCMA 4U95D 1HF8A 3UM2A 4XZ4A 4DX2A 3NZUA 4I9EA 1SA5A 2QY7A 4FULA 3FU5A 4WAFA 3C3RA 2R59A 1OWPA 2CG2A 4GPMA 3JQ0A 5ENTD 3VTYA 5D0QD 3I4RB 4F1PA 3QWWA 2KC7A 2ZU6B 3UX4A 4CZ2D 1E7VA 1TN7A 1QQEA 3QKYA 2ONDA 2PZIA 4CDNA 3L17A 3EHNA 3G2WA 4JHRA 1HXIA 4MRUA 3L13A 3IXEA 3E32A 3GW4A 3G2SA 3Q9NC 5G04C 1HX8A 3PZ1A 4CT4A 4NIKA 4NQ0A 2Y4TA 4JEHA 2WXLA 4HXIA 3APDA 3UMVA 4BESA 4ILGA 1TYQG 1QBQA 3J5PA 4C9BB 3FUNA 2YNQA 4YDEA 5KWDA 2L6JA 5ANLA 3RAUA 4U0ZA 4OYSA 3RRMB 2I1JA 2A5UA 1WAO1 3LY7A 3OTNA 2KCLA 1JCQA 4TXRA 3V30A 4AM9A 5ARFA 4JHJA 4GTQA 3UM1A 2EIKE 2VGXB 1OWMA 3EHMA 3FUFA 4PS7A 4L7TA 3PE3A 3RRNB 4BT9A 2AJAA 5ENNA 2PL2A 4MKTA 3ISMC 2VSYA 1NZNA 3UKUG 3PDNA 4ILHB 3S7JA 3PZ2A 3ZHEA 2F8YA 1H19A 3L9TA 3UM0A 4ZHBA 3SFYA 3T5XA 5AYWD 3FTSA 2CFZA 4CDMA 5LX8A 4LNGA 1TN6A 2X6JA 3AU5A 2YHEA 1VDYA 3MJWA 1NI1A 1U3CA 3ULQA 1DC2A 4JHKA 2KZTB 2ETBA 3DSXA 3EU5A 2VSXE 4JA9A 3V2OA 4GMJA 5KNGA 2BEDA 2IEJA 3NOCD 4J8FA 3PREA 4G24A 4WWNA 4EQFA 1RZ4A 1SZAA 2XENA 3BUAA 2CHWA 3Q78A 1HG5A 4I17A 3PEVB 3D9MA 1TJCA 2V4HC 3Q7AA 1ZB1A 2Y0BG 4L1BA 1MJ0A 3R7RA 2XPYA 2GRNB 4EBAA 3SZ7A 3UM3A 3TWXA 1UW4B 5EN5D 3TWVA 4BX9A 1BLXB 2XEHA 3Q73A 2IU1A 3NF1A 2WMOA 4L2YA 5FINA 3CLJA 1DNPA 4LRZA 4FA6A 3MYVA 4FC8A 3TAXA 3R9MA 1NA0A 4AY5A 2BTDA 3FTVA 3W9FA 5JJTA 4MLPA 4D10C 5DBKA 3EDTB 3ASFA 4C0EA 4H7YA 1N0RA 1MYOA 3TL5A 4V3IA 3L82A 3Q7FA 3UUXA 1IYGA 2BF0X 4OAVB 2P58C 4JZYA 5LCWC 1HFAA 4JL0A 3QK0A 3V31A 1P5QA 3SHFA 4LEUA 1ZBPA 4U7EB 3ONKA 1N94A 1U2VG 3AJIA 2KATA 4RQIA 3TWSA 2CHZA 2WXIA 3FP3A 4HLEA 4DX1A 1E8WA 1JCRA 2AXZA 1H2VC 2WXOA 5G05C 3CVQA 1SQMA 2MYOA 3KAEA 4HS2A 4OVUA 3BG0B 3CV0A 3JCKC 4AJWA 3KSQA 2IF4A 3CHMA 3MKQA 5FJYA 4W9RA 3RJVA 2UY1B 2Y1LE 1A5EA 3UKRG 3IHVA 2IFUA 1S64A 3P1UA 3NOGD 1O5MA 5FZSA 4AVXA 3KSLA 4DPRA 2VTBA 3TXNA 4BT8A 3F6QA 3APCA 1Q2ZA 5AJDA 2JABA 1EPUA 4YVQC 4LERA 5T4YA 4ILIA 5EYPF 1N4RA 2LNIA 4J8EA 4PDXA 4J7WA 3D9PA 3ULEG 4I6JA 2GRPB 3HDXA 2IY0C 1W3BA 2XQ0A 3I5PA 3FEXA 1H0AA 1JWFA 2EIME 1MX6A 3B95A 2EINE 2WXRA 3HVEA 3ULYA 4EECA 4GZ6A 1JPLA 3DSTA 5AQ7A 1SVXA 1JWGA 3ZYQA 3D9HA 2DYSE 4WNEA 2P9KG 5CBOA 4XKCA 5E75A 1TNYA 3FUMA 4B0ZA 3TWWA 2PQNA 3ESLA 1UJKA 3QC1A 1OCZE 4UWGA 4HB5A 3OXFA 3ZNGA 3PVLA 4BETA 5FT9A 3B7RL 2LAIA 4MBGA 2J49A 5B3SE 2GRQB 3SFXA 1TNOA 2FO1E 1O1SA 3RIBA 4UWHA 4G2VA 2XZTG 2ZXWE 4GTRA 4PH4B 3IKOB 3PUJA 5KJMA 1TN8A 2HR2A 4GA0A 1INZA 3JUIA 3CHRA 3ASOE 3QB2A 2FF4A 3FTXA 3L6AA 4FJZA 3C72A 4RG9A 3ZYMA 4GTPA 3FFLA 3ASDA 1TNBA 1TR4A 2NXPA 1N0QA 4RG6A 4HLLA 3B7SA 3ZKJA 1K8KG 4FJYA 4KVOA 5KNHD 1IHBA 2WMNA 4UI9J 5G04J 2WVIA 5CMYA 4N2SA 2L9BA 3CK9A 1HH8A 2A5EA 2XRYA 2CG3A 3KEZA 1DCEA 4G8KA 2H6GA 4BERA 3G2UA 3AU4A 2L6BA 4HRNA 4O1OA 2X6FA 3ZHEB 3ZFWA 5B1BE 2MOWA 2ETCA 2J4DA 4EPZA 4WNFA 5CERB 4Y6CA 4DX7D 2WM9A 3DWLG 2J9QA 1FCHA 5BXUA 3R9AB 3FTYA 4YDWA 2AXUA 5JHBA 3RKVA 5D2MC 4URKA 5AQBA 2X6KA 3ZU7B 1N4PA 3LYAA 2WXFA 4GZ3A 1QNFA 3D9IA 2IOLA 3QAQA 5JJ7A 3Q47B 1UN9A 2F8XK 3CSTA 4U8VD 4RVBA 1OWOA 1OUVA 4EZLA 3R7QA 5ENQD 4GMRA 5BPPA 4GB9A 2E2EA 2P9UG 3FU0A 1KZOA 4LUNU 3LVQE 4EBAG 4HOSA 1S0PA 3PH0C 3VLDA 3U9WA 3SFZA 2M63A 4A63B 1WM5A 4OAUC 4DI3A 3QWVA 4E6HA 4U63A 2PNNA 1O1RA 4L9PA 2Q7FA 4I2WA 2WXMA 1FVHA 3B13A 3C3QA 3CHSA 3FUDA 4I43A 5AJLA 3KEAA 4L23A 1JCSA 1MQSA 3CQCB 2XEEA 2C0LA 1MX2A 4EHMA 1BI7B 2WXGA 2WQ7A 3CVYA 3CKBA 1KZPA 1KPSB 3CK7A 2RKKA 4HNAD 3AG2E 4L2LA 1YYHA 5FQ4A 3FDHA 3ZIMA 1EDUA 2EILE 4TUMA 3FH7A 3L22A 4Q96A 2XEVA 3QJZA 3TG5A 4DI4A 4GTTA 4ACLA 1OT8A 1GW6A 4QFVA 3LXUX 4I9CA 2JEKA 2DZOA 1UOHA 3AG4E 4YNDA 3Q75A 1E8XA 5LFAA 2OEVA 2ZISA 2Y69E 5KJKA 1AP7A 4U07A 3T8KA 3L16A 1RW2A 4BX8A 5JHAA 3TWQA 3UPVA 4AEZC 4IULA 3GZSA 3DRAA 1NP7A
chains in the Genus database with same CATH topology
3PUKA 2VTBB 2C2LA 3D3MA 2L0TB 5M72A 2OV8A 4WWOA 2PM7A 3D9LA 2KATA 4BTBA 5G05J 3SF4A 2CHZA 2J07A 2WXIA 3OAWA 4Y6WA 3FP3A 1FVFA 3Q15A 4CT0A 2XGOA 4HLEA 3SNXA 3TG4A 1E8WA 3TGOA 2AXZA 3B7TA 3S7FA 1H2VC 2X6HA 2GW1A 1N54A 3LEWA 3S7BA 3P2BA 1TJFA 3TJPA 4I6GA 2WXOA 2XPIA 3HYMB 5G05C 3CVQA 4PUCA 4U0SA 1HZ4A 1SQMA 2YQ8A 3CVVA 5LP0A 3KAEA 1U3DA 4HS2A 4WWPA 4OVUA 3BG0B 3CV0A 2XCCA 3JCKC 3L08A 4AJWA 3ML9A 4OVVA 3D9JA 3FEYA 2IF4A 2KCVA 2X3MA 4J8DA 4UWKA 5HI7A 2XHEA 3CHMA 4N3BA 5D0OD 3MKQA 2HM8A 2OOEA 5FJYA 3SGHA 5C1DA 4W9RA 3I4GA 1HG2A 3ESKA 2YINA 2C0MA 3SD5A 2V0PA 3RJVA 5BT1A 2UY1B 3EIQC 4Q69A 2UWJG 2FI7A 3RRUA 2AVPA 4I2ZA 2GRMA 3IHVA 2IFUA 5EKQD 4BWRA 4GA2A 3P1UA 3RO3A 5BW8C 3MKRA 4AVXA 5FZSA 4DLOA 4DPRA 5E76A 2VTBA 2MHKA 4GA1A 3FUIA 3TXNA 4BT8A 3ZEFA 3CVUA 4GCOA 3CHQA 3CHPA 4N3CA 3APCA 5JJ6A 3N71A 1E96B 5AJDA 1B89A 3FU6A 3OXGA 4BTAA 1LF8A 1EPUA 4YVQC 2HO1A 4LERA 5T4YA 5KJLA 4ILIA 4M3OA 3NQPA 2CFUA 3CR3A 2XCBA 4JC8A 2LNIA 4EZJA 4J8EA 4PDXA 4IYPA 2WXJA 3D9PA 2WQ6A 4UI9C 4JEUA 3UT4A 2BUGA 3I3NA 4I6JA 4UQYA 3HDXA 4YVOA 4J8SA 3PRZA 4XE0A 2XQ0A 1W3BA 3I5PA 4GZ5A 4BSXA 2RG8A 3BG1B 3CKCA 4XI9A 4O6FA 4AY6A 3FHEA 3G2TA 3RK6A 3FEXA 1H0AA 1JWFA 3MCXA 3ML8A 1UJJA 4GMLA 3FUHA 3LKUA 4KZCA 3HIZA 3ONLA 3ZVVA 4DLQA 3CEQA 2AXVA 2XGSA 3IHYA 3FTZA 3LS8A 2WXRA 2X6IA 4UWFA 2V5FA 2FO7A 3Q49B 2XRZA 2VQ2A 4AP2A 3HVEA 2XGMA 3MGBA 5LCWJ 4LCTA 2FEZA 1SZ9A 4CGVA 1HS6A 4KBQA 2R17C 1JPLA 2GRLA 2WQHA 4GZ6A 4EECA 4TV3A 1BPOA 1JWGA 3ZYQA 4GYYA 4R7LA 1JUQA 3D9NA 3O48A 4WNEA 1OWLA 3CVNA 5FZRA 3O4ZA 4XKCA 5E75A 5EX0A 3IEGA 3FUMA 3PS6A 4UI9K 5CCMA 3MKQB 4B0ZA 3UT8A 2Y4UA 3CVWA 3LCAA 2PQNA 4GZDA 3ESLA 4UWLA 3PEUB 4CCAA 1UJKA 4KVMA 5FTPA 2GGFA 3QC1A 3TXMA 3ZYLA 4EZKA 3UQ3A 4UWGA 2VSNA 3SBSA 3OXFA 1Z3YA 2VGYA 3PVLA 4FU3A 5FT9A 2R5SA 3B7RL 4GU5A 2KM4A 3QARA 5G2NA 2LAIA 4GAAA 4ANWA 4ANUA 4G23A 2LSVA 4XKBA 3KD7A 2DBAA 2J49A 4HORA 2CHXA 4I6EA 1PAQA 4U0UA 3CVPA 3CHOA 3T8MA 3AS4A 3RIBA 4E85A 4UWHA 1Z3XA 4J0UA 4G2VA 1KT0A 3L54A 3LJ3A 4XI0A 4I1AA 4PH4B 3LY8A 3IKOB 5AIJA 3LY9A 3PUJA 5KJMA 3CVLA 2J4BA 3S2AA 1EYHA 2HR2A 2I1KA 3GZ1A 4GA0A 2AW6A 3PE4A 2WXHA 4FHJA 1INZA 3JUIA 4APOA 4CRWA 4G26A 3CHRA 3PZDA 4C0MA 3ZW3A 3QB2A 2V8SE 5KCMA 4KXKB 2FF4A 3FTXA 1HF8A 3CGHA 4HFGA 2VJ8A 3L6AA 4FJZA 4XZ4A 3NZUA 4RG9A 5A7DB 4I9EA 3ZYMA 2QY7A 4FULA 3FFLA 3FU5A 3HVEB 5C2YA 4WAFA 3ASDA 1E8YA 2R59A 3E4BA 4B8CB 2NXPA 1OWPA 4N3AA 4I1MA 3PNLB 2CG2A 2OVBA 4JXTA 3CK8A 4RG6A 3JQ0A 3B7SA 4F3VA 4UQZA 4AIFA 2VYIA 4FJYA 4BFRA 3G2VA 3VTYA 4WUYA 5D0QD 5BNWA 5DIZA 4KVOA 4N2QA 3I4RB 1E90A 4DK5A 2IQCA 4H7XA 2WXNA 3QWWA 3LVRE 2KC7A 2ZU6B 2WMNA 3UX4A 2IJGX 4UI9J 1E7UA 1E7VA 4F1SA 3EIJA 3FUKA 4F53A 1E8ZA 1QQEA 5G04J 5G55A 5J08A 4FLBA 1Y6IA 2ONDA 2WVIA 2PZIA 3QKYA 5CMYA 5EX3A 4CDNA 3L17A 4N2SA 3EHNA 2L9BA 3G2WA 4JHRA 1HXIA 3CK9A 1HH8A 4KT6B 4MRUA 3GYZA 2XRYA 3PNTB 3FULA 3L13A 1XGWA 2CG3A 3HHMA 3KEZA 4A1GA 3KS2A 4KYOB 3GW4A 3G2SA 2EQXA 2WPVA 3CIAA 3G2UA 3AU4A 2DIWA 3U4TA 1WY6A 5CHEE 5G04C 4HVBA 1HX8A 5FQ6A 2X6FA 4CT4A 1HE8A 1XNFA 4I1OB 3ZHEB 3ZFWA 4IRUA 4A3TA 1ELKA 4NQ0A 2Y4TA 3VLFA 4JEHA 1H6KA 2WXLA 4GYWA 4HXIA 1HO8A 3APDA 2FBNA 3UMVA 4ILGA 2MOWA 4AOFA 3MV2B 5FWQA 4C9BB 3FUNA 3ZN3A 2LSUA 2YNQA 3ASGA 4A1SA 4G25A 5FQ8A 5FZQA 3VTXA 1QZ2A 4WNDA 3SI5A 2NSZA 2J4DA 3ZGQA 4AV7A 1KLXA 4EPZA 2I6HA 4WNFA 1TEZA 3QOUA 3WXXA 1KT1A 2L6JA 4Y6CA 5ANLA 2WM9A 2J9QA 4U0ZA 1FCHA 4JW1A 5FQ7A 4OYSA 3RRMB 4GZCA 3R9AB 3FTUA 2I1JA 2A5UA 2YHCA 3JQ1A 3FU3A 5CMWA 1WAO1 3LY7A 4N5CA 3FTYA 2AXUA 3C98A 4PS8A 3OTNA 4K0RA 3ZRHA 3FH8A 2VSOE 5JHBA 2KCLA 4AM9A 1YA0A 4J6IA 5ARFA 3RU0A 5T3RA 5BV1A 3RKVA 4JHJA 4TUUA 4GYOA 2VGXB 1H2TC 1OWMA 2J08A 3EHMA 3FUFA 4PS7A 2ILRA 3PE3A 4L7TA 3RRNB 2QFCA 2DCPA 4URKA 4K03A 2A4ZA 2IONA 4BT9A 3APFA 2X6KA 4DJAA 5ENNA 2PL2A 3MX3A 4MKTA 2VSYA 1NZNA 2LO6A 3LYAA 4ME2A 5A6CA 4N39A 3PDNA 4ILHB 3S7JA 2NC9A 3D9OA 3Q5MA 2WXFA 2WXPA 4XIFA 4GZ3A 3ZHEA 1QNFA 3ZPJA 3D9IA 2IOLA 1H19A 3QAQA 3BEEA 1L5JA 3FUEA 3FWVA 3B7UX 5BUZA 3IV0A 2MRIA 3CQGB 4FLHA 3T5XA 4A3VA 5JJ7A 2PQRA 1UN9A 3Q47B 3FTSA 5AYWD 2CFZA 2V4LA 4CDMA 5LX8A 1MHQA 3CSTA 4RVBA 1OWOA 3NZSA 4FHKA 4G1TA 1HU3A 2OVFA 3AU5A 2X6JA 2YHEA 4B94A 1VDYA 3U64A 3MJWA 1OUVA 4ABNA 4U04A 3CVXA 4ANXA 4JA7A 5J90A 1ZU2A 4EZLA 5ANRA 3R7QA 2J09A 3GZ2A 2L0IA 3MEKA 1IQRA 1U3CA 5BPPA 3ULQA 4GB9A 2E2EA 3FU0A 4PS3A 4LUNU 3LVQE 4EBAG 3U66A 3AS5A 5BV0A 1S0PA 4HOSA 3PH0C 4JHKA 3FH5A 3VLDA 3U9WA 3SFZA 2KZTB 2XPZA 4B8AA 1NA3A 2Y3AA 3MV3B 2M63A 1WM5A 2VSXE 4JA9A 1H2UA 2E0IA 3EJNA 2VGXA 4APFA 4GMJA 3S7DA 4JPSA 4MS6A 4DI3A 3QWVA 5KJNA 4E6HA 4U63A 4J8FA 4KZ0A 4F7AA 2Q7FA 3PREA 4I2WA 4G24A 4WWNA 4EQFA 2WXMA 3DPDA 1SZAA 3FTWA 5CCLA 1FVHA 3B13A 3VLEA 4GPKA 4JVSA 3SBTB 3QWPA 2CHWA 3CHSA 3FUDA 4UQXA 4I43A 5AJLA 2WXQA 1HG5A 4L23A 2RD0A 4G11A 4I17A 5A23A 1MQSA 3CQCB 3PEVB 2C0LA 3CSFA 3D9MA 3MZLB 5HQ8A 2AWIA 3U3WA 3URZA 3RO2A 2WXGA 4BY6A 2WQ7A 2X38A 3FY4A 1TJCA 5T8IA 3CVYA 4KMOA 3CKBA 1OWNA 3CK7A 4Q94A 4L2LA 1DVPA 3K9IA 1ELWA 4L1BA 5FQ4A 3R7RA 2XPYA 3Q4AB 4EBAA 3SZ7A 4RSYA 3LDZA 1UW4B 2PM6A 3FDHA 4BX9A 3ZXSA 3QDNA 2IU1A 2JLBA 4TRQA 4WNGA 3ZIMA 4ACKA 3NF1A 2WMOA 4L2YA 1ELRA 1EDUA 1IHGA 2KCKA 5ARGA 3CLJA 1DNPA 2KZTA 3JYSA 4CDRA 4FP7A 3FH7A 3ENEA 1IQUA 3L22A 4XX5A 4LRZA 2IOSA 3ASHA 3MYVA 4FC8A 3TAXA 3ZYKA 4FA6A 3FUJA 1NA0A 5LOZA 4AY5A 4Q96A 2XEVA 3QJZA 3T5VA 2BTDA 3MA5A 1Z6TA 1Y8MA 3FTVA 3TG5A 4AXHA 4ACLA 4HOQA 4DI4A 2WB2A 2LAHA 4B89A 1GW6A 5JJTA 3QNKA 3DBSA 4QFVA 4MLPA 3LXUX 3OXLA 5DBKA 3EDTB 3IBEA 4I9CA 4D10C 3ASFA 2JEKA 4C0EA 4U8HA 4HOUA 4H7YA 4YNDA 3TL5A 1E8XA 4NRHB 5LFAA 1PY1A 4V3IA 1UG3A 3UUXA 5KJKA 3UT7A 2UY1A 4U07A 1UN8A 5EDSA 1IYGA 2BF0X 2WXKA 3L16A 4HOTA 1X5BA 2P58C 4JZYA 1N52A 2HYZA 4BX8A 4CGWA 5JHAA 5LCWC 2I2OA 3LPZA 4FADA 4GCNA 4ANVA 1HFAA 3UPVA 4CEMA 4JL0A 4IN3B 4ATGA 3QK0A 4AEZC 1P5QA 1EF1C 2I9CA 4IULA 5AENA 1A17A 4P29A 1PC2A 4NACA 3GZSA 3SHFA 4LEUA 3AS8A 1ZBPA 3D9KA 4A55A 2FULA 4NURA 1NP7A 3ONKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ILR A; 
#chains in the Genus database with same CATH topology
 2VTB B;  3D3M A;  3ABK E;  2L0T B;  4WWO A;  3D9L A;  2GRO B;  5G05 J;  2J07 A;  3C5R A;  2GW1 A;  1N54 A;  3LEW A;  4I6G A;  3HYM B;  1HZ4 A;  2ZGD A;  5LP0 A;  1U3D A;  2XCC A;  2KCV A;  4BSZ B;  2XHE A;  2HM8 A;  2OOE A;  4GTV A;  5C1D A;  5FIO A;  3I4G A;  3B7B A;  3ESK A;  2C0M A;  3UTM A;  3SY2 A;  2UWJ G;  3RRU A;  2AVP A;  5EKQ D;  2GRM A;  4BWR A;  4GA2 A;  5BW8 C;  3MKR A;  2DWZ A;  4GA1 A;  1LF8 A;  4UUC A;  3NQP A;  1OY3 D;  4X8Q A;  3UT4 A;  3JUE A;  4J8S A;  4GTM A;  1BI8 B;  4XE0 A;  4GZ5 A;  2RG8 A;  3BG1 B;  3CKC A;  3RK6 A;  3FUH A;  1FPP A;  3ONL A;  3ZVV A;  3LS8 A;  2FO7 A;  2XGM A;  4LCT A;  2FEZ A;  1HS6 A;  1D9S A;  2GRL A;  3D9N A;  3O48 A;  2F0Y A;  2H6F A;  2LXM A;  5EX0 A;  3IEG A;  4GZD A;  4CCA A;  5FTP A;  2GGF A;  3TXM A;  3ZYL A;  1Z3Y A;  1D8E A;  2VGY A;  2R5S A;  4GU5 A;  2KM4 A;  3QAR A;  5G2N A;  4GAA A;  2LSV A;  4HOR A;  1H6O A;  5CEA A;  4TXP A;  5IY5 E;  1Z3X A;  4J0U A;  3L54 A;  3LY9 A;  5KBA A;  1BU9 A;  1EYH A;  2AW6 A;  2WXH A;  4FHJ A;  5HS0 A;  4APO A;  4G26 A;  4C0M A;  2P9L G;  1OCO E;  3HXE A;  4K5A B;  2V8S E;  1IKN D;  4HFG A;  2VJ8 A;  2P9P G;  4LG6 A;  5C2Y A;  1D8D A;  4B8C B;  3PNL B;  2VGE A;  4JXT A;  2ZIR A;  4F3V A;  3J5Q B;  4YDO A;  2VYI A;  4BFR A;  3G2V A;  5BNW A;  4WUY A;  5DIZ A;  2P9I G;  2IQC A;  2WXN A;  4M7C A;  4F1S A;  2IJG X;  1E7U A;  3EIJ A;  1E8Z A;  5J08 A;  1Y6I A;  5EX3 A;  4G8L A;  1SA4 A;  1XGW A;  3HHM A;  4A1G A;  3HXC A;  2EQX A;  5ITZ F;  3CIA A;  3EUV A;  5CHE E;  4HVB A;  1N95 A;  3VLF A;  2H6I A;  1H6K A;  2FBN A;  3MV2 B;  5EID A;  3ZN3 A;  2LSU A;  4G25 A;  5FZQ A;  3VTX A;  1TNZ A;  4WND A;  2NSZ A;  3ZGQ A;  1K3Z D;  1KLX A;  2I6H A;  1TEZ A;  4JW1 A;  3DSW A;  3FTU A;  3FU3 A;  5CMW A;  4N5C A;  3DSS A;  2VSO E;  1YA0 A;  5BV1 A;  4TUU A;  3X2Q E;  4GYO A;  4HQD A;  2ILR A;  1TNU A;  2KXP C;  2ION A;  3APF A;  3NB2 A;  4DX5 D;  5AAR A;  2LO6 A;  5A6C A;  2NC9 A;  3D9O A;  3ZXP A;  4XIF A;  2F37 A;  1L5J A;  4GTS A;  3FWV A;  3B7U X;  5BUZ A;  3IV0 A;  4FLH A;  4A3V A;  1MHQ A;  2OVF A;  4O60 A;  3U64 A;  4ABN A;  3CVX A;  4U04 A;  1V54 E;  5J90 A;  4JA7 A;  5ANR A;  2P9S G;  2L0I A;  3MEK A;  3DSV A;  3AS5 A;  5BV0 A;  3FH5 A;  2R02 A;  2XPZ A;  4B8A A;  1NA3 A;  3V79 K;  3MV3 B;  4JD2 G;  1H2U A;  2E0I A;  2B6C A;  3S7D A;  4JPS A;  1K1B A;  2ETA A;  4F7A A;  3DPD A;  3FTW A;  4DRX E;  2HE0 A;  3VLE A;  4JVS A;  3SBT B;  2LXL A;  2NYJ A;  2WXQ A;  5A23 A;  5HQ8 A;  3URZ A;  4F6R D;  3C3O A;  2X38 A;  5T8I A;  1LD7 A;  4CYM D;  1DVP A;  3K9I A;  1ELW A;  4RSY A;  2PM6 A;  3ZXS A;  2IO3 C;  3QDN A;  4TRQ A;  4WNG A;  4ACK A;  3E30 A;  1ELR A;  1IHG A;  4CDR A;  4FP7 A;  3T9K A;  1SW6 A;  1N9A A;  5CED B;  5LOZ A;  2EIJ E;  3T5V A;  1Z6T A;  1Y8M A;  3DEO A;  2WB2 A;  3ZUV B;  2LAH A;  4HI9 A;  3QNK A;  3OXL A;  3ASN E;  1PY1 A;  1G3N B;  3UI2 A;  2UY1 A;  2DVW A;  2WXK A;  2HYZ A;  4CGW A;  2I2O A;  4GCN A;  4ANV A;  4CEM A;  5AN8 A;  4IN3 B;  4U8Y D;  1EF1 C;  2I9C A;  5AEN A;  1A17 A;  5ENP D;  1PC2 A;  4NAC A;  3AS8 A;  4A55 A;  4NUR A;  2DYR E;  4KZ0 A;  3EHR A;  5CRU A;  2C2L A;  5AQA A;  5M72 A;  2DZN A;  4RLY A;  2PM7 A;  3SF4 A;  5JMN D;  3JXJ A;  4Y6W A;  3Q15 A;  2XGO A;  3SNX A;  3TG4 A;  3TGO A;  3DXK G;  3EHQ A;  3S7F A;  1LTX A;  3S7B A;  3TJP A;  4C48 B;  4WWP A;  3V2X A;  3L08 A;  3ML9 A;  3D9J A;  3E33 A;  2X3M A;  4J8D A;  4N3B A;  5D0O D;  3SGH A;  1HG2 A;  1OXJ A;  3SD5 A;  4JB8 P;  4DUI A;  3RO3 A;  5E76 A;  1BD8 A;  2MHK A;  2R2L A;  3HG0 D;  4GCO A;  3ZEF A;  3CHP A;  2BKK B;  3N71 A;  1E96 B;  3NBN B;  1B89 A;  4BTA A;  2HO1 A;  1YMP A;  2CFU A;  3CR3 A;  4HI8 A;  4JC8 A;  4LNU D;  4IYP A;  4U96 D;  4UI9 C;  4JEU A;  4UQY A;  3PZ3 A;  4BSX A;  5EIB E;  1H6P A;  4O6F A;  4AY6 A;  3FHE A;  3G2T A;  4KZC A;  4J8Y A;  2XGS A;  3IHY A;  5HKP A;  3UIN C;  2X6I A;  4UWF A;  2VQ2 A;  3W9G A;  3MGB A;  5LCW J;  4CGV A;  3HXF A;  1IXV A;  2R17 C;  3DXM G;  4HRL A;  4TV3 A;  4GYY A;  4R7L A;  1JUQ A;  3DEP A;  1OWL A;  3CVN A;  2P9N G;  3PS6 A;  4UI9 K;  3MKQ B;  2H6H A;  3UT8 A;  2Y4U A;  3LCA A;  3HRA A;  4UWL A;  3PEU B;  4EZK A;  3SBS A;  5JA4 D;  4N5Q A;  2B0O E;  4XKB A;  3KD7 A;  5CEC B;  1OCR E;  4I6E A;  1S63 A;  1PAQ A;  3CVP A;  3T8M A;  3AS4 A;  1KT0 A;  3LJ3 A;  1N4Q A;  4XI0 A;  4I1A A;  2QYU A;  4B93 B;  3S2A A;  3LJN A;  3Q79 A;  4CRW A;  3RSE G;  3PZD A;  3DPY A;  4KXK B;  3CGH A;  2LUH A;  2RFA A;  5A7D B;  3HVE B;  1E8Y A;  3E4B A;  4N3A A;  4I1M A;  2OVB A;  3CK8 A;  2BKG A;  4UQZ A;  4AIF A;  4N2Q A;  4DK5 A;  1E90 A;  4H7X A;  5ENR D;  3LVR E;  3FUK A;  4F53 A;  5G55 A;  4FLB A;  4KT6 B;  4LSZ E;  3GYZ A;  3PNT B;  3FUL A;  3KS2 A;  4KYO B;  1N4S A;  2WPV A;  2R03 A;  3UXG A;  2DIW A;  3U4T A;  1WY6 A;  5FQ6 A;  1HE8 A;  1XNF A;  1V55 E;  4I1O B;  4A3T A;  4IRU A;  2OEW A;  1ELK A;  5H7P A;  5B1A E;  4BEP A;  4GYW A;  1HO8 A;  3SO8 A;  4AOF A;  5FWQ A;  3ASG A;  4A1S A;  5FQ8 A;  1LD8 A;  1QZ2 A;  3WG7 E;  3SI5 A;  4AV7 A;  3QOU A;  3WXX A;  1KT1 A;  4ZFH A;  5FQ7 A;  4GZC A;  3JQ1 A;  2XZD G;  2YHC A;  3EU9 A;  5D66 A;  4DX6 D;  3C98 A;  5CBN A;  4PS8 A;  4K0R A;  3ZRH A;  3FH8 A;  3HXB A;  1S70 B;  1QYM A;  4ATZ D;  4J6I A;  3RU0 A;  5T3R A;  1H2T C;  2J08 A;  3AAA C;  5AQ9 A;  2QFC A;  2DCP A;  4K03 A;  2A4Z A;  4DJA A;  3MX3 A;  4ME2 A;  4N39 A;  3Q5M A;  2WXP A;  4GTO A;  5ENS D;  3ZPJ A;  3BEE A;  3FUE A;  2RFM A;  2MRI A;  3CQG B;  2PQR A;  2V4L A;  2XS1 A;  4K5B A;  1WG0 A;  3NZS A;  3Q9U C;  4FHK A;  4G1T A;  1HU3 A;  4B94 A;  4HRM B;  4ANX A;  1ZU2 A;  3JXI A;  2J09 A;  3GZ2 A;  1IQR A;  3AG3 E;  4PS3 A;  3U66 A;  2Y3A A;  3EJN A;  2VGX A;  4APF A;  5BXO A;  1Z5S C;  4MS6 A;  5KJN A;  3TWU A;  2R05 A;  5CCL A;  4GPK A;  3QWP A;  4UQX A;  2RD0 A;  4G11 A;  3CSF A;  3ABM E;  3MZL B;  2AWI A;  3U3W A;  3RO2 A;  4BY6 A;  3FY4 A;  4KMO A;  2ZGG A;  1OWN A;  4Q94 A;  2IO2 C;  5CRV A;  2KBX A;  3Q4A B;  4HBD A;  3LDZ A;  1FT2 A;  4Z68 A;  2JLB A;  3TWR A;  1N11 A;  2KCK A;  5ARG A;  2KZT A;  3JYS A;  3ENE A;  1IQU A;  4XX5 A;  3SQV A;  2OCC E;  2IOS A;  3ASH A;  3ZYK A;  3FUJ A;  5EIL A;  5EYL A;  3MA5 A;  4AXH A;  4HOQ A;  4B89 A;  3DBS A;  3IBE A;  5AAO A;  4U8H A;  4HOU A;  3ABL E;  4NRH B;  1UG3 A;  1NL4 A;  3UT7 A;  1UN8 A;  5EDS A;  4HOT A;  1X5B A;  1N52 A;  1WDY A;  3NAW A;  3LPZ A;  4FAD A;  1K1A A;  4ATG A;  3TWT A;  4P29 A;  3D9K A;  2FUL A;  3HXD A;  3PUK A;  4LNB A;  2OV8 A;  4BTB A;  1O1T A;  2QYJ A;  3AG1 E;  3OAW A;  1FVF A;  4CT0 A;  2XS8 A;  5ENO D;  3B7T A;  2X6H A;  2J8S D;  3P2B A;  1TJF A;  2XPI A;  4K5C A;  4PUC A;  4U0S A;  3DSU A;  2YQ8 A;  3CVV A;  1X81 A;  1AWC B;  3UIP C;  4OVV A;  3FEY A;  4UWK A;  5HI7 A;  2YIN A;  3E37 A;  4QQI A;  2V0P A;  5BT1 A;  3EIQ C;  4Q69 A;  2FI7 A;  4I2Z A;  4YDY A;  4DLO A;  1DCQ A;  3FUI A;  3CVU A;  3CHQ A;  4N3C A;  5JJ6 A;  3OXG A;  3FU6 A;  5HRY A;  5KJL A;  4M3O A;  2QC9 A;  2XCB A;  4EZJ A;  2WXJ A;  2WQ6 A;  2BUG A;  3I3N A;  4YVO A;  3PRZ A;  4XI9 A;  3ML8 A;  3MCX A;  4GML A;  1UJJ A;  3LKU A;  1FT1 A;  3HIZ A;  4DLQ A;  1YCS B;  3CEQ A;  1OCC E;  2AXV A;  3FTZ A;  4TXQ A;  1NFI E;  3UIO C;  2V5F A;  3Q49 B;  2XRZ A;  4AP2 A;  1SZ9 A;  4KBQ A;  2WQH A;  1BPO A;  2GRR B;  5FZR A;  3O4Z A;  5CCM A;  3BQO A;  3CVW A;  3PZ4 A;  4KVM A;  4O1P A;  3UQ3 A;  2VSN A;  3E34 A;  4FU3 A;  1MX4 A;  4XEI G;  4ANW A;  4ANU A;  4G23 A;  2QZA A;  2DBA A;  2CHX A;  4U0U A;  3CHO A;  3BU8 A;  4E85 A;  1MZC A;  3LY8 A;  5AIJ A;  3CVL A;  2J4B A;  2I1K A;  3GZ1 A;  2P2C P;  3PE4 A;  2V5Q C;  3ZW3 A;  5KCM A;  4U95 D;  1HF8 A;  3UM2 A;  4XZ4 A;  4DX2 A;  3NZU A;  4I9E A;  1SA5 A;  2QY7 A;  4FUL A;  3FU5 A;  4WAF A;  3C3R A;  2R59 A;  1OWP A;  2CG2 A;  4GPM A;  3JQ0 A;  5ENT D;  3VTY A;  5D0Q D;  3I4R B;  4F1P A;  3QWW A;  2KC7 A;  2ZU6 B;  3UX4 A;  4CZ2 D;  1E7V A;  1TN7 A;  1QQE A;  3QKY A;  2OND A;  2PZI A;  4CDN A;  3L17 A;  3EHN A;  3G2W A;  4JHR A;  1HXI A;  4MRU A;  3L13 A;  3IXE A;  3E32 A;  3GW4 A;  3G2S A;  3Q9N C;  5G04 C;  1HX8 A;  3PZ1 A;  4CT4 A;  4NIK A;  4NQ0 A;  2Y4T A;  4JEH A;  2WXL A;  4HXI A;  3APD A;  3UMV A;  4BES A;  4ILG A;  1TYQ G;  1QBQ A;  3J5P A;  4C9B B;  3FUN A;  2YNQ A;  4YDE A;  5KWD A;  2L6J A;  5ANL A;  3RAU A;  4U0Z A;  4OYS A;  3RRM B;  2I1J A;  2A5U A;  1WAO 1;  3LY7 A;  3OTN A;  2KCL A;  1JCQ A;  4TXR A;  3V30 A;  4AM9 A;  5ARF A;  4JHJ A;  4GTQ A;  3UM1 A;  2EIK E;  2VGX B;  1OWM A;  3EHM A;  3FUF A;  4PS7 A;  4L7T A;  3PE3 A;  3RRN B;  4BT9 A;  2AJA A;  5ENN A;  2PL2 A;  4MKT A;  3ISM C;  2VSY A;  1NZN A;  3UKU G;  3PDN A;  4ILH B;  3S7J A;  3PZ2 A;  3ZHE A;  2F8Y A;  1H19 A;  3L9T A;  3UM0 A;  4ZHB A;  3SFY A;  3T5X A;  5AYW D;  3FTS A;  2CFZ A;  4CDM A;  5LX8 A;  4LNG A;  1TN6 A;  2X6J A;  3AU5 A;  2YHE A;  1VDY A;  3MJW A;  1NI1 A;  1U3C A;  3ULQ A;  1DC2 A;  4JHK A;  2KZT B;  2ETB A;  3DSX A;  3EU5 A;  2VSX E;  4JA9 A;  3V2O A;  4GMJ A;  5KNG A;  2BED A;  2IEJ A;  3NOC D;  4J8F A;  3PRE A;  4G24 A;  4WWN A;  4EQF A;  1RZ4 A;  1SZA A;  2XEN A;  3BUA A;  2CHW A;  3Q78 A;  1HG5 A;  4I17 A;  3PEV B;  3D9M A;  1TJC A;  2V4H C;  3Q7A A;  1ZB1 A;  2Y0B G;  4L1B A;  1MJ0 A;  3R7R A;  2XPY A;  2GRN B;  4EBA A;  3SZ7 A;  3UM3 A;  3TWX A;  1UW4 B;  5EN5 D;  3TWV A;  4BX9 A;  1BLX B;  2XEH A;  3Q73 A;  2IU1 A;  3NF1 A;  2WMO A;  4L2Y A;  5FIN A;  3CLJ A;  1DNP A;  4LRZ A;  4FA6 A;  3MYV A;  4FC8 A;  3TAX A;  3R9M A;  1NA0 A;  4AY5 A;  2BTD A;  3FTV A;  3W9F A;  5JJT A;  4MLP A;  4D10 C;  5DBK A;  3EDT B;  3ASF A;  4C0E A;  4H7Y A;  1N0R A;  1MYO A;  3TL5 A;  4V3I A;  3L82 A;  3Q7F A;  3UUX A;  1IYG A;  2BF0 X;  4OAV B;  2P58 C;  4JZY A;  5LCW C;  1HFA A;  4JL0 A;  3QK0 A;  3V31 A;  1P5Q A;  3SHF A;  4LEU A;  1ZBP A;  4U7E B;  3ONK A;  1N94 A;  1U2V G;  3AJI A;  2KAT A;  4RQI A;  3TWS A;  2CHZ A;  2WXI A;  3FP3 A;  4HLE A;  4DX1 A;  1E8W A;  1JCR A;  2AXZ A;  1H2V C;  2WXO A;  5G05 C;  3CVQ A;  1SQM A;  2MYO A;  3KAE A;  4HS2 A;  4OVU A;  3BG0 B;  3CV0 A;  3JCK C;  4AJW A;  3KSQ A;  2IF4 A;  3CHM A;  3MKQ A;  5FJY A;  4W9R A;  3RJV A;  2UY1 B;  2Y1L E;  1A5E A;  3UKR G;  3IHV A;  2IFU A;  1S64 A;  3P1U A;  3NOG D;  1O5M A;  5FZS A;  4AVX A;  3KSL A;  4DPR A;  2VTB A;  3TXN A;  4BT8 A;  3F6Q A;  3APC A;  1Q2Z A;  5AJD A;  2JAB A;  1EPU A;  4YVQ C;  4LER A;  5T4Y A;  4ILI A;  5EYP F;  1N4R A;  2LNI A;  4J8E A;  4PDX A;  4J7W A;  3D9P A;  3ULE G;  4I6J A;  2GRP B;  3HDX A;  2IY0 C;  1W3B A;  2XQ0 A;  3I5P A;  3FEX A;  1H0A A;  1JWF A;  2EIM E;  1MX6 A;  3B95 A;  2EIN E;  2WXR A;  3HVE A;  3ULY A;  4EEC A;  4GZ6 A;  1JPL A;  3DST A;  5AQ7 A;  1SVX A;  1JWG A;  3ZYQ A;  3D9H A;  2DYS E;  4WNE A;  2P9K G;  5CBO A;  4XKC A;  5E75 A;  1TNY A;  3FUM A;  4B0Z A;  3TWW A;  2PQN A;  3ESL A;  1UJK A;  3QC1 A;  1OCZ E;  4UWG A;  4HB5 A;  3OXF A;  3ZNG A;  3PVL A;  4BET A;  5FT9 A;  3B7R L;  2LAI A;  4MBG A;  2J49 A;  5B3S E;  2GRQ B;  3SFX A;  1TNO A;  2FO1 E;  1O1S A;  3RIB A;  4UWH A;  4G2V A;  2XZT G;  2ZXW E;  4GTR A;  4PH4 B;  3IKO B;  3PUJ A;  5KJM A;  1TN8 A;  2HR2 A;  4GA0 A;  1INZ A;  3JUI A;  3CHR A;  3ASO E;  3QB2 A;  2FF4 A;  3FTX A;  3L6A A;  4FJZ A;  3C72 A;  4RG9 A;  3ZYM A;  4GTP A;  3FFL A;  3ASD A;  1TNB A;  1TR4 A;  2NXP A;  1N0Q A;  4RG6 A;  4HLL A;  3B7S A;  3ZKJ A;  1K8K G;  4FJY A;  4KVO A;  5KNH D;  1IHB A;  2WMN A;  4UI9 J;  5G04 J;  2WVI A;  5CMY A;  4N2S A;  2L9B A;  3CK9 A;  1HH8 A;  2A5E A;  2XRY A;  2CG3 A;  3KEZ A;  1DCE A;  4G8K A;  2H6G A;  4BER A;  3G2U A;  3AU4 A;  2L6B A;  4HRN A;  4O1O A;  2X6F A;  3ZHE B;  3ZFW A;  5B1B E;  2MOW A;  2ETC A;  2J4D A;  4EPZ A;  4WNF A;  5CER B;  4Y6C A;  4DX7 D;  2WM9 A;  3DWL G;  2J9Q A;  1FCH A;  5BXU A;  3R9A B;  3FTY A;  4YDW A;  2AXU A;  5JHB A;  3RKV A;  5D2M C;  4URK A;  5AQB A;  2X6K A;  3ZU7 B;  1N4P A;  3LYA A;  2WXF A;  4GZ3 A;  1QNF A;  3D9I A;  2IOL A;  3QAQ A;  5JJ7 A;  3Q47 B;  1UN9 A;  2F8X K;  3CST A;  4U8V D;  4RVB A;  1OWO A;  1OUV A;  4EZL A;  3R7Q A;  5ENQ D;  4GMR A;  5BPP A;  4GB9 A;  2E2E A;  2P9U G;  3FU0 A;  1KZO A;  4LUN U;  3LVQ E;  4EBA G;  4HOS A;  1S0P A;  3PH0 C;  3VLD A;  3U9W A;  3SFZ A;  2M63 A;  4A63 B;  1WM5 A;  4OAU C;  4DI3 A;  3QWV A;  4E6H A;  4U63 A;  2PNN A;  1O1R A;  4L9P A;  2Q7F A;  4I2W A;  2WXM A;  1FVH A;  3B13 A;  3C3Q A;  3CHS A;  3FUD A;  4I43 A;  5AJL A;  3KEA A;  4L23 A;  1JCS A;  1MQS A;  3CQC B;  2XEE A;  2C0L A;  1MX2 A;  4EHM A;  1BI7 B;  2WXG A;  2WQ7 A;  3CVY A;  3CKB A;  1KZP A;  1KPS B;  3CK7 A;  2RKK A;  4HNA D;  3AG2 E;  4L2L A;  1YYH A;  5FQ4 A;  3FDH A;  3ZIM A;  1EDU A;  2EIL E;  4TUM A;  3FH7 A;  3L22 A;  4Q96 A;  2XEV A;  3QJZ A;  3TG5 A;  4DI4 A;  4GTT A;  4ACL A;  1OT8 A;  1GW6 A;  4QFV A;  3LXU X;  4I9C A;  2JEK A;  2DZO A;  1UOH A;  3AG4 E;  4YND A;  3Q75 A;  1E8X A;  5LFA A;  2OEV A;  2ZIS A;  2Y69 E;  5KJK A;  1AP7 A;  4U07 A;  3T8K A;  3L16 A;  1RW2 A;  4BX8 A;  5JHA A;  3TWQ A;  3UPV A;  4AEZ C;  4IUL A;  3GZS A;  3DRA A;  1NP7 A; 
#chains in the Genus database with same CATH homology
 3PUK A;  2VTB B;  2C2L A;  3D3M A;  2L0T B;  5M72 A;  2OV8 A;  4WWO A;  2PM7 A;  3D9L A;  2KAT A;  4BTB A;  5G05 J;  3SF4 A;  2CHZ A;  2J07 A;  2WXI A;  3OAW A;  4Y6W A;  3FP3 A;  1FVF A;  3Q15 A;  4CT0 A;  2XGO A;  4HLE A;  3SNX A;  3TG4 A;  1E8W A;  3TGO A;  2AXZ A;  3B7T A;  3S7F A;  1H2V C;  2X6H A;  2GW1 A;  1N54 A;  3LEW A;  3S7B A;  3P2B A;  1TJF A;  3TJP A;  4I6G A;  2WXO A;  2XPI A;  3HYM B;  5G05 C;  3CVQ A;  4PUC A;  4U0S A;  1HZ4 A;  1SQM A;  2YQ8 A;  3CVV A;  5LP0 A;  3KAE A;  1U3D A;  4HS2 A;  4WWP A;  4OVU A;  3BG0 B;  3CV0 A;  2XCC A;  3JCK C;  3L08 A;  4AJW A;  3ML9 A;  4OVV A;  3D9J A;  3FEY A;  2IF4 A;  2KCV A;  2X3M A;  4J8D A;  4UWK A;  5HI7 A;  2XHE A;  3CHM A;  4N3B A;  5D0O D;  3MKQ A;  2HM8 A;  2OOE A;  5FJY A;  3SGH A;  5C1D A;  4W9R A;  3I4G A;  1HG2 A;  3ESK A;  2YIN A;  2C0M A;  3SD5 A;  2V0P A;  3RJV A;  5BT1 A;  2UY1 B;  3EIQ C;  4Q69 A;  2UWJ G;  2FI7 A;  3RRU A;  2AVP A;  4I2Z A;  2GRM A;  3IHV A;  2IFU A;  5EKQ D;  4BWR A;  4GA2 A;  3P1U A;  3RO3 A;  5BW8 C;  3MKR A;  4AVX A;  5FZS A;  4DLO A;  4DPR A;  5E76 A;  2VTB A;  2MHK A;  4GA1 A;  3FUI A;  3TXN A;  4BT8 A;  3ZEF A;  3CVU A;  4GCO A;  3CHQ A;  3CHP A;  4N3C A;  3APC A;  5JJ6 A;  3N71 A;  1E96 B;  5AJD A;  1B89 A;  3FU6 A;  3OXG A;  4BTA A;  1LF8 A;  1EPU A;  4YVQ C;  2HO1 A;  4LER A;  5T4Y A;  5KJL A;  4ILI A;  4M3O A;  3NQP A;  2CFU A;  3CR3 A;  2XCB A;  4JC8 A;  2LNI A;  4EZJ A;  4J8E A;  4PDX A;  4IYP A;  2WXJ A;  3D9P A;  2WQ6 A;  4UI9 C;  4JEU A;  3UT4 A;  2BUG A;  3I3N A;  4I6J A;  4UQY A;  3HDX A;  4YVO A;  4J8S A;  3PRZ A;  4XE0 A;  2XQ0 A;  1W3B A;  3I5P A;  4GZ5 A;  4BSX A;  2RG8 A;  3BG1 B;  3CKC A;  4XI9 A;  4O6F A;  4AY6 A;  3FHE A;  3G2T A;  3RK6 A;  3FEX A;  1H0A A;  1JWF A;  3MCX A;  3ML8 A;  1UJJ A;  4GML A;  3FUH A;  3LKU A;  4KZC A;  3HIZ A;  3ONL A;  3ZVV A;  4DLQ A;  3CEQ A;  2AXV A;  2XGS A;  3IHY A;  3FTZ A;  3LS8 A;  2WXR A;  2X6I A;  4UWF A;  2V5F A;  2FO7 A;  3Q49 B;  2XRZ A;  2VQ2 A;  4AP2 A;  3HVE A;  2XGM A;  3MGB A;  5LCW J;  4LCT A;  2FEZ A;  1SZ9 A;  4CGV A;  1HS6 A;  4KBQ A;  2R17 C;  1JPL A;  2GRL A;  2WQH A;  4GZ6 A;  4EEC A;  4TV3 A;  1BPO A;  1JWG A;  3ZYQ A;  4GYY A;  4R7L A;  1JUQ A;  3D9N A;  3O48 A;  4WNE A;  1OWL A;  3CVN A;  5FZR A;  3O4Z A;  4XKC A;  5E75 A;  5EX0 A;  3IEG A;  3FUM A;  3PS6 A;  4UI9 K;  5CCM A;  3MKQ B;  4B0Z A;  3UT8 A;  2Y4U A;  3CVW A;  3LCA A;  2PQN A;  4GZD A;  3ESL A;  4UWL A;  3PEU B;  4CCA A;  1UJK A;  4KVM A;  5FTP A;  2GGF A;  3QC1 A;  3TXM A;  3ZYL A;  4EZK A;  3UQ3 A;  4UWG A;  2VSN A;  3SBS A;  3OXF A;  1Z3Y A;  2VGY A;  3PVL A;  4FU3 A;  5FT9 A;  2R5S A;  3B7R L;  4GU5 A;  2KM4 A;  3QAR A;  5G2N A;  2LAI A;  4GAA A;  4ANW A;  4ANU A;  4G23 A;  2LSV A;  4XKB A;  3KD7 A;  2DBA A;  2J49 A;  4HOR A;  2CHX A;  4I6E A;  1PAQ A;  4U0U A;  3CVP A;  3CHO A;  3T8M A;  3AS4 A;  3RIB A;  4E85 A;  4UWH A;  1Z3X A;  4J0U A;  4G2V A;  1KT0 A;  3L54 A;  3LJ3 A;  4XI0 A;  4I1A A;  4PH4 B;  3LY8 A;  3IKO B;  5AIJ A;  3LY9 A;  3PUJ A;  5KJM A;  3CVL A;  2J4B A;  3S2A A;  1EYH A;  2HR2 A;  2I1K A;  3GZ1 A;  4GA0 A;  2AW6 A;  3PE4 A;  2WXH A;  4FHJ A;  1INZ A;  3JUI A;  4APO A;  4CRW A;  4G26 A;  3CHR A;  3PZD A;  4C0M A;  3ZW3 A;  3QB2 A;  2V8S E;  5KCM A;  4KXK B;  2FF4 A;  3FTX A;  1HF8 A;  3CGH A;  4HFG A;  2VJ8 A;  3L6A A;  4FJZ A;  4XZ4 A;  3NZU A;  4RG9 A;  5A7D B;  4I9E A;  3ZYM A;  2QY7 A;  4FUL A;  3FFL A;  3FU5 A;  3HVE B;  5C2Y A;  4WAF A;  3ASD A;  1E8Y A;  2R59 A;  3E4B A;  4B8C B;  2NXP A;  1OWP A;  4N3A A;  4I1M A;  3PNL B;  2CG2 A;  2OVB A;  4JXT A;  3CK8 A;  4RG6 A;  3JQ0 A;  3B7S A;  4F3V A;  4UQZ A;  4AIF A;  2VYI A;  4FJY A;  4BFR A;  3G2V A;  3VTY A;  4WUY A;  5D0Q D;  5BNW A;  5DIZ A;  4KVO A;  4N2Q A;  3I4R B;  1E90 A;  4DK5 A;  2IQC A;  4H7X A;  2WXN A;  3QWW A;  3LVR E;  2KC7 A;  2ZU6 B;  2WMN A;  3UX4 A;  2IJG X;  4UI9 J;  1E7U A;  1E7V A;  4F1S A;  3EIJ A;  3FUK A;  4F53 A;  1E8Z A;  1QQE A;  5G04 J;  5G55 A;  5J08 A;  4FLB A;  1Y6I A;  2OND A;  2WVI A;  2PZI A;  3QKY A;  5CMY A;  5EX3 A;  4CDN A;  3L17 A;  4N2S A;  3EHN A;  2L9B A;  3G2W A;  4JHR A;  1HXI A;  3CK9 A;  1HH8 A;  4KT6 B;  4MRU A;  3GYZ A;  2XRY A;  3PNT B;  3FUL A;  3L13 A;  1XGW A;  2CG3 A;  3HHM A;  3KEZ A;  4A1G A;  3KS2 A;  4KYO B;  3GW4 A;  3G2S A;  2EQX A;  2WPV A;  3CIA A;  3G2U A;  3AU4 A;  2DIW A;  3U4T A;  1WY6 A;  5CHE E;  5G04 C;  4HVB A;  1HX8 A;  5FQ6 A;  2X6F A;  4CT4 A;  1HE8 A;  1XNF A;  4I1O B;  3ZHE B;  3ZFW A;  4IRU A;  4A3T A;  1ELK A;  4NQ0 A;  2Y4T A;  3VLF A;  4JEH A;  1H6K A;  2WXL A;  4GYW A;  4HXI A;  1HO8 A;  3APD A;  2FBN A;  3UMV A;  4ILG A;  2MOW A;  4AOF A;  3MV2 B;  5FWQ A;  4C9B B;  3FUN A;  3ZN3 A;  2LSU A;  2YNQ A;  3ASG A;  4A1S A;  4G25 A;  5FQ8 A;  5FZQ A;  3VTX A;  1QZ2 A;  4WND A;  3SI5 A;  2NSZ A;  2J4D A;  3ZGQ A;  4AV7 A;  1KLX A;  4EPZ A;  2I6H A;  4WNF A;  1TEZ A;  3QOU A;  3WXX A;  1KT1 A;  2L6J A;  4Y6C A;  5ANL A;  2WM9 A;  2J9Q A;  4U0Z A;  1FCH A;  4JW1 A;  5FQ7 A;  4OYS A;  3RRM B;  4GZC A;  3R9A B;  3FTU A;  2I1J A;  2A5U A;  2YHC A;  3JQ1 A;  3FU3 A;  5CMW A;  1WAO 1;  3LY7 A;  4N5C A;  3FTY A;  2AXU A;  3C98 A;  4PS8 A;  3OTN A;  4K0R A;  3ZRH A;  3FH8 A;  2VSO E;  5JHB A;  2KCL A;  4AM9 A;  1YA0 A;  4J6I A;  5ARF A;  3RU0 A;  5T3R A;  5BV1 A;  3RKV A;  4JHJ A;  4TUU A;  4GYO A;  2VGX B;  1H2T C;  1OWM A;  2J08 A;  3EHM A;  3FUF A;  4PS7 A;  2ILR A;  3PE3 A;  4L7T A;  3RRN B;  2QFC A;  2DCP A;  4URK A;  4K03 A;  2A4Z A;  2ION A;  4BT9 A;  3APF A;  2X6K A;  4DJA A;  5ENN A;  2PL2 A;  3MX3 A;  4MKT A;  2VSY A;  1NZN A;  2LO6 A;  3LYA A;  4ME2 A;  5A6C A;  4N39 A;  3PDN A;  4ILH B;  3S7J A;  2NC9 A;  3D9O A;  3Q5M A;  2WXF A;  2WXP A;  4XIF A;  4GZ3 A;  3ZHE A;  1QNF A;  3ZPJ A;  3D9I A;  2IOL A;  1H19 A;  3QAQ A;  3BEE A;  1L5J A;  3FUE A;  3FWV A;  3B7U X;  5BUZ A;  3IV0 A;  2MRI A;  3CQG B;  4FLH A;  3T5X A;  4A3V A;  5JJ7 A;  2PQR A;  1UN9 A;  3Q47 B;  3FTS A;  5AYW D;  2CFZ A;  2V4L A;  4CDM A;  5LX8 A;  1MHQ A;  3CST A;  4RVB A;  1OWO A;  3NZS A;  4FHK A;  4G1T A;  1HU3 A;  2OVF A;  3AU5 A;  2X6J A;  2YHE A;  4B94 A;  1VDY A;  3U64 A;  3MJW A;  1OUV A;  4ABN A;  4U04 A;  3CVX A;  4ANX A;  4JA7 A;  5J90 A;  1ZU2 A;  4EZL A;  5ANR A;  3R7Q A;  2J09 A;  3GZ2 A;  2L0I A;  3MEK A;  1IQR A;  1U3C A;  5BPP A;  3ULQ A;  4GB9 A;  2E2E A;  3FU0 A;  4PS3 A;  4LUN U;  3LVQ E;  4EBA G;  3U66 A;  3AS5 A;  5BV0 A;  1S0P A;  4HOS A;  3PH0 C;  4JHK A;  3FH5 A;  3VLD A;  3U9W A;  3SFZ A;  2KZT B;  2XPZ A;  4B8A A;  1NA3 A;  2Y3A A;  3MV3 B;  2M63 A;  1WM5 A;  2VSX E;  4JA9 A;  1H2U A;  2E0I A;  3EJN A;  2VGX A;  4APF A;  4GMJ A;  3S7D A;  4JPS A;  4MS6 A;  4DI3 A;  3QWV A;  5KJN A;  4E6H A;  4U63 A;  4J8F A;  4KZ0 A;  4F7A A;  2Q7F A;  3PRE A;  4I2W A;  4G24 A;  4WWN A;  4EQF A;  2WXM A;  3DPD A;  1SZA A;  3FTW A;  5CCL A;  1FVH A;  3B13 A;  3VLE A;  4GPK A;  4JVS A;  3SBT B;  3QWP A;  2CHW A;  3CHS A;  3FUD A;  4UQX A;  4I43 A;  5AJL A;  2WXQ A;  1HG5 A;  4L23 A;  2RD0 A;  4G11 A;  4I17 A;  5A23 A;  1MQS A;  3CQC B;  3PEV B;  2C0L A;  3CSF A;  3D9M A;  3MZL B;  5HQ8 A;  2AWI A;  3U3W A;  3URZ A;  3RO2 A;  2WXG A;  4BY6 A;  2WQ7 A;  2X38 A;  3FY4 A;  1TJC A;  5T8I A;  3CVY A;  4KMO A;  3CKB A;  1OWN A;  3CK7 A;  4Q94 A;  4L2L A;  1DVP A;  3K9I A;  1ELW A;  4L1B A;  5FQ4 A;  3R7R A;  2XPY A;  3Q4A B;  4EBA A;  3SZ7 A;  4RSY A;  3LDZ A;  1UW4 B;  2PM6 A;  3FDH A;  4BX9 A;  3ZXS A;  3QDN A;  2IU1 A;  2JLB A;  4TRQ A;  4WNG A;  3ZIM A;  4ACK A;  3NF1 A;  2WMO A;  4L2Y A;  1ELR A;  1EDU A;  1IHG A;  2KCK A;  5ARG A;  3CLJ A;  1DNP A;  2KZT A;  3JYS A;  4CDR A;  4FP7 A;  3FH7 A;  3ENE A;  1IQU A;  3L22 A;  4XX5 A;  4LRZ A;  2IOS A;  3ASH A;  3MYV A;  4FC8 A;  3TAX A;  3ZYK A;  4FA6 A;  3FUJ A;  1NA0 A;  5LOZ A;  4AY5 A;  4Q96 A;  2XEV A;  3QJZ A;  3T5V A;  2BTD A;  3MA5 A;  1Z6T A;  1Y8M A;  3FTV A;  3TG5 A;  4AXH A;  4ACL A;  4HOQ A;  4DI4 A;  2WB2 A;  2LAH A;  4B89 A;  1GW6 A;  5JJT A;  3QNK A;  3DBS A;  4QFV A;  4MLP A;  3LXU X;  3OXL A;  5DBK A;  3EDT B;  3IBE A;  4I9C A;  4D10 C;  3ASF A;  2JEK A;  4C0E A;  4U8H A;  4HOU A;  4H7Y A;  4YND A;  3TL5 A;  1E8X A;  4NRH B;  5LFA A;  1PY1 A;  4V3I A;  1UG3 A;  3UUX A;  5KJK A;  3UT7 A;  2UY1 A;  4U07 A;  1UN8 A;  5EDS A;  1IYG A;  2BF0 X;  2WXK A;  3L16 A;  4HOT A;  1X5B A;  2P58 C;  4JZY A;  1N52 A;  2HYZ A;  4BX8 A;  4CGW A;  5JHA A;  5LCW C;  2I2O A;  3LPZ A;  4FAD A;  4GCN A;  4ANV A;  1HFA A;  3UPV A;  4CEM A;  4JL0 A;  4IN3 B;  4ATG A;  3QK0 A;  4AEZ C;  1P5Q A;  1EF1 C;  2I9C A;  4IUL A;  5AEN A;  1A17 A;  4P29 A;  1PC2 A;  4NAC A;  3GZS A;  3SHF A;  4LEU A;  3AS8 A;  1ZBP A;  3D9K A;  4A55 A;  2FUL A;  4NUR A;  1NP7 A;  3ONK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...