2RG8A

Crystal structure of programmed for cell death 4 middle ma3 domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
b'GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 4
publication title PDCD4 inhibits translation initiation by binding to eIF4A using both its MA3 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, translation
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2rg8A00
1HU3A 2VSOE 4CEMA 1PAQA 3FEXA 2IOSA 3RK6A 4C9BB 2KZTB 2IONA 4CT4A 2NSZA 3JUIA 3L6AA 2ZU6B 2FULA 4B89A 1N54A 4JHJA 2RG8A 2I2OA 4CRWA 1H2TC 4B8CB 4B8AA 2VSXE 3EIQC 1H6KA 4LUNU 3EIJA 4GMJA 4IULA 4GMLA 2KZTA 2GGFA 1UG3A 1H2UA 4JHKA 3FEYA 1H2VC 2IU1A 1UW4B 2IOLA 5ANRA 2HM8A 3D3MA 1N52A
chains in the Genus database with same CATH superfamily
1V55E 4JB8P 2L9BA 5A7DB 5E76A 4URKA 4GCNA 3DSWA 2QYJA 5BPPA 2Y4UA 2ZXWE 4GA2A 5AYWD 4BX8A 4HI8A 3DBSA 3L13A 4RG6A 3SGHA 5EYLA 3QAQA 2OV8A 2AJAA 2IONA 2NXPA 5KNGA 3AJIA 3PZDA 4B8CB 3K9IA 3MV3B 1YMPA 2MOWA 5JMND 1OCZE 3D9MA 3CQGB 3SBSA 4ZHBA 5EYPF 3ZYLA 3JUIA 2J08A 4B93B 4JA9A 3RJVA 2YHEA 2RD0A 3U66A 1LF8A 1Z3XA 3ZXSA 3CEQA 4GZ3A 3GZSA 3Q9NC 2BTDA 3UIOC 1TNOA 2UWJG 3LDZA 2ZGGA 3PRZA 2QY7A 3UQ3A 2QC9A 3U4TA 2DZNA 3ENEA 4I1OB 2KZTA 2WXIA 2XEVA 2P9IG 4V3IA 5AAOA 1XNFA 5G05C 2XEHA 4U04A 2PQNA 2XGSA 2OVBA 5FQ8A 1U3CA 1QNFA 2VGXA 4DLQA 2FF4A 5D0OD 1BI7B 3LY9A 3W9FA 2AW6A 1H0AA 2FI7A 4H7YA 4FU3A 5B3SE 2HO1A 3AG2E 5CERB 4U0ZA 5J90A 4LNUD 4DLOA 4EZKA 4FJZA 4N2QA 4UI9J 4M3OA 2DYSE 3BG1B 3AS8A 1TNZA 1TNUA 1JPLA 1D8DA 4JL0A 5CRUA 4F1PA 4UWFA 3KEAA 2KZTB 5FJYA 4L2YA 1JWFA 4GYYA 1E7VA 3HDXA 1OY3D 3IV0A 2IFUA 4ILHB 2R03A 1WM5A 1DNPA 4NURA 1L5JA 2EILE 2VGXB 1HXIA 3ZN3A 2IOLA 4APOA 5G04C 3X2QE 3ABME 1N0RA 3ZVVA 5JJ6A 3CR3A 4DX7D 2DBAA 4C48B 3FY4A 2HR2A 2ETAA 3LYAA 3N71A 2XS1A 2LAHA 3IKOB 3RO2A 3CLJA 3Q79A 1NFIE 4F53A 4HOTA 4XE0A 1G3NB 3V2XA 5AARA 4U07A 1E8ZA 4U0SA 2H6HA 4L2LA 1TR4A 2WB2A 2WXFA 4G26A 3PUKA 4B89A 4JHRA 1ELWA 3FUHA 4MS6A 3CGHA 2FEZA 3SY2A 3T5VA 1UW4B 3NQPA 2I1JA 4W9RA 3AU5A 3I4GA 4K0RA 3RK6A 3QOUA 3CHMA 3UKUG 2X6FA 1JCRA 4N5CA 1SA4A 2Y4TA 2XCBA 4O6FA 4TXQA 1N94A 1Y8MA 4MBGA 4LRZA 3ZU7B 2V0PA 5BT1A 5AJLA 4JPSA 3UTMA 4DK5A 2VSOE 4EZLA 3AU4A 5FZQA 5CCLA 4LNGA 4G23A 1BI8B 4JZYA 5A23A 3E30A 3TXNA 1OWOA 4G2VA 4XI9A 4HBDA 4HI9A 3TWXA 1OCRE 3UM1A 1EDUA 5HS0A 3FU6A 1NL4A 1NA0A 4DJAA 2B6CA 2I9CA 3CQCB 4GPKA 4BSZB 4WNGA 1W3BA 1D9SA 5ENQD 1TN8A 1YCSB 4BY6A 4CDNA 2ILRA 3DSVA 1QZ2A 2LXMA 4DI3A 2XHEA 2F0YA 2Y0BG 3MA5A 5G04J 1PY1A 4AVXA 3Q78A 4R7LA 3TJPA 1HO8A 2GRQB 2RFMA 2J8SD 5DIZA 2WM9A 1HU3A 4I1AA 3U64A 2OCCE 4KZ0A 3GW4A 2EIME 3LJ3A 4LG6A 3ZHEA 4WNEA 1H6OA 3HG0D 4HOUA 1HF8A 1MHQA 3F6QA 3CHSA 4DX2A 4AOFA 2GRNB 2V4HC 3ASOE 4IYPA 1D8EA 3ASNE 5C2YA 4DX5D 1MZCA 2VSYA 4HLEA 4F6RD 1O1RA 4DRXE 3ONKA 4GB9A 2FO1E 3OTNA 4FADA 4FA6A 3FU3A 3FP3A 5G55A 2NC9A 2KBXA 3EHMA 4LNBA 3ZYQA 1MYOA 3SO8A 4HB5A 3ZHEB 4TRQA 5ANLA 3BEEA 3TL5A 2P9LG 1FPPA 4IN3B 5B1BE 4G25A 1U3DA 1JWGA 3FTXA 2YINA 4GMLA 1BPOA 3EDTB 3I3NA 3HXDA 3DPYA 4J8FA 2X6HA 3ZPJA 1TJCA 2PQRA 4A3VA 3GZ2A 1TN7A 2WQHA 3HHMA 1E8XA 3APDA 1O1SA 4EHMA 1DCEA 4EPZA 3PZ4A 3BG0B 4OAVB 1A5EA 1S64A 4HORA 2GRLA 3EHRA 4I2WA 1FT1A 3FTUA 3I5PA 4A1GA 3AS5A 4GZDA 4I6JA 2MYOA 3B95A 2WXMA 1N4PA 3LXUX 4GTVA 3ZRHA 2XPIA 5EIDA 3EU9A 5EDSA 4I2ZA 4YVOA 1E96B 3C3QA 4LERA 3PNTB 4WWPA 4AM9A 2WXOA 4XX5A 4HOSA 3G2WA 1E8WA 4GZ5A 4OVVA 4YDEA 3MYVA 5DBKA 3DXKG 2A5UA 3LY7A 1XGWA 3Q9UC 5C1DA 2XZDG 3R9AB 1IKND 2UY1A 4J0UA 1QQEA 3OXLA 2YQ8A 5ANRA 2OEVA 2Y1LE 5A6CA 1V54E 3UINC 2GW1A 3G2SA 3RRMB 4UI9C 2FBNA 3FUEA 1N54A 2PZIA 3LJNA 3Q49B 3DSXA 1SVXA 3B13A 4EECA 2V8SE 3DXMG 3DPDA 3APFA 4F1SA 2WXKA 3G2UA 4EBAG 1Y6IA 2DIWA 1OWMA 2XPYA 5D66A 1UJKA 3B7UX 3KSLA 2BKGA 2RFAA 2OVFA 4N3AA 1DCQA 4YNDA 3LS8A 2GRPB 3G2TA 3DWLG 5JA4D 1NI1A 2Y69E 1S70B 2L6JA 2UY1B 2AXVA 2CFZA 4NACA 5T4YA 4EZJA 4GMJA 2VSNA 2J9QA 2WXPA 5BV0A 5EKQD 5AQ9A 4UUCA 3JXJA 3CSTA 4K5BA 3DRAA 2P9SG 3L6AA 4KZCA 3UXGA 1EPUA 4G24A 5G2NA 4E6HA 2IQCA 3ULYA 3CHOA 3Q5MA 3JQ1A 3CSFA 3PUJA 3DSUA 3CHQA 3D3MA 4MLPA 3T8KA 3VLDA 3TWSA 1HZ4A 2XRZA 3PE3A 3RIBA 3FUIA 5E75A 2CHWA 4GCOA 2MHKA 3EUVA 3D9OA 4HOQA 3ZYMA 4FLHA 3MCXA 2IU1A 3FULA 2WQ6A 4Q94A 3CKBA 4RSYA 1LD8A 3FDHA 4BEPA 1O5MA 4BT9A 5BV1A 2EINE 4KVMA 4UWHA 3I4RB 1SW6A 3B7BA 5FQ4A 3TWTA 3FUJA 3S2AA 3QWVA 2ETBA 1UN9A 3FUFA 4GTOA 1X5BA 2PL2A 4I6EA 2F8XK 4CDMA 4BERA 3CK7A 2H6FA 2KATA 3NAWA 5IY5E 4J6IA 3FUNA 5LFAA 1ELKA 2BEDA 4AY6A 2F8YA 3PDNA 3EU5A 3DEOA 3QJZA 3FHEA 5HQ8A 3FH7A 4UQYA 3QWWA 1TJFA 1YA0A 4CGVA 5AIJA 1OT8A 5LP0A 3TXMA 5FQ6A 3D9PA 5CEAA 2XGOA 4XKBA 4O1OA 5KJMA 4RVBA 3LKUA 2DWZA 2VTBA 4JHKA 2LSUA 3CHPA 3LEWA 4GA0A 3PZ1A 2OEWA 3E37A 5FZRA 2NSZA 5AJDA 5FZSA 4TXRA 3VLEA 4E85A 1SA5A 3FUKA 1KT1A 4GTPA 4LUNU 5CHEE 5KJNA 5ARGA 4N3BA 2BF0X 1MX6A 3J5PA 2CG2A 3Q73A 2IO3C 3MGBA 1ELRA 2R02A 1LD7A 3SQVA 4U8HA 1IHBA 3L17A 3PZ3A 3QB2A 2VYIA 1K1BA 2IOSA 1E90A 2KC7A 3T8MA 3D9HA 2WXGA 3HXCA 4CRWA 2IY0C 3ASGA 3R9MA 1IYGA 5EX0A 4ILIA 2J49A 1H2VC 4I1MA 3B7SA 3RRNB 4GZ6A 5BW8C 4CCAA 1HX8A 3W9GA 5M72A 4U7EB 2VTBB 4HVBA 5KWDA 3FTYA 4U95D 2E0IA 5EIBE 3MKRA 1KZOA 1H6KA 2EIJE 3VTYA 1INZA 3T5XA 4FLBA 1KZPA 5EX3A 2H6IA 2KCVA 3ZGQA 1WG0A 2WXRA 3KAEA 3KEZA 3C5RA 4JEUA 4YDWA 3APCA 4I17A 2WMOA 3LVRE 1OWPA 4QFVA 3BQOA 4YDOA 1IQUA 3CHRA 4MKTA 4UWKA 3CVVA 4U8VD 3O48A 2H6GA 3C72A 1IXVA 4N5QA 4HNAD 2P9NG 3CVQA 1QBQA 3UM0A 4CT4A 1N4SA 5LCWJ 2LSVA 4GA1A 3ULEG 1JCQA 3HRAA 4GYOA 5JJ7A 4BSXA 2DCPA 2FO7A 4HFGA 2AXZA 1N4QA 3PEVB 3QNKA 2QFCA 4WWOA 4DX1A 3FEXA 3SFXA 4FULA 3AS4A 4U63A 3G2VA 2I2OA 2C2LA 4JC8A 3SD5A 3AAAC 4N3CA 1OXJA 3CVLA 4GPMA 4CDRA 1TNYA 4J8SA 5JHAA 5BUZA 1S0PA 1Z6TA 3T9KA 4ANUA 5BNWA 2DZOA 3MEKA 3TWVA 4FC8A 1WY6A 2DYRE 1E8YA 4AIFA 4OYSA 3VTXA 2GRRB 3NOCD 2WPVA 2YNQA 3LCAA 3ULQA 5AQBA 4HLLA 5D2MC 3O4ZA 4B0ZA 1AWCB 4G1TA 4Y6CA 4WNFA 2I1KA 4LCTA 3TG4A 5FINA 4GAAA 4ANXA 5BXUA 1DC2A 2EIKE 4U0UA 2V5FA 2JLBA 3MZLB 1PAQA 3S7FA 4J8EA 5T3RA 1BU9A 3P1UA 2L0IA 4RG9A 3SHFA 3PH0C 3IHYA 4HRNA 4IULA 4BWRA 2IJGX 3NZSA 2EQXA 3FEYA 1S63A 3SFYA 2HM8A 3MX3A 2J4BA 3UM2A 3HYMB 3L08A 1WAO1 5CRVA 3UM3A 4BFRA 4P29A 4J8YA 3EHNA 2RKKA 5ENPD 4I9CA 2X38A 4NRHB 3ESKA 1TEZA 3ONLA 4GTQA 4OVUA 1Q2ZA 4L23A 2KCLA 5EILA 4AP2A 4MRUA 4PS3A 5KJLA 4RQIA 4A63B 5CMWA 2P2CP 3LY8A 1BD8A 2QYUA 4ABNA 3ZKJA 2IEJA 5LOZA 2R17C 1Z5SC 1MJ0A 3OXGA 2X6KA 3CK8A 1ZB1A 2L6BA 3TAXA 3SF4A 2BKKB 3QK0A 5KJKA 3ML9A 4CGWA 4CZ2D 2ETCA 2F37A 3KD7A 3HVEA 5AQ7A 3CVXA 4N39A 4IRUA 3CVWA 4LEUA 4YVQC 2PM6A 2V4LA 3HIZA 3FUMA 2CHXA 1SZ9A 3UT4A 2R2LA 4KMOA 3UUXA 4ANWA 2MRIA 5CECB 3FU5A 4NIKA 3LVQE 1N11A 5AENA 4GZCA 3D9LA 3IBEA 5LX8A 4KBQA 3UT7A 4PDXA 3CVYA 4F3VA 4FP7A 4B94A 2LUHA 4BTBA 4Q69A 3RRUA 4LSZE 5HKPA 1H2TC 3V79K 3EHQA 3ZIMA 1KPSB 3B7RL 3HVEB 3NF1A 1NZNA 4ACKA 4CT0A 4DX6D 4X8QA 1UN8A 2YHCA 1AP7A 2E2EA 1N95A 1DVPA 4B8AA 2J07A 2WQ7A 4L7TA 5ENOD 4BTAA 5FTPA 3DEPA 2XQ0A 3DSTA 3NOGD 2WMNA 4H7XA 3FH5A 1OUVA 2IO2C 3IXEA 4AXHA 3FTSA 2AWIA 4JD2G 3L9TA 2WXNA 4CYMD 4J7WA 4K5AB 4D10C 3HXEA 1A17A 4A3TA 2WXJA 2B0OE 1NP7A 1K8KG 4C9BB 2PNNA 2XPZA 2AVPA 3BU8A 3E34A 3URZA 3FFLA 3FTWA 4HQDA 1K3ZD 5T8IA 2R5SA 2IF4A 1UG3A 4AJWA 3JCKC 4KVOA 4K03A 3PREA 4TUUA 3AG3E 1FVFA 3IHVA 5CMYA 5FT9A 3WXXA 3AG1E 4G8LA 2X6IA 4GMRA 3RU0A 1MX2A 2CHZA 3CV0A 5J08A 1H2UA 1JUQA 4JXTA 3ZW3A 4CEMA 4WAFA 3C98A 4EQFA 5JHBA 3HXFA 5ENSD 4JA7A 3E32A 5HRYA 4RLYA 1EF1C 3TWQA 2GRMA 3U3WA 5LCWC 2Q7FA 2P9PG 3CKCA 3U9WA 4FHJA 4GU5A 3S7BA 4BETA 2VGEA 2OOEA 3QKYA 4G8KA 2RG8A 5ITZF 3S7DA 3ASFA 3EIJA 1FVHA 4BESA 1O1TA 1OCCE 2ONDA 3E33A 4DI4A 3LPZA 3JQ0A 4M7CA 1VDYA 2X6JA 2ZIRA 1Z3YA 3FWVA 2CG3A 3QWPA 4JEHA 3SFZA 3Q47B 1SZAA 3S7JA 1P5QA 2JEKA 4GTMA 3SBTB 5CEDB 5ARFA 3ABLE 3UPVA 3ESLA 3NB2A 4UQZA 2ZISA 3FUDA 3ZNGA 4U8YD 3PS6A 3ZFWA 3E4BA 1K1AA 4EBAA 3CK9A 1OWNA 5CBOA 5FIOA 3OAWA 5AQAA 3J5QB 2C0LA 5EN5D 2J09A 3Q7FA 2DVWA 2HYZA 3JUEA 3QDNA 4XKCA 4A1SA 2WXQA 3ISMC 2A5EA 2KXPC 4WUYA 3ABKE 2NYJA 3UX4A 3L16A 4JHJA 4UWGA 5G05J 2VSXE 3SZ7A 3EIQC 3TWRA 4ATGA 1U2VG 1HS6A 4UQXA 4JW1A 4TV3A 3UKRG 3V31A 3FTVA 4JVSA 3C3OA 1E7UA 2X3MA 5JJTA 1HFAA 3L54A 2FULA 3C3RA 4I9EA 4TUMA 4Q96A 3UI2A 1FCHA 1QYMA 3UIPC 3ZUVB 3PE4A 2VJ8A 3RAUA 4Z68A 5FQ7A 5HI7A 4ZFHA 5ENRD 1FT2A 4BX9A 3KSQA 3CVUA 1H19A 2WVIA 5CCMA 2ZGDA 3ZEFA 3L22A 2P58C 3D9KA 4KXKB 4PUCA 4WWNA 1WDYA 2Y3AA 2XGMA 1OCOE 4HXIA 3RO3A 3Q15A 4J8DA 1N52A 3PZ2A 2CFUA 1HG2A 1OWLA 3P2BA 2LXLA 2XEEA 2WXLA 4XI0A 3KS2A 3D9JA 3TG5A 2AXUA 3GZ1A 2M63A 4GTRA 3PEUB 1UOHA 4ME2A 4Y6WA 3BUAA 1HE8A 4DPRA 2LAIA 3PVLA 2XS8A 4YDYA 5KCMA 3TWWA 1B89A 4WNDA 2L0TB 3CVNA 2VGYA 4L1BA 2XZTG 2R59A 4O1PA 1KLXA 4K5CA 2KM4A 3QARA 2XRYA 3UMVA 5KBAA 3D9IA 3ASHA 3EJNA 1GW6A 2JABA 3Q4AB 4TXPA 3IEGA 1X81A 4A55A 4XIFA 3ML8A 1JCSA 4ANVA 3JYSA 3L82A 1RW2A 1RZ4A 3FU0A 3NBNB 3VLFA 1TNBA 3MKQA 2P9KG 1SQMA 3PNLB 2C0MA 1LTXA 3R7RA 4AV7A 3Q75A 4UI9K 1N4RA 2V5QC 3MJWA 3ZYKA 5BXOA 3UT8A 4C0MA 4GTTA 3FH8A 4PS7A 3QC1A 2BUGA 2XENA 3V2OA 4GYWA 3TGOA 4C0EA 4KYOB 2PM7A 3NZUA 4L9PA 3WG7E 1N0QA 3CVPA 2LO6A 1HG5A 4XEIG 3SI5A 1NA3A 1PC2A 2QZAA 1N9AA 4FJYA 4AEZC 4APFA 3GYZA 4PS8A 1ZU2A 3RKVA 5KNHD 4DUIA 4U96D 5AN8A 5CBNA 4AY5A 5H7PA 2GROB 2LNIA 1UJJA 3MKQB 1TN6A 1H6PA 5B1AE 3D9NA 3MV2B 2ZU6B 3ASDA 4QQIA 4HS2A 4F7AA 2J4DA 4HRLA 4KT6B 5D0QD 5FWQA 4I6GA 2VQ2A 3OXFA 1IHGA 2WXHA 3SNXA 2HE0A 1MX4A 4ACLA 1ZBPA 4NQ0A 2KCKA 4OAUC 4FHKA 1TYQG 1MQSA 2I6HA 3RSEG 3B7TA 4ATZD 3ZXPA 1KT0A 2R05A 2XCCA 3R7QA 4ILGA 4O60A 4UWLA 2GGFA 4PH4B 3HXBA 5ENNA 4GTSA 4XZ4A 3CIAA 1YYHA 3Q7AA 4N2SA 4HRMB 3AG4E 2A4ZA 4I43A 4BT8A 1HH8A 4G11A 1EYHA 3TWUA 3V30A 5ENTD 3JXIA 2P9UG 3FTZA 1BLXB 1IQRA 3DSSA
chains in the Genus database with same CATH topology
5ANLA 2KCVA 3BEEA 3TL5A 3ZGQA 4CEMA 2L9BA 2WXRA 5A7DB 3KAEA 4IN3B 3KEZA 4WAFA 5E76A 4URKA 4JEUA 4G25A 3APCA 4GCNA 4I17A 1U3DA 3C98A 1JWGA 3FTXA 2WMOA 3LVRE 1OWPA 4QFVA 5BPPA 2Y4UA 2YINA 4EQFA 5JHBA 4GA2A 4GMLA 5AYWD 4JA7A 1BPOA 3EDTB 1IQUA 3I3NA 4BX8A 3DBSA 3CHRA 3L13A 1EF1C 4RG6A 2GRMA 3SGHA 4MKTA 4UWKA 3U3WA 3CVVA 3O48A 5LCWC 4J8FA 2Q7FA 3QAQA 2OV8A 2X6HA 3ZPJA 3CKCA 1TJCA 2PQRA 3U9WA 4FHJA 4GU5A 2IONA 4A3VA 2NXPA 3CVQA 3GZ2A 3QKYA 2OOEA 3S7BA 4CT4A 5LCWJ 2LSVA 4GA1A 2WQHA 2RG8A 3HHMA 3PZDA 3S7DA 1E8XA 4B8CB 4GYOA 3K9IA 3ASFA 3APDA 3EIJA 3MV3B 2MOWA 5JJ7A 1FVHA 4BSXA 2DCPA 4EPZA 3D9MA 2FO7A 4HFGA 2AXZA 3CQGB 3SBSA 3PEVB 3BG0B 3QNKA 2QFCA 4WWOA 2ONDA 4DI4A 3FEXA 4HORA 3LPZA 4FULA 3JQ0A 2GRLA 3AS4A 4U63A 3G2VA 3ZYLA 1VDYA 3JUIA 4I2WA 2J08A 2X6JA 1Z3YA 3FWVA 2I2OA 2CG3A 4JA9A 3RJVA 3QWPA 2YHEA 2C2LA 4JEHA 3FTUA 2RD0A 3U66A 3I5PA 3SFZA 1LF8A 4A1GA 3Q47B 1SZAA 4JC8A 3S7JA 1Z3XA 1P5QA 2JEKA 3SD5A 3ZXSA 3AS5A 4N3CA 3SBTB 5ARFA 3CVLA 3UPVA 4GZDA 4I6JA 3ESLA 4CDRA 3CEQA 4GZ3A 3GZSA 2BTDA 4UQZA 4J8SA 5JHAA 5BUZA 3FUDA 2UWJG 1S0PA 1Z6TA 3PS6A 3LDZA 3ZFWA 3E4BA 2WXMA 3LXUX 3ZRHA 3CK9A 3PRZA 4ANUA 4EBAA 5BNWA 3MEKA 2QY7A 2XPIA 3UQ3A 1OWNA 4FC8A 5EDSA 1WY6A 4I2ZA 4YVOA 3U4TA 3OAWA 3ENEA 4I1OB 2KZTA 1E96B 2C0LA 1E8YA 2J09A 2WXIA 2XEVA 4OYSA 4AIFA 4LERA 3PNTB 4WWPA 3VTXA 4AM9A 2WXOA 2HYZA 4V3IA 4XX5A 3QDNA 4XKCA 4HOSA 2WPVA 4A1SA 1XNFA 2WXQA 2YNQA 5G05C 3G2WA 3LCAA 1E8WA 4U04A 4WUYA 2PQNA 2XGSA 2OVBA 5FQ8A 3ULQA 4GZ5A 1U3CA 4OVVA 1QNFA 3MYVA 2VGXA 3O4ZA 4B0ZA 3UX4A 4DLQA 4G1TA 3L16A 4JHJA 4Y6CA 4WNFA 4UWGA 5G05J 5DBKA 2FF4A 5D0OD 2I1KA 4LCTA 2A5UA 2VSXE 3SZ7A 3LY7A 1XGWA 3EIQC 3LY9A 5C1DA 2AW6A 1H0AA 4ATGA 3R9AB 4J0UA 2UY1A 2FI7A 3TG4A 1HS6A 4H7YA 4UQXA 4FU3A 4JW1A 1QQEA 3OXLA 4GAAA 4TV3A 4ANXA 2YQ8A 5ANRA 2HO1A 4U0UA 5A6CA 2V5FA 2JLBA 3FTVA 4JVSA 3MZLB 1E7UA 1PAQA 2X3MA 3S7FA 4J8EA 2GW1A 3G2SA 4U0ZA 5T3RA 3RRMB 5JJTA 3P1UA 5J90A 2L0IA 1HFAA 2FBNA 4RG9A 4UI9C 3L54A 3FUEA 4DLOA 2FULA 4EZKA 1N54A 4I9EA 2PZIA 3SHFA 3PH0C 3Q49B 4FJZA 4Q96A 1FCHA 4N2QA 3PE4A 4UI9J 4M3OA 2VJ8A 3B13A 3IHYA 4IULA 4EECA 4BWRA 2V8SE 2IJGX 3AS8A 2EQXA 3BG1B 3FEYA 3NZSA 5FQ7A 3DPDA 5HI7A 4BX9A 2HM8A 3APFA 1JPLA 4F1SA 3CVUA 3MX3A 2WXKA 3G2UA 4JL0A 1H19A 4EBAG 1Y6IA 2DIWA 4UWFA 1OWMA 2KZTB 2WVIA 5FJYA 2J4BA 2XPYA 4L2YA 5CCMA 1UJKA 3B7UX 4N3AA 1JWFA 2OVFA 3HYMB 3L08A 4GYYA 1E7VA 3HDXA 1WAO1 3ZEFA 4YNDA 3LS8A 3IV0A 2IFUA 3L22A 4BFRA 4ILHB 2P58C 3D9KA 4KXKB 4P29A 1WM5A 4PUCA 2Y3AA 4WWNA 2XGMA 3EHNA 1DNPA 4NURA 1L5JA 3G2TA 4HXIA 3RO3A 2VGXB 1HXIA 3Q15A 2X38A 2IOLA 4I9CA 3ZN3A 4NRHB 3ESKA 4J8DA 4APOA 5G04C 1N52A 1TEZA 3ZVVA 2CFUA 3ONLA 5JJ6A 1HG2A 2L6JA 2UY1B 1OWLA 3CR3A 3P2BA 4OVUA 2DBAA 2WXLA 2AXVA 2CFZA 4XI0A 4L23A 2KCLA 3KS2A 4NACA 3D9JA 3FY4A 5T4YA 4AP2A 3TG5A 2AXUA 4MRUA 4PS3A 2HR2A 4EZJA 4GMJA 5KJLA 3GZ1A 2M63A 3LYAA 3N71A 2VSNA 2J9QA 2WXPA 5BV0A 5EKQD 5CMWA 2LAHA 3IKOB 3RO2A 3CLJA 3LY8A 4F53A 3CSTA 4HOTA 4XE0A 3PEUB 4ABNA 4ME2A 4U07A 4Y6WA 1E8ZA 1HE8A 4U0SA 4DPRA 2LAIA 3PVLA 4L2LA 2WB2A 3L6AA 2WXFA 4G26A 3PUKA 5LOZA 4B89A 4JHRA 2R17C 1ELWA 4KZCA 1EPUA 3FUHA 4G24A 5KCMA 5G2NA 4MS6A 4E6HA 2IQCA 3OXGA 1B89A 3CGHA 2X6KA 3CHOA 2FEZA 4WNDA 3T5VA 2L0TB 3CK8A 3CVNA 2VGYA 4L1BA 3Q5MA 3TAXA 1UW4B 3SF4A 3JQ1A 2R59A 3CSFA 3PUJA 3NQPA 3QK0A 5KJKA 2I1JA 3CHQA 3D3MA 3ML9A 4MLPA 4W9RA 4CGWA 1KLXA 3AU5A 3VLDA 2KM4A 3QARA 3I4GA 1HZ4A 2XRZA 4K0RA 2XRYA 3KD7A 3UMVA 3HVEA 3RK6A 3PE3A 3CVXA 3QOUA 3RIBA 3FUIA 5E75A 3CHMA 2CHWA 2X6FA 4GCOA 4N39A 2MHKA 4N5CA 3D9OA 3D9IA 4HOQA 3ASHA 4IRUA 3CVWA 2Y4TA 4LEUA 4YVQC 2XCBA 2PM6A 2V4LA 1GW6A 3EJNA 3FUMA 3HIZA 4FLHA 3ZYMA 4O6FA 2CHXA 1SZ9A 3Q4AB 3MCXA 3UT4A 2IU1A 3FULA 3IEGA 2WQ6A 4Q94A 4KMOA 3CKBA 4RSYA 1Y8MA 3UUXA 4ANWA 3FDHA 4LRZA 2MRIA 2V0PA 5BT1A 4A55A 5AJLA 3FU5A 4JPSA 4DK5A 4XIFA 3ML8A 2VSOE 4BT9A 3LVQE 3AU4A 4ANVA 4EZLA 3JYSA 5AENA 5BV1A 4GZCA 4KVMA 4UWHA 3D9LA 3IBEA 3I4RB 5FZQA 5CCLA 5LX8A 5FQ4A 4G23A 3FUJA 4KBQA 4JZYA 3FU0A 3UT7A 5A23A 3S2AA 3TXNA 3VLFA 3QWVA 4PDXA 1OWOA 3CVYA 1UN9A 4F3VA 3FUFA 3MKQA 4G2VA 4XI9A 1X5BA 4FP7A 2PL2A 4I6EA 4B94A 4CDMA 1SQMA 3CK7A 2KATA 3PNLB 2C0MA 3R7RA 1EDUA 4AV7A 4J6IA 3FU6A 4UI9K 4BTBA 3FUNA 3MJWA 4Q69A 5LFAA 3ZYKA 3UT8A 3RRUA 4C0MA 1NA0A 4DJAA 1ELKA 4AY6A 3FH8A 4PS7A 2I9CA 3CQCB 3QC1A 1H2TC 4GPKA 3ZIMA 3PDNA 2BUGA 4GYWA 3TGOA 4WNGA 4C0EA 4KYOB 1W3BA 2PM7A 3NZUA 3B7RL 3HVEB 3NF1A 3QJZA 3FHEA 5HQ8A 3FH7A 4UQYA 3QWWA 1NZNA 3CVPA 1TJFA 4ACKA 1YA0A 4CT0A 4CGVA 2LO6A 5AIJA 4BY6A 1HG5A 4CDNA 5LP0A 3SI5A 2ILRA 1NA3A 1QZ2A 1PC2A 3TXMA 4DI3A 5FQ6A 1UN8A 2XHEA 2YHCA 4FJYA 4AEZC 3D9PA 4APFA 2E2EA 3MA5A 3GYZA 5G04J 2XGOA 1PY1A 1DVPA 4AVXA 4XKBA 4PS8A 5KJMA 1ZU2A 4RVBA 2J07A 3RKVA 4B8AA 2WQ7A 4R7LA 3TJPA 3LKUA 2VTBA 4AY5A 4L7TA 4BTAA 4JHKA 1HO8A 2LSUA 2LNIA 5FTPA 2XQ0A 2WMNA 3CHPA 3LEWA 4GA0A 4H7XA 5DIZA 2WM9A 1HU3A 3FH5A 1UJJA 3MKQB 4I1AA 3U64A 1OUVA 4KZ0A 3D9NA 5FZRA 3GW4A 2NSZA 5AJDA 5FZSA 4AXHA 3MV2B 2ZU6B 3VLEA 4E85A 3FTSA 2AWIA 3LJ3A 3ZHEA 3FUKA 3ASDA 1KT1A 4HS2A 4F7AA 2WXNA 4LUNU 5CHEE 4WNEA 5ARGA 2J4DA 4KT6B 4N3BA 5D0QD 5FWQA 5KJNA 4D10C 4I6GA 4HOUA 1A17A 1HF8A 2BF0X 2VQ2A 3OXFA 1IHGA 2CG2A 2WXHA 1MHQA 3SNXA 3MGBA 4A3TA 1ELRA 2WXJA 3CHSA 4U8HA 4ACLA 3L17A 3QB2A 1NP7A 2VYIA 2IOSA 4C9BB 1E90A 1ZBPA 4AOFA 4NQ0A 2KC7A 2KCKA 2XPZA 3T8MA 4FHKA 2AVPA 1MQSA 2I6HA 2WXGA 3URZA 3B7TA 4CRWA 3ASGA 3FFLA 4IYPA 1IYGA 1KT0A 5EX0A 2XCCA 3FTWA 4ILIA 3R7QA 5T8IA 4ILGA 2R5SA 2IF4A 5C2YA 4UWLA 2GGFA 1UG3A 3JCKC 2J49A 4PH4B 1H2VC 5ENNA 4AJWA 4I1MA 3B7SA 4XZ4A 3RRNB 2VSYA 3CIAA 4KVOA 4GZ6A 5BW8C 4HLEA 4CCAA 1HX8A 4K03A 3PREA 4N2SA 4TUUA 3ONKA 5M72A 4GB9A 1FVFA 3OTNA 4FADA 2VTBB 3IHVA 5CMYA 5FT9A 3WXXA 4FA6A 4HVBA 3FU3A 3FP3A 3FTYA 2A4ZA 2E0IA 2X6IA 4I43A 4BT8A 3RU0A 1HH8A 4G11A 5G55A 3MKRA 1EYHA 2CHZA 3CV0A 5J08A 2NC9A 1H6KA 3EHMA 3VTYA 1H2UA 1INZA 3FTZA 3T5XA 3ZYQA 1JUQA 4JXTA 4FLBA 3ZHEB 1IQRA 5EX3A 3ZW3A 4TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HU3 A;  2VSO E;  4CEM A;  1PAQ A;  3FEX A;  2IOS A;  3RK6 A;  4C9B B;  2KZT B;  2ION A;  4CT4 A;  2NSZ A;  3JUI A;  3L6A A;  2ZU6 B;  2FUL A;  4B89 A;  1N54 A;  4JHJ A;  2RG8 A;  2I2O A;  4CRW A;  1H2T C;  4B8C B;  4B8A A;  2VSX E;  3EIQ C;  1H6K A;  4LUN U;  3EIJ A;  4GMJ A;  4IUL A;  4GML A;  2KZT A;  2GGF A;  1UG3 A;  1H2U A;  4JHK A;  3FEY A;  1H2V C;  2IU1 A;  1UW4 B;  2IOL A;  5ANR A;  2HM8 A;  3D3M A;  1N52 A; 
#chains in the Genus database with same CATH topology
 1V55 E;  4JB8 P;  2L9B A;  5A7D B;  5E76 A;  4URK A;  4GCN A;  3DSW A;  2QYJ A;  5BPP A;  2Y4U A;  2ZXW E;  4GA2 A;  5AYW D;  4BX8 A;  4HI8 A;  3DBS A;  3L13 A;  4RG6 A;  3SGH A;  5EYL A;  3QAQ A;  2OV8 A;  2AJA A;  2ION A;  2NXP A;  5KNG A;  3AJI A;  3PZD A;  4B8C B;  3K9I A;  3MV3 B;  1YMP A;  2MOW A;  5JMN D;  1OCZ E;  3D9M A;  3CQG B;  3SBS A;  4ZHB A;  5EYP F;  3ZYL A;  3JUI A;  2J08 A;  4B93 B;  4JA9 A;  3RJV A;  2YHE A;  2RD0 A;  3U66 A;  1LF8 A;  1Z3X A;  3ZXS A;  3CEQ A;  4GZ3 A;  3GZS A;  3Q9N C;  2BTD A;  3UIO C;  1TNO A;  2UWJ G;  3LDZ A;  2ZGG A;  3PRZ A;  2QY7 A;  3UQ3 A;  2QC9 A;  3U4T A;  2DZN A;  3ENE A;  4I1O B;  2KZT A;  2WXI A;  2XEV A;  2P9I G;  4V3I A;  5AAO A;  1XNF A;  5G05 C;  2XEH A;  4U04 A;  2PQN A;  2XGS A;  2OVB A;  5FQ8 A;  1U3C A;  1QNF A;  2VGX A;  4DLQ A;  2FF4 A;  5D0O D;  1BI7 B;  3LY9 A;  3W9F A;  2AW6 A;  1H0A A;  2FI7 A;  4H7Y A;  4FU3 A;  5B3S E;  2HO1 A;  3AG2 E;  5CER B;  4U0Z A;  5J90 A;  4LNU D;  4DLO A;  4EZK A;  4FJZ A;  4N2Q A;  4UI9 J;  4M3O A;  2DYS E;  3BG1 B;  3AS8 A;  1TNZ A;  1TNU A;  1JPL A;  1D8D A;  4JL0 A;  5CRU A;  4F1P A;  4UWF A;  3KEA A;  2KZT B;  5FJY A;  4L2Y A;  1JWF A;  4GYY A;  1E7V A;  3HDX A;  1OY3 D;  3IV0 A;  2IFU A;  4ILH B;  2R03 A;  1WM5 A;  1DNP A;  4NUR A;  1L5J A;  2EIL E;  2VGX B;  1HXI A;  3ZN3 A;  2IOL A;  4APO A;  5G04 C;  3X2Q E;  3ABM E;  1N0R A;  3ZVV A;  5JJ6 A;  3CR3 A;  4DX7 D;  2DBA A;  4C48 B;  3FY4 A;  2HR2 A;  2ETA A;  3LYA A;  3N71 A;  2XS1 A;  2LAH A;  3IKO B;  3RO2 A;  3CLJ A;  3Q79 A;  1NFI E;  4F53 A;  4HOT A;  4XE0 A;  1G3N B;  3V2X A;  5AAR A;  4U07 A;  1E8Z A;  4U0S A;  2H6H A;  4L2L A;  1TR4 A;  2WB2 A;  2WXF A;  4G26 A;  3PUK A;  4B89 A;  4JHR A;  1ELW A;  3FUH A;  4MS6 A;  3CGH A;  2FEZ A;  3SY2 A;  3T5V A;  1UW4 B;  3NQP A;  2I1J A;  4W9R A;  3AU5 A;  3I4G A;  4K0R A;  3RK6 A;  3QOU A;  3CHM A;  3UKU G;  2X6F A;  1JCR A;  4N5C A;  1SA4 A;  2Y4T A;  2XCB A;  4O6F A;  4TXQ A;  1N94 A;  1Y8M A;  4MBG A;  4LRZ A;  3ZU7 B;  2V0P A;  5BT1 A;  5AJL A;  4JPS A;  3UTM A;  4DK5 A;  2VSO E;  4EZL A;  3AU4 A;  5FZQ A;  5CCL A;  4LNG A;  4G23 A;  1BI8 B;  4JZY A;  5A23 A;  3E30 A;  3TXN A;  1OWO A;  4G2V A;  4XI9 A;  4HBD A;  4HI9 A;  3TWX A;  1OCR E;  3UM1 A;  1EDU A;  5HS0 A;  3FU6 A;  1NL4 A;  1NA0 A;  4DJA A;  2B6C A;  2I9C A;  3CQC B;  4GPK A;  4BSZ B;  4WNG A;  1W3B A;  1D9S A;  5ENQ D;  1TN8 A;  1YCS B;  4BY6 A;  4CDN A;  2ILR A;  3DSV A;  1QZ2 A;  2LXM A;  4DI3 A;  2XHE A;  2F0Y A;  2Y0B G;  3MA5 A;  5G04 J;  1PY1 A;  4AVX A;  3Q78 A;  4R7L A;  3TJP A;  1HO8 A;  2GRQ B;  2RFM A;  2J8S D;  5DIZ A;  2WM9 A;  1HU3 A;  4I1A A;  3U64 A;  2OCC E;  4KZ0 A;  3GW4 A;  2EIM E;  3LJ3 A;  4LG6 A;  3ZHE A;  4WNE A;  1H6O A;  3HG0 D;  4HOU A;  1HF8 A;  1MHQ A;  3F6Q A;  3CHS A;  4DX2 A;  4AOF A;  2GRN B;  2V4H C;  3ASO E;  4IYP A;  1D8E A;  3ASN E;  5C2Y A;  4DX5 D;  1MZC A;  2VSY A;  4HLE A;  4F6R D;  1O1R A;  4DRX E;  3ONK A;  4GB9 A;  2FO1 E;  3OTN A;  4FAD A;  4FA6 A;  3FU3 A;  3FP3 A;  5G55 A;  2NC9 A;  2KBX A;  3EHM A;  4LNB A;  3ZYQ A;  1MYO A;  3SO8 A;  4HB5 A;  3ZHE B;  4TRQ A;  5ANL A;  3BEE A;  3TL5 A;  2P9L G;  1FPP A;  4IN3 B;  5B1B E;  4G25 A;  1U3D A;  1JWG A;  3FTX A;  2YIN A;  4GML A;  1BPO A;  3EDT B;  3I3N A;  3HXD A;  3DPY A;  4J8F A;  2X6H A;  3ZPJ A;  1TJC A;  2PQR A;  4A3V A;  3GZ2 A;  1TN7 A;  2WQH A;  3HHM A;  1E8X A;  3APD A;  1O1S A;  4EHM A;  1DCE A;  4EPZ A;  3PZ4 A;  3BG0 B;  4OAV B;  1A5E A;  1S64 A;  4HOR A;  2GRL A;  3EHR A;  4I2W A;  1FT1 A;  3FTU A;  3I5P A;  4A1G A;  3AS5 A;  4GZD A;  4I6J A;  2MYO A;  3B95 A;  2WXM A;  1N4P A;  3LXU X;  4GTV A;  3ZRH A;  2XPI A;  5EID A;  3EU9 A;  5EDS A;  4I2Z A;  4YVO A;  1E96 B;  3C3Q A;  4LER A;  3PNT B;  4WWP A;  4AM9 A;  2WXO A;  4XX5 A;  4HOS A;  3G2W A;  1E8W A;  4GZ5 A;  4OVV A;  4YDE A;  3MYV A;  5DBK A;  3DXK G;  2A5U A;  3LY7 A;  1XGW A;  3Q9U C;  5C1D A;  2XZD G;  3R9A B;  1IKN D;  2UY1 A;  4J0U A;  1QQE A;  3OXL A;  2YQ8 A;  5ANR A;  2OEV A;  2Y1L E;  5A6C A;  1V54 E;  3UIN C;  2GW1 A;  3G2S A;  3RRM B;  4UI9 C;  2FBN A;  3FUE A;  1N54 A;  2PZI A;  3LJN A;  3Q49 B;  3DSX A;  1SVX A;  3B13 A;  4EEC A;  2V8S E;  3DXM G;  3DPD A;  3APF A;  4F1S A;  2WXK A;  3G2U A;  4EBA G;  1Y6I A;  2DIW A;  1OWM A;  2XPY A;  5D66 A;  1UJK A;  3B7U X;  3KSL A;  2BKG A;  2RFA A;  2OVF A;  4N3A A;  1DCQ A;  4YND A;  3LS8 A;  2GRP B;  3G2T A;  3DWL G;  5JA4 D;  1NI1 A;  2Y69 E;  1S70 B;  2L6J A;  2UY1 B;  2AXV A;  2CFZ A;  4NAC A;  5T4Y A;  4EZJ A;  4GMJ A;  2VSN A;  2J9Q A;  2WXP A;  5BV0 A;  5EKQ D;  5AQ9 A;  4UUC A;  3JXJ A;  3CST A;  4K5B A;  3DRA A;  2P9S G;  3L6A A;  4KZC A;  3UXG A;  1EPU A;  4G24 A;  5G2N A;  4E6H A;  2IQC A;  3ULY A;  3CHO A;  3Q5M A;  3JQ1 A;  3CSF A;  3PUJ A;  3DSU A;  3CHQ A;  3D3M A;  4MLP A;  3T8K A;  3VLD A;  3TWS A;  1HZ4 A;  2XRZ A;  3PE3 A;  3RIB A;  3FUI A;  5E75 A;  2CHW A;  4GCO A;  2MHK A;  3EUV A;  3D9O A;  4HOQ A;  3ZYM A;  4FLH A;  3MCX A;  2IU1 A;  3FUL A;  2WQ6 A;  4Q94 A;  3CKB A;  4RSY A;  1LD8 A;  3FDH A;  4BEP A;  1O5M A;  4BT9 A;  5BV1 A;  2EIN E;  4KVM A;  4UWH A;  3I4R B;  1SW6 A;  3B7B A;  5FQ4 A;  3TWT A;  3FUJ A;  3S2A A;  3QWV A;  2ETB A;  1UN9 A;  3FUF A;  4GTO A;  1X5B A;  2PL2 A;  4I6E A;  2F8X K;  4CDM A;  4BER A;  3CK7 A;  2H6F A;  2KAT A;  3NAW A;  5IY5 E;  4J6I A;  3FUN A;  5LFA A;  1ELK A;  2BED A;  4AY6 A;  2F8Y A;  3PDN A;  3EU5 A;  3DEO A;  3QJZ A;  3FHE A;  5HQ8 A;  3FH7 A;  4UQY A;  3QWW A;  1TJF A;  1YA0 A;  4CGV A;  5AIJ A;  1OT8 A;  5LP0 A;  3TXM A;  5FQ6 A;  3D9P A;  5CEA A;  2XGO A;  4XKB A;  4O1O A;  5KJM A;  4RVB A;  3LKU A;  2DWZ A;  2VTB A;  4JHK A;  2LSU A;  3CHP A;  3LEW A;  4GA0 A;  3PZ1 A;  2OEW A;  3E37 A;  5FZR A;  2NSZ A;  5AJD A;  5FZS A;  4TXR A;  3VLE A;  4E85 A;  1SA5 A;  3FUK A;  1KT1 A;  4GTP A;  4LUN U;  5CHE E;  5KJN A;  5ARG A;  4N3B A;  2BF0 X;  1MX6 A;  3J5P A;  2CG2 A;  3Q73 A;  2IO3 C;  3MGB A;  1ELR A;  2R02 A;  1LD7 A;  3SQV A;  4U8H A;  1IHB A;  3L17 A;  3PZ3 A;  3QB2 A;  2VYI A;  1K1B A;  2IOS A;  1E90 A;  2KC7 A;  3T8M A;  3D9H A;  2WXG A;  3HXC A;  4CRW A;  2IY0 C;  3ASG A;  3R9M A;  1IYG A;  5EX0 A;  4ILI A;  2J49 A;  1H2V C;  4I1M A;  3B7S A;  3RRN B;  4GZ6 A;  5BW8 C;  4CCA A;  1HX8 A;  3W9G A;  5M72 A;  4U7E B;  2VTB B;  4HVB A;  5KWD A;  3FTY A;  4U95 D;  2E0I A;  5EIB E;  3MKR A;  1KZO A;  1H6K A;  2EIJ E;  3VTY A;  1INZ A;  3T5X A;  4FLB A;  1KZP A;  5EX3 A;  2H6I A;  2KCV A;  3ZGQ A;  1WG0 A;  2WXR A;  3KAE A;  3KEZ A;  3C5R A;  4JEU A;  4YDW A;  3APC A;  4I17 A;  2WMO A;  3LVR E;  1OWP A;  4QFV A;  3BQO A;  4YDO A;  1IQU A;  3CHR A;  4MKT A;  4UWK A;  3CVV A;  4U8V D;  3O48 A;  2H6G A;  3C72 A;  1IXV A;  4N5Q A;  4HNA D;  2P9N G;  3CVQ A;  1QBQ A;  3UM0 A;  4CT4 A;  1N4S A;  5LCW J;  2LSV A;  4GA1 A;  3ULE G;  1JCQ A;  3HRA A;  4GYO A;  5JJ7 A;  4BSX A;  2DCP A;  2FO7 A;  4HFG A;  2AXZ A;  1N4Q A;  3PEV B;  3QNK A;  2QFC A;  4WWO A;  4DX1 A;  3FEX A;  3SFX A;  4FUL A;  3AS4 A;  4U63 A;  3G2V A;  2I2O A;  2C2L A;  4JC8 A;  3SD5 A;  3AAA C;  4N3C A;  1OXJ A;  3CVL A;  4GPM A;  4CDR A;  1TNY A;  4J8S A;  5JHA A;  5BUZ A;  1S0P A;  1Z6T A;  3T9K A;  4ANU A;  5BNW A;  2DZO A;  3MEK A;  3TWV A;  4FC8 A;  1WY6 A;  2DYR E;  1E8Y A;  4AIF A;  4OYS A;  3VTX A;  2GRR B;  3NOC D;  2WPV A;  2YNQ A;  3LCA A;  3ULQ A;  5AQB A;  4HLL A;  5D2M C;  3O4Z A;  4B0Z A;  1AWC B;  4G1T A;  4Y6C A;  4WNF A;  2I1K A;  4LCT A;  3TG4 A;  5FIN A;  4GAA A;  4ANX A;  5BXU A;  1DC2 A;  2EIK E;  4U0U A;  2V5F A;  2JLB A;  3MZL B;  1PAQ A;  3S7F A;  4J8E A;  5T3R A;  1BU9 A;  3P1U A;  2L0I A;  4RG9 A;  3SHF A;  3PH0 C;  3IHY A;  4HRN A;  4IUL A;  4BWR A;  2IJG X;  3NZS A;  2EQX A;  3FEY A;  1S63 A;  3SFY A;  2HM8 A;  3MX3 A;  2J4B A;  3UM2 A;  3HYM B;  3L08 A;  1WAO 1;  5CRV A;  3UM3 A;  4BFR A;  4P29 A;  4J8Y A;  3EHN A;  2RKK A;  5ENP D;  4I9C A;  2X38 A;  4NRH B;  3ESK A;  1TEZ A;  3ONL A;  4GTQ A;  4OVU A;  1Q2Z A;  4L23 A;  2KCL A;  5EIL A;  4AP2 A;  4MRU A;  4PS3 A;  5KJL A;  4RQI A;  4A63 B;  5CMW A;  2P2C P;  3LY8 A;  1BD8 A;  2QYU A;  4ABN A;  3ZKJ A;  2IEJ A;  5LOZ A;  2R17 C;  1Z5S C;  1MJ0 A;  3OXG A;  2X6K A;  3CK8 A;  1ZB1 A;  2L6B A;  3TAX A;  3SF4 A;  2BKK B;  3QK0 A;  5KJK A;  3ML9 A;  4CGW A;  4CZ2 D;  2ETC A;  2F37 A;  3KD7 A;  3HVE A;  5AQ7 A;  3CVX A;  4N39 A;  4IRU A;  3CVW A;  4LEU A;  4YVQ C;  2PM6 A;  2V4L A;  3HIZ A;  3FUM A;  2CHX A;  1SZ9 A;  3UT4 A;  2R2L A;  4KMO A;  3UUX A;  4ANW A;  2MRI A;  5CEC B;  3FU5 A;  4NIK A;  3LVQ E;  1N11 A;  5AEN A;  4GZC A;  3D9L A;  3IBE A;  5LX8 A;  4KBQ A;  3UT7 A;  4PDX A;  3CVY A;  4F3V A;  4FP7 A;  4B94 A;  2LUH A;  4BTB A;  4Q69 A;  3RRU A;  4LSZ E;  5HKP A;  1H2T C;  3V79 K;  3EHQ A;  3ZIM A;  1KPS B;  3B7R L;  3HVE B;  3NF1 A;  1NZN A;  4ACK A;  4CT0 A;  4DX6 D;  4X8Q A;  1UN8 A;  2YHC A;  1AP7 A;  2E2E A;  1N95 A;  1DVP A;  4B8A A;  2J07 A;  2WQ7 A;  4L7T A;  5ENO D;  4BTA A;  5FTP A;  3DEP A;  2XQ0 A;  3DST A;  3NOG D;  2WMN A;  4H7X A;  3FH5 A;  1OUV A;  2IO2 C;  3IXE A;  4AXH A;  3FTS A;  2AWI A;  4JD2 G;  3L9T A;  2WXN A;  4CYM D;  4J7W A;  4K5A B;  4D10 C;  3HXE A;  1A17 A;  4A3T A;  2WXJ A;  2B0O E;  1NP7 A;  1K8K G;  4C9B B;  2PNN A;  2XPZ A;  2AVP A;  3BU8 A;  3E34 A;  3URZ A;  3FFL A;  3FTW A;  4HQD A;  1K3Z D;  5T8I A;  2R5S A;  2IF4 A;  1UG3 A;  4AJW A;  3JCK C;  4KVO A;  4K03 A;  3PRE A;  4TUU A;  3AG3 E;  1FVF A;  3IHV A;  5CMY A;  5FT9 A;  3WXX A;  3AG1 E;  4G8L A;  2X6I A;  4GMR A;  3RU0 A;  1MX2 A;  2CHZ A;  3CV0 A;  5J08 A;  1H2U A;  1JUQ A;  4JXT A;  3ZW3 A;  4CEM A;  4WAF A;  3C98 A;  4EQF A;  5JHB A;  3HXF A;  5ENS D;  4JA7 A;  3E32 A;  5HRY A;  4RLY A;  1EF1 C;  3TWQ A;  2GRM A;  3U3W A;  5LCW C;  2Q7F A;  2P9P G;  3CKC A;  3U9W A;  4FHJ A;  4GU5 A;  3S7B A;  4BET A;  2VGE A;  2OOE A;  3QKY A;  4G8K A;  2RG8 A;  5ITZ F;  3S7D A;  3ASF A;  3EIJ A;  1FVH A;  4BES A;  1O1T A;  1OCC E;  2OND A;  3E33 A;  4DI4 A;  3LPZ A;  3JQ0 A;  4M7C A;  1VDY A;  2X6J A;  2ZIR A;  1Z3Y A;  3FWV A;  2CG3 A;  3QWP A;  4JEH A;  3SFZ A;  3Q47 B;  1SZA A;  3S7J A;  1P5Q A;  2JEK A;  4GTM A;  3SBT B;  5CED B;  5ARF A;  3ABL E;  3UPV A;  3ESL A;  3NB2 A;  4UQZ A;  2ZIS A;  3FUD A;  3ZNG A;  4U8Y D;  3PS6 A;  3ZFW A;  3E4B A;  1K1A A;  4EBA A;  3CK9 A;  1OWN A;  5CBO A;  5FIO A;  3OAW A;  5AQA A;  3J5Q B;  2C0L A;  5EN5 D;  2J09 A;  3Q7F A;  2DVW A;  2HYZ A;  3JUE A;  3QDN A;  4XKC A;  4A1S A;  2WXQ A;  3ISM C;  2A5E A;  2KXP C;  4WUY A;  3ABK E;  2NYJ A;  3UX4 A;  3L16 A;  4JHJ A;  4UWG A;  5G05 J;  2VSX E;  3SZ7 A;  3EIQ C;  3TWR A;  4ATG A;  1U2V G;  1HS6 A;  4UQX A;  4JW1 A;  4TV3 A;  3UKR G;  3V31 A;  3FTV A;  4JVS A;  3C3O A;  1E7U A;  2X3M A;  5JJT A;  1HFA A;  3L54 A;  2FUL A;  3C3R A;  4I9E A;  4TUM A;  4Q96 A;  3UI2 A;  1FCH A;  1QYM A;  3UIP C;  3ZUV B;  3PE4 A;  2VJ8 A;  3RAU A;  4Z68 A;  5FQ7 A;  5HI7 A;  4ZFH A;  5ENR D;  1FT2 A;  4BX9 A;  3KSQ A;  3CVU A;  1H19 A;  2WVI A;  5CCM A;  2ZGD A;  3ZEF A;  3L22 A;  2P58 C;  3D9K A;  4KXK B;  4PUC A;  4WWN A;  1WDY A;  2Y3A A;  2XGM A;  1OCO E;  4HXI A;  3RO3 A;  3Q15 A;  4J8D A;  1N52 A;  3PZ2 A;  2CFU A;  1HG2 A;  1OWL A;  3P2B A;  2LXL A;  2XEE A;  2WXL A;  4XI0 A;  3KS2 A;  3D9J A;  3TG5 A;  2AXU A;  3GZ1 A;  2M63 A;  4GTR A;  3PEU B;  1UOH A;  4ME2 A;  4Y6W A;  3BUA A;  1HE8 A;  4DPR A;  2LAI A;  3PVL A;  2XS8 A;  4YDY A;  5KCM A;  3TWW A;  1B89 A;  4WND A;  2L0T B;  3CVN A;  2VGY A;  4L1B A;  2XZT G;  2R59 A;  4O1P A;  1KLX A;  4K5C A;  2KM4 A;  3QAR A;  2XRY A;  3UMV A;  5KBA A;  3D9I A;  3ASH A;  3EJN A;  1GW6 A;  2JAB A;  3Q4A B;  4TXP A;  3IEG A;  1X81 A;  4A55 A;  4XIF A;  3ML8 A;  1JCS A;  4ANV A;  3JYS A;  3L82 A;  1RW2 A;  1RZ4 A;  3FU0 A;  3NBN B;  3VLF A;  1TNB A;  3MKQ A;  2P9K G;  1SQM A;  3PNL B;  2C0M A;  1LTX A;  3R7R A;  4AV7 A;  3Q75 A;  4UI9 K;  1N4R A;  2V5Q C;  3MJW A;  3ZYK A;  5BXO A;  3UT8 A;  4C0M A;  4GTT A;  3FH8 A;  4PS7 A;  3QC1 A;  2BUG A;  2XEN A;  3V2O A;  4GYW A;  3TGO A;  4C0E A;  4KYO B;  2PM7 A;  3NZU A;  4L9P A;  3WG7 E;  1N0Q A;  3CVP A;  2LO6 A;  1HG5 A;  4XEI G;  3SI5 A;  1NA3 A;  1PC2 A;  2QZA A;  1N9A A;  4FJY A;  4AEZ C;  4APF A;  3GYZ A;  4PS8 A;  1ZU2 A;  3RKV A;  5KNH D;  4DUI A;  4U96 D;  5AN8 A;  5CBN A;  4AY5 A;  5H7P A;  2GRO B;  2LNI A;  1UJJ A;  3MKQ B;  1TN6 A;  1H6P A;  5B1A E;  3D9N A;  3MV2 B;  2ZU6 B;  3ASD A;  4QQI A;  4HS2 A;  4F7A A;  2J4D A;  4HRL A;  4KT6 B;  5D0Q D;  5FWQ A;  4I6G A;  2VQ2 A;  3OXF A;  1IHG A;  2WXH A;  3SNX A;  2HE0 A;  1MX4 A;  4ACL A;  1ZBP A;  4NQ0 A;  2KCK A;  4OAU C;  4FHK A;  1TYQ G;  1MQS A;  2I6H A;  3RSE G;  3B7T A;  4ATZ D;  3ZXP A;  1KT0 A;  2R05 A;  2XCC A;  3R7Q A;  4ILG A;  4O60 A;  4UWL A;  2GGF A;  4PH4 B;  3HXB A;  5ENN A;  4GTS A;  4XZ4 A;  3CIA A;  1YYH A;  3Q7A A;  4N2S A;  4HRM B;  3AG4 E;  2A4Z A;  4I43 A;  4BT8 A;  1HH8 A;  4G11 A;  1EYH A;  3TWU A;  3V30 A;  5ENT D;  3JXI A;  2P9U G;  3FTZ A;  1BLX B;  1IQR A;  3DSS A; 
#chains in the Genus database with same CATH homology
 5ANL A;  2KCV A;  3BEE A;  3TL5 A;  3ZGQ A;  4CEM A;  2L9B A;  2WXR A;  5A7D B;  3KAE A;  4IN3 B;  3KEZ A;  4WAF A;  5E76 A;  4URK A;  4JEU A;  4G25 A;  3APC A;  4GCN A;  4I17 A;  1U3D A;  3C98 A;  1JWG A;  3FTX A;  2WMO A;  3LVR E;  1OWP A;  4QFV A;  5BPP A;  2Y4U A;  2YIN A;  4EQF A;  5JHB A;  4GA2 A;  4GML A;  5AYW D;  4JA7 A;  1BPO A;  3EDT B;  1IQU A;  3I3N A;  4BX8 A;  3DBS A;  3CHR A;  3L13 A;  1EF1 C;  4RG6 A;  2GRM A;  3SGH A;  4MKT A;  4UWK A;  3U3W A;  3CVV A;  3O48 A;  5LCW C;  4J8F A;  2Q7F A;  3QAQ A;  2OV8 A;  2X6H A;  3ZPJ A;  3CKC A;  1TJC A;  2PQR A;  3U9W A;  4FHJ A;  4GU5 A;  2ION A;  4A3V A;  2NXP A;  3CVQ A;  3GZ2 A;  3QKY A;  2OOE A;  3S7B A;  4CT4 A;  5LCW J;  2LSV A;  4GA1 A;  2WQH A;  2RG8 A;  3HHM A;  3PZD A;  3S7D A;  1E8X A;  4B8C B;  4GYO A;  3K9I A;  3ASF A;  3APD A;  3EIJ A;  3MV3 B;  2MOW A;  5JJ7 A;  1FVH A;  4BSX A;  2DCP A;  4EPZ A;  3D9M A;  2FO7 A;  4HFG A;  2AXZ A;  3CQG B;  3SBS A;  3PEV B;  3BG0 B;  3QNK A;  2QFC A;  4WWO A;  2OND A;  4DI4 A;  3FEX A;  4HOR A;  3LPZ A;  4FUL A;  3JQ0 A;  2GRL A;  3AS4 A;  4U63 A;  3G2V A;  3ZYL A;  1VDY A;  3JUI A;  4I2W A;  2J08 A;  2X6J A;  1Z3Y A;  3FWV A;  2I2O A;  2CG3 A;  4JA9 A;  3RJV A;  3QWP A;  2YHE A;  2C2L A;  4JEH A;  3FTU A;  2RD0 A;  3U66 A;  3I5P A;  3SFZ A;  1LF8 A;  4A1G A;  3Q47 B;  1SZA A;  4JC8 A;  3S7J A;  1Z3X A;  1P5Q A;  2JEK A;  3SD5 A;  3ZXS A;  3AS5 A;  4N3C A;  3SBT B;  5ARF A;  3CVL A;  3UPV A;  4GZD A;  4I6J A;  3ESL A;  4CDR A;  3CEQ A;  4GZ3 A;  3GZS A;  2BTD A;  4UQZ A;  4J8S A;  5JHA A;  5BUZ A;  3FUD A;  2UWJ G;  1S0P A;  1Z6T A;  3PS6 A;  3LDZ A;  3ZFW A;  3E4B A;  2WXM A;  3LXU X;  3ZRH A;  3CK9 A;  3PRZ A;  4ANU A;  4EBA A;  5BNW A;  3MEK A;  2QY7 A;  2XPI A;  3UQ3 A;  1OWN A;  4FC8 A;  5EDS A;  1WY6 A;  4I2Z A;  4YVO A;  3U4T A;  3OAW A;  3ENE A;  4I1O B;  2KZT A;  1E96 B;  2C0L A;  1E8Y A;  2J09 A;  2WXI A;  2XEV A;  4OYS A;  4AIF A;  4LER A;  3PNT B;  4WWP A;  3VTX A;  4AM9 A;  2WXO A;  2HYZ A;  4V3I A;  4XX5 A;  3QDN A;  4XKC A;  4HOS A;  2WPV A;  4A1S A;  1XNF A;  2WXQ A;  2YNQ A;  5G05 C;  3G2W A;  3LCA A;  1E8W A;  4U04 A;  4WUY A;  2PQN A;  2XGS A;  2OVB A;  5FQ8 A;  3ULQ A;  4GZ5 A;  1U3C A;  4OVV A;  1QNF A;  3MYV A;  2VGX A;  3O4Z A;  4B0Z A;  3UX4 A;  4DLQ A;  4G1T A;  3L16 A;  4JHJ A;  4Y6C A;  4WNF A;  4UWG A;  5G05 J;  5DBK A;  2FF4 A;  5D0O D;  2I1K A;  4LCT A;  2A5U A;  2VSX E;  3SZ7 A;  3LY7 A;  1XGW A;  3EIQ C;  3LY9 A;  5C1D A;  2AW6 A;  1H0A A;  4ATG A;  3R9A B;  4J0U A;  2UY1 A;  2FI7 A;  3TG4 A;  1HS6 A;  4H7Y A;  4UQX A;  4FU3 A;  4JW1 A;  1QQE A;  3OXL A;  4GAA A;  4TV3 A;  4ANX A;  2YQ8 A;  5ANR A;  2HO1 A;  4U0U A;  5A6C A;  2V5F A;  2JLB A;  3FTV A;  4JVS A;  3MZL B;  1E7U A;  1PAQ A;  2X3M A;  3S7F A;  4J8E A;  2GW1 A;  3G2S A;  4U0Z A;  5T3R A;  3RRM B;  5JJT A;  3P1U A;  5J90 A;  2L0I A;  1HFA A;  2FBN A;  4RG9 A;  4UI9 C;  3L54 A;  3FUE A;  4DLO A;  2FUL A;  4EZK A;  1N54 A;  4I9E A;  2PZI A;  3SHF A;  3PH0 C;  3Q49 B;  4FJZ A;  4Q96 A;  1FCH A;  4N2Q A;  3PE4 A;  4UI9 J;  4M3O A;  2VJ8 A;  3B13 A;  3IHY A;  4IUL A;  4EEC A;  4BWR A;  2V8S E;  2IJG X;  3AS8 A;  2EQX A;  3BG1 B;  3FEY A;  3NZS A;  5FQ7 A;  3DPD A;  5HI7 A;  4BX9 A;  2HM8 A;  3APF A;  1JPL A;  4F1S A;  3CVU A;  3MX3 A;  2WXK A;  3G2U A;  4JL0 A;  1H19 A;  4EBA G;  1Y6I A;  2DIW A;  4UWF A;  1OWM A;  2KZT B;  2WVI A;  5FJY A;  2J4B A;  2XPY A;  4L2Y A;  5CCM A;  1UJK A;  3B7U X;  4N3A A;  1JWF A;  2OVF A;  3HYM B;  3L08 A;  4GYY A;  1E7V A;  3HDX A;  1WAO 1;  3ZEF A;  4YND A;  3LS8 A;  3IV0 A;  2IFU A;  3L22 A;  4BFR A;  4ILH B;  2P58 C;  3D9K A;  4KXK B;  4P29 A;  1WM5 A;  4PUC A;  2Y3A A;  4WWN A;  2XGM A;  3EHN A;  1DNP A;  4NUR A;  1L5J A;  3G2T A;  4HXI A;  3RO3 A;  2VGX B;  1HXI A;  3Q15 A;  2X38 A;  2IOL A;  4I9C A;  3ZN3 A;  4NRH B;  3ESK A;  4J8D A;  4APO A;  5G04 C;  1N52 A;  1TEZ A;  3ZVV A;  2CFU A;  3ONL A;  5JJ6 A;  1HG2 A;  2L6J A;  2UY1 B;  1OWL A;  3CR3 A;  3P2B A;  4OVU A;  2DBA A;  2WXL A;  2AXV A;  2CFZ A;  4XI0 A;  4L23 A;  2KCL A;  3KS2 A;  4NAC A;  3D9J A;  3FY4 A;  5T4Y A;  4AP2 A;  3TG5 A;  2AXU A;  4MRU A;  4PS3 A;  2HR2 A;  4EZJ A;  4GMJ A;  5KJL A;  3GZ1 A;  2M63 A;  3LYA A;  3N71 A;  2VSN A;  2J9Q A;  2WXP A;  5BV0 A;  5EKQ D;  5CMW A;  2LAH A;  3IKO B;  3RO2 A;  3CLJ A;  3LY8 A;  4F53 A;  3CST A;  4HOT A;  4XE0 A;  3PEU B;  4ABN A;  4ME2 A;  4U07 A;  4Y6W A;  1E8Z A;  1HE8 A;  4U0S A;  4DPR A;  2LAI A;  3PVL A;  4L2L A;  2WB2 A;  3L6A A;  2WXF A;  4G26 A;  3PUK A;  5LOZ A;  4B89 A;  4JHR A;  2R17 C;  1ELW A;  4KZC A;  1EPU A;  3FUH A;  4G24 A;  5KCM A;  5G2N A;  4MS6 A;  4E6H A;  2IQC A;  3OXG A;  1B89 A;  3CGH A;  2X6K A;  3CHO A;  2FEZ A;  4WND A;  3T5V A;  2L0T B;  3CK8 A;  3CVN A;  2VGY A;  4L1B A;  3Q5M A;  3TAX A;  1UW4 B;  3SF4 A;  3JQ1 A;  2R59 A;  3CSF A;  3PUJ A;  3NQP A;  3QK0 A;  5KJK A;  2I1J A;  3CHQ A;  3D3M A;  3ML9 A;  4MLP A;  4W9R A;  4CGW A;  1KLX A;  3AU5 A;  3VLD A;  2KM4 A;  3QAR A;  3I4G A;  1HZ4 A;  2XRZ A;  4K0R A;  2XRY A;  3KD7 A;  3UMV A;  3HVE A;  3RK6 A;  3PE3 A;  3CVX A;  3QOU A;  3RIB A;  3FUI A;  5E75 A;  3CHM A;  2CHW A;  2X6F A;  4GCO A;  4N39 A;  2MHK A;  4N5C A;  3D9O A;  3D9I A;  4HOQ A;  3ASH A;  4IRU A;  3CVW A;  2Y4T A;  4LEU A;  4YVQ C;  2XCB A;  2PM6 A;  2V4L A;  1GW6 A;  3EJN A;  3FUM A;  3HIZ A;  4FLH A;  3ZYM A;  4O6F A;  2CHX A;  1SZ9 A;  3Q4A B;  3MCX A;  3UT4 A;  2IU1 A;  3FUL A;  3IEG A;  2WQ6 A;  4Q94 A;  4KMO A;  3CKB A;  4RSY A;  1Y8M A;  3UUX A;  4ANW A;  3FDH A;  4LRZ A;  2MRI A;  2V0P A;  5BT1 A;  4A55 A;  5AJL A;  3FU5 A;  4JPS A;  4DK5 A;  4XIF A;  3ML8 A;  2VSO E;  4BT9 A;  3LVQ E;  3AU4 A;  4ANV A;  4EZL A;  3JYS A;  5AEN A;  5BV1 A;  4GZC A;  4KVM A;  4UWH A;  3D9L A;  3IBE A;  3I4R B;  5FZQ A;  5CCL A;  5LX8 A;  5FQ4 A;  4G23 A;  3FUJ A;  4KBQ A;  4JZY A;  3FU0 A;  3UT7 A;  5A23 A;  3S2A A;  3TXN A;  3VLF A;  3QWV A;  4PDX A;  1OWO A;  3CVY A;  1UN9 A;  4F3V A;  3FUF A;  3MKQ A;  4G2V A;  4XI9 A;  1X5B A;  4FP7 A;  2PL2 A;  4I6E A;  4B94 A;  4CDM A;  1SQM A;  3CK7 A;  2KAT A;  3PNL B;  2C0M A;  3R7R A;  1EDU A;  4AV7 A;  4J6I A;  3FU6 A;  4UI9 K;  4BTB A;  3FUN A;  3MJW A;  4Q69 A;  5LFA A;  3ZYK A;  3UT8 A;  3RRU A;  4C0M A;  1NA0 A;  4DJA A;  1ELK A;  4AY6 A;  3FH8 A;  4PS7 A;  2I9C A;  3CQC B;  3QC1 A;  1H2T C;  4GPK A;  3ZIM A;  3PDN A;  2BUG A;  4GYW A;  3TGO A;  4WNG A;  4C0E A;  4KYO B;  1W3B A;  2PM7 A;  3NZU A;  3B7R L;  3HVE B;  3NF1 A;  3QJZ A;  3FHE A;  5HQ8 A;  3FH7 A;  4UQY A;  3QWW A;  1NZN A;  3CVP A;  1TJF A;  4ACK A;  1YA0 A;  4CT0 A;  4CGV A;  2LO6 A;  5AIJ A;  4BY6 A;  1HG5 A;  4CDN A;  5LP0 A;  3SI5 A;  2ILR A;  1NA3 A;  1QZ2 A;  1PC2 A;  3TXM A;  4DI3 A;  5FQ6 A;  1UN8 A;  2XHE A;  2YHC A;  4FJY A;  4AEZ C;  3D9P A;  4APF A;  2E2E A;  3MA5 A;  3GYZ A;  5G04 J;  2XGO A;  1PY1 A;  1DVP A;  4AVX A;  4XKB A;  4PS8 A;  5KJM A;  1ZU2 A;  4RVB A;  2J07 A;  3RKV A;  4B8A A;  2WQ7 A;  4R7L A;  3TJP A;  3LKU A;  2VTB A;  4AY5 A;  4L7T A;  4BTA A;  4JHK A;  1HO8 A;  2LSU A;  2LNI A;  5FTP A;  2XQ0 A;  2WMN A;  3CHP A;  3LEW A;  4GA0 A;  4H7X A;  5DIZ A;  2WM9 A;  1HU3 A;  3FH5 A;  1UJJ A;  3MKQ B;  4I1A A;  3U64 A;  1OUV A;  4KZ0 A;  3D9N A;  5FZR A;  3GW4 A;  2NSZ A;  5AJD A;  5FZS A;  4AXH A;  3MV2 B;  2ZU6 B;  3VLE A;  4E85 A;  3FTS A;  2AWI A;  3LJ3 A;  3ZHE A;  3FUK A;  3ASD A;  1KT1 A;  4HS2 A;  4F7A A;  2WXN A;  4LUN U;  5CHE E;  4WNE A;  5ARG A;  2J4D A;  4KT6 B;  4N3B A;  5D0Q D;  5FWQ A;  5KJN A;  4D10 C;  4I6G A;  4HOU A;  1A17 A;  1HF8 A;  2BF0 X;  2VQ2 A;  3OXF A;  1IHG A;  2CG2 A;  2WXH A;  1MHQ A;  3SNX A;  3MGB A;  4A3T A;  1ELR A;  2WXJ A;  3CHS A;  4U8H A;  4ACL A;  3L17 A;  3QB2 A;  1NP7 A;  2VYI A;  2IOS A;  4C9B B;  1E90 A;  1ZBP A;  4AOF A;  4NQ0 A;  2KC7 A;  2KCK A;  2XPZ A;  3T8M A;  4FHK A;  2AVP A;  1MQS A;  2I6H A;  2WXG A;  3URZ A;  3B7T A;  4CRW A;  3ASG A;  3FFL A;  4IYP A;  1IYG A;  1KT0 A;  5EX0 A;  2XCC A;  3FTW A;  4ILI A;  3R7Q A;  5T8I A;  4ILG A;  2R5S A;  2IF4 A;  5C2Y A;  4UWL A;  2GGF A;  1UG3 A;  3JCK C;  2J49 A;  4PH4 B;  1H2V C;  5ENN A;  4AJW A;  4I1M A;  3B7S A;  4XZ4 A;  3RRN B;  2VSY A;  3CIA A;  4KVO A;  4GZ6 A;  5BW8 C;  4HLE A;  4CCA A;  1HX8 A;  4K03 A;  3PRE A;  4N2S A;  4TUU A;  3ONK A;  5M72 A;  4GB9 A;  1FVF A;  3OTN A;  4FAD A;  2VTB B;  3IHV A;  5CMY A;  5FT9 A;  3WXX A;  4FA6 A;  4HVB A;  3FU3 A;  3FP3 A;  3FTY A;  2A4Z A;  2E0I A;  2X6I A;  4I43 A;  4BT8 A;  3RU0 A;  1HH8 A;  4G11 A;  5G55 A;  3MKR A;  1EYH A;  2CHZ A;  3CV0 A;  5J08 A;  2NC9 A;  1H6K A;  3EHM A;  3VTY A;  1H2U A;  1INZ A;  3FTZ A;  3T5X A;  3ZYQ A;  1JUQ A;  4JXT A;  4FLB A;  3ZHE B;  1IQR A;  5EX3 A;  3ZW3 A;  4TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...