2RG8A

Crystal structure of programmed for cell death 4 middle ma3 domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 4
publication title PDCD4 inhibits translation initiation by binding to eIF4A using both its MA3 domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis, translation
total genus 51
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2rg8A00
2IOSA 1H6KA 2RG8A 3D3MA 3JUIA 2FULA 2ZU6B 1H2TC 1N52A 1UW4B 2IU1A 2IONA 3RK6A 4B89A 4CEMA 2VSXE 1PAQA 1UG3A 3FEXA 5ANRA 4CT4A 2HM8A 4JHKA 4B8CB 2I2OA 2GGFA 1HU3A 3FEYA 2NSZA 1H2VC 2VSOE 4GMLA 4CRWA 2IOLA 3EIJA 2KZTB 3L6AA 4IULA 1H2UA 4LUNU 4B8AA 2KZTA 1N54A 4C9BB 4JHJA 4GMJA 3EIQC
chains in the Genus database with same CATH superfamily
5G2NA 1N94A 3B7BA 3FTSA 3UUXA 1EDUA 1WY6A 2VGXB 4BESA 1FT1A 2XPZA 1A17A 4FJZA 4YDEA 5AYWD 3HVEB 2MRIA 5AN8A 2A5UA 2KCLA 2P9NG 3AS4A 3DEOA 1EYHA 3URZA 2NYJA 3LXUX 2XGMA 1EPUA 4TXQA 1HO8A 4UWHA 4X8QA 4DX5D 2X38A 2WPVA 4GYYA 3I3NA 4HI8A 3IBEA 2J09A 4RVBA 3FY4A 3APFA 1BU9A 4BSZB 2ETCA 2DYRE 2QC9A 3PZ4A 5M72A 4KZCA 3UMVA 2WXRA 3QWVA 4BWRA 1PC2A 3FU6A 2WXLA 3FUEA 4OAUC 1VDYA 3V79K 2B6CA 2J4DA 1PAQA 4XIFA 2F8YA 3FP3A 2WXKA 5G04C 3PZ1A 3DRAA 3L6AA 3DSWA 5EX3A 4E6HA 4JL0A 1GW6A 4I1OB 3APCA 5JJ7A 2OV8A 4N2QA 4G8KA 2IONA 3BEEA 2BEDA 2WXQA 2OVFA 3UX4A 2ZIRA 2GROB 1NI1A 4HI9A 2XEVA 2V0PA 1K3ZD 4NACA 3LJNA 5EYPF 3G2WA 3FFLA 2FBNA 4K5CA 2X6JA 1QYMA 5AARA 2R17C 4DI4A 4K0RA 4GA0A 4O1OA 4ILIA 2V4LA 1IKND 1FCHA 3C3RA 2PM7A 2V5QC 3CHRA 5D66A 1TJFA 1SW6A 2H6HA 2PQNA 4KZ0A 5ENOD 3UT7A 2P9IG 2X3MA 4K5AB 4A63B 5HRYA 3EU9A 5EKQD 1WAO1 2P2CP 1MHQA 3OXFA 4GTSA 2Q7FA 3PUJA 3CV0A 3FUFA 2IO2C 2J49A 4LERA 2MYOA 1BD8A 3SD5A 1QNFA 3ZN3A 5CHEE 3FTYA 2V5FA 1HXIA 2ILRA 4HOTA 4URKA 2PQRA 3HYMB 3ONLA 4EHMA 3FU3A 4U8YD 3EDTB 3QNKA 2XENA 3GZSA 4XKCA 3FTZA 5CEAA 1LD8A 3CVYA 4XZ4A 2V8SE 5BNWA 3HXEA 3I5PA 4RQIA 1N4RA 4GPMA 5KNGA 4UWKA 3VLDA 2J07A 1ELKA 1OY3D 2GW1A 2R03A 3AG1E 3R7QA 3JUIA 3CSFA 3TWTA 3NF1A 3MKQA 5AQAA 4KT6B 2KXPC 2FO1E 5B1BE 3HG0D 5ENTD 1HH8A 3CLJA 2EILE 1TN8A 4A3TA 1W3BA 1LTXA 5ARGA 3V31A 2C0MA 1ELWA 3NQPA 4HRNA 4MLPA 1ELRA 1JPLA 2R2LA 5FQ7A 4G11A 3B7UX 3TXMA 4O6FA 3PNTB 3G2VA 2IEJA 1BLXB 3TG4A 4N5QA 2KCKA 1OWPA 5JHAA 3RRNB 1NZNA 2NXPA 3QKYA 2H6IA 4RLYA 3FTWA 2IU1A 4BETA 2XEHA 4YNDA 4H7YA 2Y3AA 3S2AA 3CKBA 4UWFA 2ZGDA 4ANWA 2F8XK 4TUMA 3G2TA 5BUZA 4A1GA 4ILHB 3G2SA 3T5XA 3TAXA 3Q7FA 3B7TA 3MZLB 4HRMB 3ESLA 4ME2A 4L23A 4UUCA 5HS0A 3C3OA 4CCAA 1V54E 3FUMA 3Q7AA 1Y8MA 4I9CA 3CSTA 4EECA 2IOSA 4XE0A 5AQ9A 1E8XA 3ONKA 4KVMA 1WM5A 5JMND 2IF4A 3ASFA 3LJ3A 3O48A 5CRVA 4GZ3A 1WDYA 2J4BA 4J8EA 4I2WA 5EYLA 4B8CB 3VTXA 1U3CA 4J8YA 3CHMA 4GPKA 4F7AA 3CVLA 1KLXA 5D0QD 2HYZA 3L17A 4U04A 3Q78A 4GA2A 5AQ7A 4GZDA 2H6GA 4U8HA 5EILA 5HKPA 5AENA 1E7UA 3KEZA 4HOSA 4LRZA 3U3WA 2ZGGA 2RKKA 4GAAA 2ZXWE 4U95D 3IXEA 3OAWA 2LNIA 2IO3C 3ZKJA 1IHGA 3B13A 2JEKA 4ANUA 2VTBB 1S0PA 2VSNA 1FVHA 2XGSA 5ENQD 2LSVA 4CT4A 3Q15A 3SZ7A 3ZW3A 2IOLA 2GRPB 2IY0C 1H2UA 4GCNA 4WWPA 2DCPA 3PE3A 4C48B 5T8IA 4U0ZA 2FI7A 3CVUA 3SY2A 4APOA 5AIJA 2YQ8A 1WG0A 3U4TA 4U8VD 3FULA 4FULA 5A23A 3ASOE 5FQ8A 4UI9K 2WB2A 5CMYA 4XI0A 1K8KG 1OT8A 2Y1LE 3NAWA 5CEDB 5BT1A 2WXNA 3DEPA 1H0AA 2XCCA 4GTRA 2WMOA 3JYSA 4JA7A 1U2VG 4C9BB 4Q69A 4F53A 3FUIA 5KNHD 5HI7A 5CBOA 2CG2A 4JHKA 3AU4A 3L22A 4IRUA 3LCAA 4DUIA 4M3OA 1N4SA 3N71A 5C2YA 4GTQA 3ZYLA 3E30A 3ZNGA 4DX7D 3X2QE 3ZYQA 1FVFA 3UM2A 3KD7A 2LUHA 2M63A 4JB8P 3PZDA 4L2LA 4MKTA 3NZUA 5ARFA 3SFYA 5B1AE 4I1MA 5CBNA 2XHEA 3LKUA 4A1SA 5LP0A 3DPDA 4UQZA 4YDWA 4EPZA 4JZYA 3RU0A 2OEWA 4Q96A 1TNBA 3QAQA 4V3IA 4U07A 3AG4E 2CHWA 4G23A 3FH7A 2R5SA 2BKKB 2FO7A 4HORA 2WVIA 4BT8A 1Q2ZA 1HG5A 3LY8A 3JXJA 1NL4A 2OVBA 3SBSA 4I1AA 4FHJA 1TR4A 5LCWC 4UI9C 4WUYA 1NA3A 5G05C 2LXLA 1MJ0A 3RK6A 4JVSA 4GMLA 1QQEA 2YHCA 4AM9A 3MEKA 1OWNA 4N2SA 4AY5A 1DCQA 3AS8A 2VQ2A 3JQ0A 3QJZA 4AY6A 2ZU6B 2WXGA 1YMPA 2KATA 4DK5A 1OWMA 3Q79A 2HE0A 3BUAA 1Z5SC 3RO3A 4NRHB 5FJYA 1A5EA 2XQ0A 2EIJE 3C3QA 4DX6D 3E33A 3QC1A 4HRLA 2AXUA 4DLOA 4GTVA 4LNGA 3LVQE 3JQ1A 3UM0A 2DIWA 5D0OD 3BQOA 4BSXA 1JWFA 4CDNA 3B7RL 4JXTA 4UWGA 5IY5E 4I6GA 2H6FA 4DLQA 2JLBA 4NURA 1UG3A 3ZXPA 3HXFA 4KYOB 4B93B 1DC2A 3MCXA 3ULEG 2OEVA 3E34A 3I4GA 3ESKA 4CYMD 2CG3A 3BG0B 3K9IA 5KCMA 1X5BA 2P9PG 1TNYA 4HOUA 3RSEG 3QDNA 4BTBA 3I4RB 3FU0A 4FJYA 3RAUA 1HF8A 1FT2A 3AJIA 4CDRA 4JW1A 3SQVA 1SA5A 5C1DA 2AXZA 1ZB1A 2EINE 5CMWA 2HR2A 2BKGA 4F1SA 3CVNA 4WWOA 1MYOA 1S64A 3MX3A 4Q94A 3LVRE 3D9LA 1Y6IA 4J6IA 2PZIA 5BV1A 1H19A 3PH0C 4GA1A 3ZHEB 2KZTA 3L08A 4DI3A 4ACLA 2P9SG 3Q49B 2Y0BG 1UJJA 2J08A 3S7BA 5JJ6A 1H2VC 4BX9A 3Q73A 1H6PA 4I6EA 2EQXA 1OCOE 2ETBA 3UIOC 3ASNE 5A6CA 4YDYA 2RG8A 3OXGA 3EJNA 2E0IA 4FHKA 3SNXA 5G55A 3AU5A 3CK7A 2VGEA 3R7RA 3CKCA 4WWNA 5AJLA 2PM6A 2DYSE 4L9PA 3T9KA 4GMJA 3TWVA 4DPRA 1KT1A 4IULA 3NOGD 3FH5A 1N95A 5FIOA 4WAFA 3SFXA 4XKBA 1OCRE 3CVQA 1SZ9A 2IJGX 2VSYA 4RG6A 3ZYMA 3L13A 2WXPA 3ZEFA 3ZYKA 4ABNA 1ZBPA 5FINA 2EIKE 3S7DA 3FH8A 2KC7A 5A7DB 4B89A 5B3SE 2J8SD 4FU3A 3HIZA 4GMRA 3PZ3A 4BX8A 4MBGA 3CVXA 1EF1C 3NOCD 5FT9A 3D3MA 3UTMA 4Y6CA 2CHXA 3KSQA 4YVQC 2HO1A 4AP2A 3PNLB 5CRUA 1E7VA 2VGXA 3APDA 1TEZA 3MYVA 1E8ZA 2VSOE 5EN5D 3E32A 4EZJA 3AS5A 3HVEA 4F1PA 3AG3E 4I9EA 1TNOA 3CGHA 4GZ5A 5ENRD 3JCKC 1H6KA 1N4QA 1D8DA 4N3CA 1NFIE 3CVWA 1P5QA 4KMOA 2GRNB 5FTPA 3IKOB 3EHNA 1FPPA 3NZSA 4FC8A 2KBXA 2BUGA 1O1RA 3TJPA 1HE8A 3Q9NC 2Y4UA 1KZPA 4EBAG 4E85A 5CCLA 4U96D 4FP7A 3RKVA 4H7XA 2DZOA 2Y4TA 3CVPA 3F6QA 4HOQA 1H2TC 1N0QA 3FDHA 3SI5A 4QQIA 4LNUD 4OVUA 5FWQA 4F3VA 4AJWA 5G04J 1MX2A 3B95A 3PUKA 4B94A 3D9JA 3NBNB 4JC8A 2QFCA 3FHEA 2QZAA 2P9KG 3DSTA 2WQHA 4L2YA 4HQDA 4BTAA 3LPZA 3RRUA 4HBDA 4O1PA 4PS8A 5BXOA 5KWDA 1XNFA 4GTOA 1B89A 3CQCB 3MA5A 3SGHA 3D9KA 4CEMA 4AOFA 2XS8A 3D9IA 3BU8A 2WMNA 5FQ4A 5DIZA 3DSSA 5KJMA 2WXMA 2XPIA 1AWCB 2PL2A 5FZRA 1BPOA 4LG6A 4AIFA 4ATZD 4J8SA 4JHRA 1IYGA 3Q4AB 2WQ7A 4G2VA 3TG5A 4AXHA 3FTUA 1IQRA 1O1SA 5ENPD 4OAVB 3CHOA 1HG2A 2AXVA 5ANRA 4ILGA 2R02A 5ENSD 4N3AA 2DZNA 4ZHBA 4IN3B 4RSYA 5BXUA 3ASDA 4AEZC 3QWWA 2AVPA 3UKRG 4GU5A 4G8LA 2L6JA 4FLHA 3NB2A 3CK9A 1OCZE 3WXXA 3EUVA 2LAHA 3OXLA 1S63A 4QFVA 1N54A 4AVXA 3V30A 2C0LA 4G1TA 4FLBA 2YINA 3CHPA 3B7SA 3GW4A 2I1KA 1SA4A 1UN8A 5LFAA 5AQBA 2AWIA 2DVWA 3P2BA 4BERA 3FUDA 3S7FA 3MGBA 4U0SA 5J90A 1G3NB 3ZIMA 3ASHA 1PY1A 3C5RA 3JUEA 3CIAA 5FQ6A 1Z3XA 2FULA 1BI7B 3MKQB 4HS2A 4CZ2D 1SQMA 2MHKA 2NSZA 1MZCA 5BV0A 1DCEA 1LF8A 5J08A 1JUQA 3AG2E 2YNQA 3DPYA 1HFAA 4A3VA 5ENNA 3ZFWA 5ITZF 2X6KA 4JD2G 5LX8A 3KEAA 4CT0A 2GRLA 3FU5A 4DX1A 3ZRHA 4CGVA 3SF4A 5CERB 1NA0A 4EZKA 3RIBA 2AJAA 2I1JA 2I6HA 2A4ZA 5KBAA 1XGWA 2XEEA 3KS2A 4Y6WA 4GYWA 3J5QB 2XGOA 5D2MC 3SHFA 3ML8A 1BI8B 1JCQA 4XX5A 2CFUA 2X6IA 1V55E 4LUNU 1NP7A 4TRQA 1SZAA 5AAOA 4K03A 2UY1A 1OWOA 3DWLG 1N9AA 5EIDA 3ZU7B 3CHSA 5KJKA 3ABME 2LO6A 4L1BA 2L6BA 3PRZA 1LD7A 2MOWA 4W9RA 1X81A 3EIQC 4PUCA 2OCCE 1TYQG 2BF0X 1Z6TA 3HRAA 3SBTB 4PS7A 4DRXE 3HXCA 4DJAA 4WNGA 2FF4A 3UINC 4HFGA 3PEVB 4J7WA 4GZCA 4DX2A 1UOHA 3ASGA 3D9HA 5T3RA 3D9NA 4GTTA 4XEIG 4LCTA 4CGWA 4WNFA 4YVOA 3HXDA 4LSZE 4NQ0A 4ANXA 3U66A 3QOUA 2XZDG 4JA9A 3JXIA 1OXJA 3L54A 3LY7A 5CECB 3PREA 5JA4D 4GTMA 3EIJA 1DNPA 2B0OE 2L0TB 3SFZA 1OWLA 2WXFA 4J0UA 4U7EB 2X6FA 3PS6A 3RJVA 2F0YA 4ZFHA 1S70B 3T5VA 2VTBA 4APFA 2GRRB 4EBAA 3UI2A 2XRYA 3FEXA 3BG1B 4I43A 3DBSA 2GGFA 3DXMG 4HVBA 3FWVA 1HS6A 4RG9A 5LOZA 3DSXA 3CVVA 1TNUA 4K5BA 3ISMC 4G25A 4R7LA 1YCSB 1N52A 2RFAA 4KVOA 3L9TA 1K1BA 2RD0A 1UJKA 2L9BA 4KXKB 3LYAA 2XZTG 1IQUA 3EU5A 3KAEA 4MRUA 2VGYA 4CRWA 4BFRA 1JCRA 4GZ6A 4BEPA 4U0UA 3IV0A 2WXHA 4BY6A 3R9AB 2DWZA 3VLFA 2GRQB 4U63A 3P1UA 1KPSB 2P58C 1E96B 2AW6A 3ZPJA 3FUKA 4AV7A 3UM1A 3UQ3A 2F37A 1HZ4A 2R59A 2Y69E 1QZ2A 3EHMA 2RFMA 4HB5A 3ZVVA 5EX0A 2LSUA 3FUNA 3Q47B 4LEUA 2BTDA 2QY7A 3TWSA 2IQCA 3PE4A 5DBKA 4OVVA 3C72A 4PS3A 4JEUA 4XI9A 3VTYA 2R05A 1JCSA 3OTNA 5JJTA 3D9MA 1E8YA 3ULQA 4YDOA 4G24A 2P9LG 5FZSA 3V2XA 5EDSA 1RW2A 3AAAC 1TJCA 1DVPA 2ZISA 3Q75A 1D8EA 1KT0A 3J5PA 1H6OA 4OYSA 2L0IA 3ABLE 2I9CA 4D10C 1HU3A 3G2UA 3FEYA 2WXOA 4HLEA 2WQ6A 3PEUB 3UKUG 2FEZA 3UM3A 4IYPA 5HQ8A 3IEGA 5T4YA 1E8WA 3CQGB 1AP7A 3HHMA 2XS1A 5LCWJ 4WNDA 4UI9J 3W9GA 2EIME 5G05J 4Z68A 5KJNA 3ZXSA 3TWXA 3L82A 3CR3A 3CK8A 4GB9A 3GZ1A 1JWGA 4L7TA 1TN7A 1D9SA 4G26A 1UN9A 3LDZA 1INZA 4UQYA 1E90A 4B8AA 3HXBA 2P9UG 4B0ZA 2DBAA 2UY1B 1U3DA 3LY9A 4TXPA 4N5CA 2WXJA 3LS8A 3QB2A 4TUUA 2YHEA 4P29A 5EIBE 2J9QA 1ZU2A 5KJLA 3FTXA 4I2ZA 5CCMA 2CFZA 2UWJG 3MKRA 4UQXA 2XRZA 1HX8A 4GTPA 3D9OA 3U64A 3VLEA 3EHQA 2IFUA 3CHQA 4ANVA 3QK0A 5E76A 4HNAD 4ATGA 4EZLA 4A55A 1QBQA 5JHBA 3TWQA 2JABA 3SO8A 2LXMA 2NC9A 4I6JA 3ZGQA 3T8MA 4JHJA 4JPSA 3RRMB 4TXRA 1TNZA 2WM9A 3O4ZA 4ACKA 3ABKE 4C0MA 2X6HA 2XPYA 5ANLA 2KCVA 3TXNA 1RZ4A 3ZUVB 3KSLA 1N4PA 3UXGA 2WXIA 5BW8C 3ENEA 2XCBA 3DSUA 3ML9A 2VYIA 1UW4B 1YYHA 3IHYA 4I17A 3TWWA 1N11A 2VSXE 4O60A 4UWLA 3TWRA 2ONDA 4PH4B 3WG7E 2VJ8A 4J8FA 1TN6A 3GZ2A 3S7JA 2QYUA 2OOEA 4CDMA 1MX4A 3PVLA 4F6RD 3PDNA 5H7PA 2I2OA 1Z3YA 3FUJA 1OUVA 2KZTB 4JEHA 3PZ2A 4GCOA 3QARA 1O5MA 4PDXA 3ZHEA 3L16A 3FTVA 3T8KA 4BT9A 1IXVA 3TGOA 3FUHA 3DXKG 3C98A 5AJDA 3D9PA 4TV3A 2CHZA 3HDXA 3TL5A 4HXIA 3QWPA 3U9WA 1K1AA 3DSVA 2A5EA 2LAIA 2E2EA 4HLLA 1MQSA 4N39A 3MV3B 2ETAA 4MS6A 1IHBA 4LNBA 4C0EA 3V2OA 3UT8A 2V4HC 3MJWA 3E4BA 4FADA 3RO2A 4N3BA 1MX6A 4EQFA 4FA6A 4J8DA 2KM4A 1YA0A 4WNEA 3GYZA 2C2LA 1N0RA 4NIKA 5FZQA 2QYJA 3MV2B 3E37A 1KZOA 1SVXA 1L5JA 3Q9UC 3EHRA 5BPPA 3LEWA 3Q5MA 4GYOA 3ULYA 4M7CA 3UT4A 3TWUA 2HM8A 3IHVA 3UIPC 1OCCE 2GRMA 3W9FA 3R9MA 3UPVA 4KBQA 5E75A 1O1TA 3CEQA 2PNNA
chains in the Genus database with same CATH topology
5G2NA 5FT9A 5T8IA 3D3MA 4G25A 4R7LA 4U0ZA 4Y6CA 1N52A 2CHXA 4KVOA 2FI7A 4YVQC 3FTSA 3UUXA 3CVUA 2RD0A 1UJKA 2HO1A 1EDUA 2L9BA 4AP2A 1WY6A 3PNLB 4KXKB 2VGXB 3LYAA 4APOA 1E7VA 1IQUA 5AIJA 2VGXA 3APDA 1TEZA 3KAEA 2XPZA 1A17A 3MYVA 1E8ZA 2VSOE 4FJZA 5AYWD 2YQ8A 2VGYA 4MRUA 4BFRA 4CRWA 3HVEB 4GZ6A 2MRIA 4EZJA 4U0UA 2A5UA 2KCLA 3FULA 4FULA 3AS5A 3HVEA 5FQ8A 3U4TA 3IV0A 5A23A 3AS4A 4UI9K 2WXHA 2WB2A 4I9EA 4GZ5A 3CGHA 5CMYA 4XI0A 1EYHA 4BY6A 3JCKC 1H6KA 3R9AB 3URZA 3VLFA 4N3CA 4U63A 3P1UA 3CVWA 1P5QA 2P58C 4KMOA 1E96B 2AW6A 5FTPA 3ZPJA 3FUKA 3IKOB 3EHNA 3NZSA 4FC8A 3LXUX 4AV7A 2BUGA 2XGMA 1EPUA 3UQ3A 5BT1A 3TJPA 1HO8A 1HE8A 2WXNA 1H0AA 1HZ4A 2XCCA 4UWHA 2WMOA 2Y4UA 3JYSA 2R59A 4JA7A 2X38A 2WPVA 4EBAG 4E85A 4C9BB 5CCLA 4FP7A 3RKVA 4GYYA 4H7XA 1QZ2A 2Y4TA 3EHMA 3CVPA 3ZVVA 3I3NA 4Q69A 4HOQA 5EX0A 3FUIA 4F53A 2LSUA 1H2TC 3FUNA 3IBEA 2BTDA 3Q47B 2J09A 4LEUA 4RVBA 5HI7A 3FDHA 2CG2A 2QY7A 3FY4A 3SI5A 3APFA 2IQCA 4JHKA 3PE4A 4OVUA 5DBKA 3AU4A 5FWQA 4F3VA 4OVVA 4AJWA 3L22A 4PS3A 4IRUA 5G04J 3LCAA 5M72A 4M3OA 4KZCA 3UMVA 2WXRA 3PUKA 3QWVA 4JEUA 4BWRA 4XI9A 3N71A 5C2YA 1PC2A 3FU6A 2WXLA 3VTYA 4B94A 3FUEA 3ZYLA 3D9JA 4JC8A 5LP0A 3OTNA 2QFCA 1VDYA 3FHEA 5JJTA 3D9MA 2WQHA 2J4DA 1PAQA 1E8YA 4L2YA 4XIFA 3ULQA 3FP3A 3ZYQA 4G24A 1FVFA 2WXKA 5FZSA 5G04C 4BTAA 5EDSA 3LPZA 3KD7A 3RRUA 3L6AA 4PS8A 2M63A 1TJCA 1DVPA 5EX3A 4E6HA 4JL0A 1XNFA 3PZDA 1GW6A 4L2LA 4MKTA 3NZUA 5ARFA 4I1OB 1B89A 3APCA 3CQCB 3MA5A 5JJ7A 2OV8A 4N2QA 1KT0A 3SGHA 4OYSA 2IONA 3BEEA 2L0IA 3D9KA 4I1MA 2WXQA 4CEMA 2OVFA 4AOFA 2XHEA 3D9IA 3UX4A 2I9CA 2WMNA 3LKUA 4D10C 4A1SA 1HU3A 3G2UA 3DPDA 2WXOA 2XEVA 3FEYA 4UQZA 2V0PA 5FQ4A 4EPZA 4HLEA 2WQ6A 4JZYA 3RU0A 5DIZA 3PEUB 2FEZA 4IYPA 5HQ8A 5KJMA 3IEGA 2WXMA 5T4YA 1E8WA 4NACA 3CQGB 4Q96A 3QAQA 3G2WA 4V3IA 2XPIA 4U07A 2PL2A 3FFLA 3HHMA 2FBNA 1BPOA 5FZRA 2X6JA 5LCWJ 4WNDA 4UI9J 2R17C 4DI4A 4K0RA 4GA0A 2CHWA 4G23A 3FH7A 2R5SA 5G05J 4ILIA 2V4LA 1FCHA 2FO7A 4HORA 2WVIA 2PM7A 4AIFA 4BT8A 1HG5A 3LY8A 3CHRA 4J8SA 4JHRA 5KJNA 1TJFA 1IYGA 2OVBA 3ZXSA 3SBSA 3Q4AB 4I1AA 2WQ7A 2PQNA 4FHJA 4G2VA 4KZ0A 3TG5A 3CR3A 4AXHA 3CK8A 3FTUA 4GB9A 1IQRA 3UT7A 5LCWC 3GZ1A 4UI9C 4WUYA 1JWGA 2X3MA 3CHOA 4L7TA 1HG2A 1NA3A 2AXVA 5G05C 5EKQD 3RK6A 5ANRA 1WAO1 4ILGA 1MHQA 3OXFA 4G26A 4JVSA 4GMLA 1UN9A 3LDZA 4N3AA 2Q7FA 3PUJA 3CV0A 1INZA 4UQYA 4IN3B 2YHCA 1QQEA 1E90A 4B8AA 3FUFA 4RSYA 3ASDA 2J49A 4B0ZA 4LERA 4AM9A 2DBAA 2UY1B 1OWNA 1U3DA 3MEKA 4N2SA 3SD5A 3LY9A 4AY5A 4AEZC 3AS8A 2AVPA 2VQ2A 3JQ0A 3QWWA 1QNFA 3QJZA 4AY6A 2ZU6B 4GU5A 3ZN3A 5CHEE 4N5CA 2WXJA 3FTYA 3LS8A 2WXGA 3QB2A 4TUUA 2YHEA 2L6JA 2V5FA 4P29A 4FLHA 2KATA 3CK9A 4DK5A 1OWMA 1HXIA 2J9QA 3RO3A 1ZU2A 3WXXA 2ILRA 5KJLA 4HOTA 3FTXA 4I2ZA 5CCMA 4URKA 2PQRA 3HYMB 3ONLA 2CFZA 2UWJG 4NRHB 3MKRA 2LAHA 3OXLA 4UQXA 5FJYA 3FU3A 2XRZA 1HX8A 4QFVA 3EDTB 1N54A 2XQ0A 3QNKA 4AVXA 3D9OA 3U64A 2C0LA 3VLEA 2IFUA 4G1TA 3CHQA 4ANVA 3GZSA 4FLBA 2YINA 3QK0A 4XKCA 3FTZA 3CHPA 3B7SA 3GW4A 2I1KA 3CVYA 4XZ4A 1UN8A 5LFAA 3QC1A 2V8SE 5BNWA 5E76A 2AWIA 3I5PA 2AXUA 4DLOA 4ATGA 4EZLA 3P2BA 4A55A 5JHBA 3LVQE 3FUDA 2DIWA 3JQ1A 5D0OD 4UWKA 4BSXA 3S7FA 3VLDA 1JWFA 2J07A 2NC9A 1ELKA 4I6JA 3ZGQA 3MGBA 4U0SA 2GW1A 3T8MA 5J90A 4JHJA 3B7RL 4JPSA 4CDNA 3ZIMA 4JXTA 4UWGA 3RRMB 3ASHA 1PY1A 4I6GA 3CIAA 3R7QA 5FQ6A 1Z3XA 2WM9A 3O4ZA 4ACKA 3JUIA 2FULA 4C0MA 2X6HA 4DLQA 2XPYA 2JLBA 3CSFA 3MKQB 4NURA 3NF1A 5ANLA 1UG3A 3MKQA 2KCVA 4HS2A 4KT6B 3TXNA 1SQMA 1HH8A 2MHKA 3CLJA 2NSZA 4KYOB 3MCXA 4A3TA 5BV0A 1W3BA 1LF8A 5J08A 3I4GA 1JUQA 2WXIA 5BW8C 5ARGA 3ENEA 3ESKA 2YNQA 2XCBA 2CG3A 1HFAA 3BG0B 3K9IA 3ML9A 5KCMA 4A3VA 1X5BA 2VYIA 5ENNA 3ZFWA 4HOUA 2C0MA 1UW4B 2X6KA 3IHYA 1ELWA 3FU0A 3I4RB 3NQPA 3QDNA 4I17A 4BTBA 4MLPA 5LX8A 1ELRA 2VSXE 4FJYA 1JPLA 4CT0A 5FQ7A 4G11A 3B7UX 4UWLA 2GRLA 3TXMA 1HF8A 3FU5A 4O6FA 3PNTB 3ZRHA 4CGVA 3SF4A 4CDRA 2ONDA 3G2VA 4JW1A 1NA0A 4PH4B 4EZKA 3TG4A 2KCKA 3RIBA 5C1DA 2VJ8A 2I1JA 2AXZA 4J8FA 1OWPA 5JHAA 2I6HA 3GZ2A 3RRNB 5CMWA 2HR2A 1NZNA 2A4ZA 2NXPA 1XGWA 3QKYA 4F1SA 3S7JA 3CVNA 4WWOA 3FTWA 3KS2A 2IU1A 3MX3A 4Y6WA 4GYWA 4Q94A 2OOEA 2XGOA 4CDMA 3PVLA 4YNDA 3PDNA 3LVRE 3SHFA 3D9LA 4H7YA 2I2OA 1Z3YA 3FUJA 1Y6IA 2Y3AA 1OUVA 3ML8A 4J6IA 3S2AA 3CKBA 4UWFA 2CFUA 2PZIA 4XX5A 4ANWA 5BV1A 1H19A 2X6IA 2KZTB 3PH0C 4JEHA 4LUNU 3G2TA 4GA1A 3QARA 2KZTA 4GCOA 1NP7A 3L08A 4TRQA 1SZAA 3ZHEB 4PDXA 3ZHEA 5BUZA 3L16A 4A1GA 4ILHB 4DI3A 4ACLA 3FTVA 4K03A 2UY1A 1OWOA 3Q49B 3G2SA 3T5XA 1UJJA 2J08A 3TAXA 4BT9A 3CHSA 3TGOA 3FUHA 3B7TA 3S7BA 3MZLB 3C98A 5AJDA 3D9PA 5KJKA 2LO6A 3ESLA 4L1BA 5JJ6A 4TV3A 2CHZA 3HDXA 4ME2A 4L23A 3TL5A 1H2VC 3PRZA 4BX9A 4HXIA 2MOWA 3QWPA 4I6EA 4CCAA 4W9RA 3U9WA 2EQXA 3FUMA 1Y8MA 5A6CA 4I9CA 3EIQC 3CSTA 4EECA 4PUCA 2IOSA 2RG8A 3OXGA 3EJNA 4XE0A 1E8XA 2E0IA 3ONKA 4FHKA 4KVMA 2LAIA 1WM5A 3SNXA 2BF0X 2IF4A 3ASFA 3LJ3A 1Z6TA 2E2EA 3O48A 1MQSA 5G55A 3SBTB 3AU5A 3CK7A 4GZ3A 4PS7A 4DJAA 2J4BA 2FF4A 4N39A 4J8EA 4HFGA 3PEVB 3MV3B 4I2WA 4MS6A 4GZCA 4WNGA 3VTXA 1U3CA 3R7RA 4B8CB 3CHMA 4C0EA 4GPKA 3ASGA 3CKCA 4F7AA 3CVLA 4WWNA 1KLXA 5T3RA 3D9NA 2HYZA 3L17A 4U04A 5D0QD 5AJLA 4CGWA 4LCTA 3UT8A 2PM6A 4GA2A 4WNFA 4GZDA 3MJWA 3E4BA 4U8HA 4YVOA 4FADA 4GMJA 4DPRA 4NQ0A 1KT1A 4IULA 4ANXA 5AENA 3FH5A 1E7UA 3KEZA 4HOSA 3U66A 3QOUA 3RO2A 4JA9A 4LRZA 4N3BA 4EQFA 3U3WA 4WAFA 4GAAA 4FA6A 3L54A 3LY7A 3PREA 4J8DA 3OAWA 2KM4A 4XKBA 1YA0A 3CVQA 3GYZA 4WNEA 2C2LA 1SZ9A 2LNIA 3EIJA 1DNPA 2L0TB 3SFZA 2IJGX 2VSYA 4RG6A 1OWLA 5FZQA 2WXFA 3L13A 3ZYMA 2WXPA 4J0UA 2X6FA 3MV2B 3ZEFA 3PS6A 3RJVA 3ZYKA 1IHGA 3B13A 4ABNA 1ZBPA 2JEKA 4ANUA 2VTBB 1S0PA 1L5JA 3S7DA 3FH8A 2KC7A 5BPPA 2VSNA 3T5VA 1FVHA 2VTBA 3LEWA 2XGSA 3Q5MA 4GYOA 4APFA 5A7DB 4EBAA 4B89A 2XRYA 3FEXA 3BG1B 2LSVA 4FU3A 3UT4A 4CT4A 4I43A 2HM8A 3HIZA 3DBSA 2GGFA 3IHVA 3Q15A 4HVBA 3FWVA 1HS6A 4RG9A 5LOZA 3SZ7A 3ZW3A 2IOLA 2GRMA 1H2UA 4GCNA 3UPVA 4BX8A 3CVVA 4WWPA 2DCPA 3PE3A 3CVXA 4KBQA 1EF1C 5E75A 3CEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOS A;  1H6K A;  2RG8 A;  3D3M A;  3JUI A;  2FUL A;  2ZU6 B;  1H2T C;  1N52 A;  1UW4 B;  2IU1 A;  2ION A;  3RK6 A;  4B89 A;  4CEM A;  2VSX E;  1PAQ A;  1UG3 A;  3FEX A;  5ANR A;  4CT4 A;  2HM8 A;  4JHK A;  4B8C B;  2I2O A;  2GGF A;  1HU3 A;  3FEY A;  2NSZ A;  1H2V C;  2VSO E;  4GML A;  4CRW A;  2IOL A;  3EIJ A;  2KZT B;  3L6A A;  4IUL A;  1H2U A;  4LUN U;  4B8A A;  2KZT A;  1N54 A;  4C9B B;  4JHJ A;  4GMJ A;  3EIQ C; 
#chains in the Genus database with same CATH topology
 5G2N A;  1N94 A;  3B7B A;  3FTS A;  3UUX A;  1EDU A;  1WY6 A;  2VGX B;  4BES A;  1FT1 A;  2XPZ A;  1A17 A;  4FJZ A;  4YDE A;  5AYW D;  3HVE B;  2MRI A;  5AN8 A;  2A5U A;  2KCL A;  2P9N G;  3AS4 A;  3DEO A;  1EYH A;  3URZ A;  2NYJ A;  3LXU X;  2XGM A;  1EPU A;  4TXQ A;  1HO8 A;  4UWH A;  4X8Q A;  4DX5 D;  2X38 A;  2WPV A;  4GYY A;  3I3N A;  4HI8 A;  3IBE A;  2J09 A;  4RVB A;  3FY4 A;  3APF A;  1BU9 A;  4BSZ B;  2ETC A;  2DYR E;  2QC9 A;  3PZ4 A;  5M72 A;  4KZC A;  3UMV A;  2WXR A;  3QWV A;  4BWR A;  1PC2 A;  3FU6 A;  2WXL A;  3FUE A;  4OAU C;  1VDY A;  3V79 K;  2B6C A;  2J4D A;  1PAQ A;  4XIF A;  2F8Y A;  3FP3 A;  2WXK A;  5G04 C;  3PZ1 A;  3DRA A;  3L6A A;  3DSW A;  5EX3 A;  4E6H A;  4JL0 A;  1GW6 A;  4I1O B;  3APC A;  5JJ7 A;  2OV8 A;  4N2Q A;  4G8K A;  2ION A;  3BEE A;  2BED A;  2WXQ A;  2OVF A;  3UX4 A;  2ZIR A;  2GRO B;  1NI1 A;  4HI9 A;  2XEV A;  2V0P A;  1K3Z D;  4NAC A;  3LJN A;  5EYP F;  3G2W A;  3FFL A;  2FBN A;  4K5C A;  2X6J A;  1QYM A;  5AAR A;  2R17 C;  4DI4 A;  4K0R A;  4GA0 A;  4O1O A;  4ILI A;  2V4L A;  1IKN D;  1FCH A;  3C3R A;  2PM7 A;  2V5Q C;  3CHR A;  5D66 A;  1TJF A;  1SW6 A;  2H6H A;  2PQN A;  4KZ0 A;  5ENO D;  3UT7 A;  2P9I G;  2X3M A;  4K5A B;  4A63 B;  5HRY A;  3EU9 A;  5EKQ D;  1WAO 1;  2P2C P;  1MHQ A;  3OXF A;  4GTS A;  2Q7F A;  3PUJ A;  3CV0 A;  3FUF A;  2IO2 C;  2J49 A;  4LER A;  2MYO A;  1BD8 A;  3SD5 A;  1QNF A;  3ZN3 A;  5CHE E;  3FTY A;  2V5F A;  1HXI A;  2ILR A;  4HOT A;  4URK A;  2PQR A;  3HYM B;  3ONL A;  4EHM A;  3FU3 A;  4U8Y D;  3EDT B;  3QNK A;  2XEN A;  3GZS A;  4XKC A;  3FTZ A;  5CEA A;  1LD8 A;  3CVY A;  4XZ4 A;  2V8S E;  5BNW A;  3HXE A;  3I5P A;  4RQI A;  1N4R A;  4GPM A;  5KNG A;  4UWK A;  3VLD A;  2J07 A;  1ELK A;  1OY3 D;  2GW1 A;  2R03 A;  3AG1 E;  3R7Q A;  3JUI A;  3CSF A;  3TWT A;  3NF1 A;  3MKQ A;  5AQA A;  4KT6 B;  2KXP C;  2FO1 E;  5B1B E;  3HG0 D;  5ENT D;  1HH8 A;  3CLJ A;  2EIL E;  1TN8 A;  4A3T A;  1W3B A;  1LTX A;  5ARG A;  3V31 A;  2C0M A;  1ELW A;  3NQP A;  4HRN A;  4MLP A;  1ELR A;  1JPL A;  2R2L A;  5FQ7 A;  4G11 A;  3B7U X;  3TXM A;  4O6F A;  3PNT B;  3G2V A;  2IEJ A;  1BLX B;  3TG4 A;  4N5Q A;  2KCK A;  1OWP A;  5JHA A;  3RRN B;  1NZN A;  2NXP A;  3QKY A;  2H6I A;  4RLY A;  3FTW A;  2IU1 A;  4BET A;  2XEH A;  4YND A;  4H7Y A;  2Y3A A;  3S2A A;  3CKB A;  4UWF A;  2ZGD A;  4ANW A;  2F8X K;  4TUM A;  3G2T A;  5BUZ A;  4A1G A;  4ILH B;  3G2S A;  3T5X A;  3TAX A;  3Q7F A;  3B7T A;  3MZL B;  4HRM B;  3ESL A;  4ME2 A;  4L23 A;  4UUC A;  5HS0 A;  3C3O A;  4CCA A;  1V54 E;  3FUM A;  3Q7A A;  1Y8M A;  4I9C A;  3CST A;  4EEC A;  2IOS A;  4XE0 A;  5AQ9 A;  1E8X A;  3ONK A;  4KVM A;  1WM5 A;  5JMN D;  2IF4 A;  3ASF A;  3LJ3 A;  3O48 A;  5CRV A;  4GZ3 A;  1WDY A;  2J4B A;  4J8E A;  4I2W A;  5EYL A;  4B8C B;  3VTX A;  1U3C A;  4J8Y A;  3CHM A;  4GPK A;  4F7A A;  3CVL A;  1KLX A;  5D0Q D;  2HYZ A;  3L17 A;  4U04 A;  3Q78 A;  4GA2 A;  5AQ7 A;  4GZD A;  2H6G A;  4U8H A;  5EIL A;  5HKP A;  5AEN A;  1E7U A;  3KEZ A;  4HOS A;  4LRZ A;  3U3W A;  2ZGG A;  2RKK A;  4GAA A;  2ZXW E;  4U95 D;  3IXE A;  3OAW A;  2LNI A;  2IO3 C;  3ZKJ A;  1IHG A;  3B13 A;  2JEK A;  4ANU A;  2VTB B;  1S0P A;  2VSN A;  1FVH A;  2XGS A;  5ENQ D;  2LSV A;  4CT4 A;  3Q15 A;  3SZ7 A;  3ZW3 A;  2IOL A;  2GRP B;  2IY0 C;  1H2U A;  4GCN A;  4WWP A;  2DCP A;  3PE3 A;  4C48 B;  5T8I A;  4U0Z A;  2FI7 A;  3CVU A;  3SY2 A;  4APO A;  5AIJ A;  2YQ8 A;  1WG0 A;  3U4T A;  4U8V D;  3FUL A;  4FUL A;  5A23 A;  3ASO E;  5FQ8 A;  4UI9 K;  2WB2 A;  5CMY A;  4XI0 A;  1K8K G;  1OT8 A;  2Y1L E;  3NAW A;  5CED B;  5BT1 A;  2WXN A;  3DEP A;  1H0A A;  2XCC A;  4GTR A;  2WMO A;  3JYS A;  4JA7 A;  1U2V G;  4C9B B;  4Q69 A;  4F53 A;  3FUI A;  5KNH D;  5HI7 A;  5CBO A;  2CG2 A;  4JHK A;  3AU4 A;  3L22 A;  4IRU A;  3LCA A;  4DUI A;  4M3O A;  1N4S A;  3N71 A;  5C2Y A;  4GTQ A;  3ZYL A;  3E30 A;  3ZNG A;  4DX7 D;  3X2Q E;  3ZYQ A;  1FVF A;  3UM2 A;  3KD7 A;  2LUH A;  2M63 A;  4JB8 P;  3PZD A;  4L2L A;  4MKT A;  3NZU A;  5ARF A;  3SFY A;  5B1A E;  4I1M A;  5CBN A;  2XHE A;  3LKU A;  4A1S A;  5LP0 A;  3DPD A;  4UQZ A;  4YDW A;  4EPZ A;  4JZY A;  3RU0 A;  2OEW A;  4Q96 A;  1TNB A;  3QAQ A;  4V3I A;  4U07 A;  3AG4 E;  2CHW A;  4G23 A;  3FH7 A;  2R5S A;  2BKK B;  2FO7 A;  4HOR A;  2WVI A;  4BT8 A;  1Q2Z A;  1HG5 A;  3LY8 A;  3JXJ A;  1NL4 A;  2OVB A;  3SBS A;  4I1A A;  4FHJ A;  1TR4 A;  5LCW C;  4UI9 C;  4WUY A;  1NA3 A;  5G05 C;  2LXL A;  1MJ0 A;  3RK6 A;  4JVS A;  4GML A;  1QQE A;  2YHC A;  4AM9 A;  3MEK A;  1OWN A;  4N2S A;  4AY5 A;  1DCQ A;  3AS8 A;  2VQ2 A;  3JQ0 A;  3QJZ A;  4AY6 A;  2ZU6 B;  2WXG A;  1YMP A;  2KAT A;  4DK5 A;  1OWM A;  3Q79 A;  2HE0 A;  3BUA A;  1Z5S C;  3RO3 A;  4NRH B;  5FJY A;  1A5E A;  2XQ0 A;  2EIJ E;  3C3Q A;  4DX6 D;  3E33 A;  3QC1 A;  4HRL A;  2AXU A;  4DLO A;  4GTV A;  4LNG A;  3LVQ E;  3JQ1 A;  3UM0 A;  2DIW A;  5D0O D;  3BQO A;  4BSX A;  1JWF A;  4CDN A;  3B7R L;  4JXT A;  4UWG A;  5IY5 E;  4I6G A;  2H6F A;  4DLQ A;  2JLB A;  4NUR A;  1UG3 A;  3ZXP A;  3HXF A;  4KYO B;  4B93 B;  1DC2 A;  3MCX A;  3ULE G;  2OEV A;  3E34 A;  3I4G A;  3ESK A;  4CYM D;  2CG3 A;  3BG0 B;  3K9I A;  5KCM A;  1X5B A;  2P9P G;  1TNY A;  4HOU A;  3RSE G;  3QDN A;  4BTB A;  3I4R B;  3FU0 A;  4FJY A;  3RAU A;  1HF8 A;  1FT2 A;  3AJI A;  4CDR A;  4JW1 A;  3SQV A;  1SA5 A;  5C1D A;  2AXZ A;  1ZB1 A;  2EIN E;  5CMW A;  2HR2 A;  2BKG A;  4F1S A;  3CVN A;  4WWO A;  1MYO A;  1S64 A;  3MX3 A;  4Q94 A;  3LVR E;  3D9L A;  1Y6I A;  4J6I A;  2PZI A;  5BV1 A;  1H19 A;  3PH0 C;  4GA1 A;  3ZHE B;  2KZT A;  3L08 A;  4DI3 A;  4ACL A;  2P9S G;  3Q49 B;  2Y0B G;  1UJJ A;  2J08 A;  3S7B A;  5JJ6 A;  1H2V C;  4BX9 A;  3Q73 A;  1H6P A;  4I6E A;  2EQX A;  1OCO E;  2ETB A;  3UIO C;  3ASN E;  5A6C A;  4YDY A;  2RG8 A;  3OXG A;  3EJN A;  2E0I A;  4FHK A;  3SNX A;  5G55 A;  3AU5 A;  3CK7 A;  2VGE A;  3R7R A;  3CKC A;  4WWN A;  5AJL A;  2PM6 A;  2DYS E;  4L9P A;  3T9K A;  4GMJ A;  3TWV A;  4DPR A;  1KT1 A;  4IUL A;  3NOG D;  3FH5 A;  1N95 A;  5FIO A;  4WAF A;  3SFX A;  4XKB A;  1OCR E;  3CVQ A;  1SZ9 A;  2IJG X;  2VSY A;  4RG6 A;  3ZYM A;  3L13 A;  2WXP A;  3ZEF A;  3ZYK A;  4ABN A;  1ZBP A;  5FIN A;  2EIK E;  3S7D A;  3FH8 A;  2KC7 A;  5A7D B;  4B89 A;  5B3S E;  2J8S D;  4FU3 A;  3HIZ A;  4GMR A;  3PZ3 A;  4BX8 A;  4MBG A;  3CVX A;  1EF1 C;  3NOC D;  5FT9 A;  3D3M A;  3UTM A;  4Y6C A;  2CHX A;  3KSQ A;  4YVQ C;  2HO1 A;  4AP2 A;  3PNL B;  5CRU A;  1E7V A;  2VGX A;  3APD A;  1TEZ A;  3MYV A;  1E8Z A;  2VSO E;  5EN5 D;  3E32 A;  4EZJ A;  3AS5 A;  3HVE A;  4F1P A;  3AG3 E;  4I9E A;  1TNO A;  3CGH A;  4GZ5 A;  5ENR D;  3JCK C;  1H6K A;  1N4Q A;  1D8D A;  4N3C A;  1NFI E;  3CVW A;  1P5Q A;  4KMO A;  2GRN B;  5FTP A;  3IKO B;  3EHN A;  1FPP A;  3NZS A;  4FC8 A;  2KBX A;  2BUG A;  1O1R A;  3TJP A;  1HE8 A;  3Q9N C;  2Y4U A;  1KZP A;  4EBA G;  4E85 A;  5CCL A;  4U96 D;  4FP7 A;  3RKV A;  4H7X A;  2DZO A;  2Y4T A;  3CVP A;  3F6Q A;  4HOQ A;  1H2T C;  1N0Q A;  3FDH A;  3SI5 A;  4QQI A;  4LNU D;  4OVU A;  5FWQ A;  4F3V A;  4AJW A;  5G04 J;  1MX2 A;  3B95 A;  3PUK A;  4B94 A;  3D9J A;  3NBN B;  4JC8 A;  2QFC A;  3FHE A;  2QZA A;  2P9K G;  3DST A;  2WQH A;  4L2Y A;  4HQD A;  4BTA A;  3LPZ A;  3RRU A;  4HBD A;  4O1P A;  4PS8 A;  5BXO A;  5KWD A;  1XNF A;  4GTO A;  1B89 A;  3CQC B;  3MA5 A;  3SGH A;  3D9K A;  4CEM A;  4AOF A;  2XS8 A;  3D9I A;  3BU8 A;  2WMN A;  5FQ4 A;  5DIZ A;  3DSS A;  5KJM A;  2WXM A;  2XPI A;  1AWC B;  2PL2 A;  5FZR A;  1BPO A;  4LG6 A;  4AIF A;  4ATZ D;  4J8S A;  4JHR A;  1IYG A;  3Q4A B;  2WQ7 A;  4G2V A;  3TG5 A;  4AXH A;  3FTU A;  1IQR A;  1O1S A;  5ENP D;  4OAV B;  3CHO A;  1HG2 A;  2AXV A;  5ANR A;  4ILG A;  2R02 A;  5ENS D;  4N3A A;  2DZN A;  4ZHB A;  4IN3 B;  4RSY A;  5BXU A;  3ASD A;  4AEZ C;  3QWW A;  2AVP A;  3UKR G;  4GU5 A;  4G8L A;  2L6J A;  4FLH A;  3NB2 A;  3CK9 A;  1OCZ E;  3WXX A;  3EUV A;  2LAH A;  3OXL A;  1S63 A;  4QFV A;  1N54 A;  4AVX A;  3V30 A;  2C0L A;  4G1T A;  4FLB A;  2YIN A;  3CHP A;  3B7S A;  3GW4 A;  2I1K A;  1SA4 A;  1UN8 A;  5LFA A;  5AQB A;  2AWI A;  2DVW A;  3P2B A;  4BER A;  3FUD A;  3S7F A;  3MGB A;  4U0S A;  5J90 A;  1G3N B;  3ZIM A;  3ASH A;  1PY1 A;  3C5R A;  3JUE A;  3CIA A;  5FQ6 A;  1Z3X A;  2FUL A;  1BI7 B;  3MKQ B;  4HS2 A;  4CZ2 D;  1SQM A;  2MHK A;  2NSZ A;  1MZC A;  5BV0 A;  1DCE A;  1LF8 A;  5J08 A;  1JUQ A;  3AG2 E;  2YNQ A;  3DPY A;  1HFA A;  4A3V A;  5ENN A;  3ZFW A;  5ITZ F;  2X6K A;  4JD2 G;  5LX8 A;  3KEA A;  4CT0 A;  2GRL A;  3FU5 A;  4DX1 A;  3ZRH A;  4CGV A;  3SF4 A;  5CER B;  1NA0 A;  4EZK A;  3RIB A;  2AJA A;  2I1J A;  2I6H A;  2A4Z A;  5KBA A;  1XGW A;  2XEE A;  3KS2 A;  4Y6W A;  4GYW A;  3J5Q B;  2XGO A;  5D2M C;  3SHF A;  3ML8 A;  1BI8 B;  1JCQ A;  4XX5 A;  2CFU A;  2X6I A;  1V55 E;  4LUN U;  1NP7 A;  4TRQ A;  1SZA A;  5AAO A;  4K03 A;  2UY1 A;  1OWO A;  3DWL G;  1N9A A;  5EID A;  3ZU7 B;  3CHS A;  5KJK A;  3ABM E;  2LO6 A;  4L1B A;  2L6B A;  3PRZ A;  1LD7 A;  2MOW A;  4W9R A;  1X81 A;  3EIQ C;  4PUC A;  2OCC E;  1TYQ G;  2BF0 X;  1Z6T A;  3HRA A;  3SBT B;  4PS7 A;  4DRX E;  3HXC A;  4DJA A;  4WNG A;  2FF4 A;  3UIN C;  4HFG A;  3PEV B;  4J7W A;  4GZC A;  4DX2 A;  1UOH A;  3ASG A;  3D9H A;  5T3R A;  3D9N A;  4GTT A;  4XEI G;  4LCT A;  4CGW A;  4WNF A;  4YVO A;  3HXD A;  4LSZ E;  4NQ0 A;  4ANX A;  3U66 A;  3QOU A;  2XZD G;  4JA9 A;  3JXI A;  1OXJ A;  3L54 A;  3LY7 A;  5CEC B;  3PRE A;  5JA4 D;  4GTM A;  3EIJ A;  1DNP A;  2B0O E;  2L0T B;  3SFZ A;  1OWL A;  2WXF A;  4J0U A;  4U7E B;  2X6F A;  3PS6 A;  3RJV A;  2F0Y A;  4ZFH A;  1S70 B;  3T5V A;  2VTB A;  4APF A;  2GRR B;  4EBA A;  3UI2 A;  2XRY A;  3FEX A;  3BG1 B;  4I43 A;  3DBS A;  2GGF A;  3DXM G;  4HVB A;  3FWV A;  1HS6 A;  4RG9 A;  5LOZ A;  3DSX A;  3CVV A;  1TNU A;  4K5B A;  3ISM C;  4G25 A;  4R7L A;  1YCS B;  1N52 A;  2RFA A;  4KVO A;  3L9T A;  1K1B A;  2RD0 A;  1UJK A;  2L9B A;  4KXK B;  3LYA A;  2XZT G;  1IQU A;  3EU5 A;  3KAE A;  4MRU A;  2VGY A;  4CRW A;  4BFR A;  1JCR A;  4GZ6 A;  4BEP A;  4U0U A;  3IV0 A;  2WXH A;  4BY6 A;  3R9A B;  2DWZ A;  3VLF A;  2GRQ B;  4U63 A;  3P1U A;  1KPS B;  2P58 C;  1E96 B;  2AW6 A;  3ZPJ A;  3FUK A;  4AV7 A;  3UM1 A;  3UQ3 A;  2F37 A;  1HZ4 A;  2R59 A;  2Y69 E;  1QZ2 A;  3EHM A;  2RFM A;  4HB5 A;  3ZVV A;  5EX0 A;  2LSU A;  3FUN A;  3Q47 B;  4LEU A;  2BTD A;  2QY7 A;  3TWS A;  2IQC A;  3PE4 A;  5DBK A;  4OVV A;  3C72 A;  4PS3 A;  4JEU A;  4XI9 A;  3VTY A;  2R05 A;  1JCS A;  3OTN A;  5JJT A;  3D9M A;  1E8Y A;  3ULQ A;  4YDO A;  4G24 A;  2P9L G;  5FZS A;  3V2X A;  5EDS A;  1RW2 A;  3AAA C;  1TJC A;  1DVP A;  2ZIS A;  3Q75 A;  1D8E A;  1KT0 A;  3J5P A;  1H6O A;  4OYS A;  2L0I A;  3ABL E;  2I9C A;  4D10 C;  1HU3 A;  3G2U A;  3FEY A;  2WXO A;  4HLE A;  2WQ6 A;  3PEU B;  3UKU G;  2FEZ A;  3UM3 A;  4IYP A;  5HQ8 A;  3IEG A;  5T4Y A;  1E8W A;  3CQG B;  1AP7 A;  3HHM A;  2XS1 A;  5LCW J;  4WND A;  4UI9 J;  3W9G A;  2EIM E;  5G05 J;  4Z68 A;  5KJN A;  3ZXS A;  3TWX A;  3L82 A;  3CR3 A;  3CK8 A;  4GB9 A;  3GZ1 A;  1JWG A;  4L7T A;  1TN7 A;  1D9S A;  4G26 A;  1UN9 A;  3LDZ A;  1INZ A;  4UQY A;  1E90 A;  4B8A A;  3HXB A;  2P9U G;  4B0Z A;  2DBA A;  2UY1 B;  1U3D A;  3LY9 A;  4TXP A;  4N5C A;  2WXJ A;  3LS8 A;  3QB2 A;  4TUU A;  2YHE A;  4P29 A;  5EIB E;  2J9Q A;  1ZU2 A;  5KJL A;  3FTX A;  4I2Z A;  5CCM A;  2CFZ A;  2UWJ G;  3MKR A;  4UQX A;  2XRZ A;  1HX8 A;  4GTP A;  3D9O A;  3U64 A;  3VLE A;  3EHQ A;  2IFU A;  3CHQ A;  4ANV A;  3QK0 A;  5E76 A;  4HNA D;  4ATG A;  4EZL A;  4A55 A;  1QBQ A;  5JHB A;  3TWQ A;  2JAB A;  3SO8 A;  2LXM A;  2NC9 A;  4I6J A;  3ZGQ A;  3T8M A;  4JHJ A;  4JPS A;  3RRM B;  4TXR A;  1TNZ A;  2WM9 A;  3O4Z A;  4ACK A;  3ABK E;  4C0M A;  2X6H A;  2XPY A;  5ANL A;  2KCV A;  3TXN A;  1RZ4 A;  3ZUV B;  3KSL A;  1N4P A;  3UXG A;  2WXI A;  5BW8 C;  3ENE A;  2XCB A;  3DSU A;  3ML9 A;  2VYI A;  1UW4 B;  1YYH A;  3IHY A;  4I17 A;  3TWW A;  1N11 A;  2VSX E;  4O60 A;  4UWL A;  3TWR A;  2OND A;  4PH4 B;  3WG7 E;  2VJ8 A;  4J8F A;  1TN6 A;  3GZ2 A;  3S7J A;  2QYU A;  2OOE A;  4CDM A;  1MX4 A;  3PVL A;  4F6R D;  3PDN A;  5H7P A;  2I2O A;  1Z3Y A;  3FUJ A;  1OUV A;  2KZT B;  4JEH A;  3PZ2 A;  4GCO A;  3QAR A;  1O5M A;  4PDX A;  3ZHE A;  3L16 A;  3FTV A;  3T8K A;  4BT9 A;  1IXV A;  3TGO A;  3FUH A;  3DXK G;  3C98 A;  5AJD A;  3D9P A;  4TV3 A;  2CHZ A;  3HDX A;  3TL5 A;  4HXI A;  3QWP A;  3U9W A;  1K1A A;  3DSV A;  2A5E A;  2LAI A;  2E2E A;  4HLL A;  1MQS A;  4N39 A;  3MV3 B;  2ETA A;  4MS6 A;  1IHB A;  4LNB A;  4C0E A;  3V2O A;  3UT8 A;  2V4H C;  3MJW A;  3E4B A;  4FAD A;  3RO2 A;  4N3B A;  1MX6 A;  4EQF A;  4FA6 A;  4J8D A;  2KM4 A;  1YA0 A;  4WNE A;  3GYZ A;  2C2L A;  1N0R A;  4NIK A;  5FZQ A;  2QYJ A;  3MV2 B;  3E37 A;  1KZO A;  1SVX A;  1L5J A;  3Q9U C;  3EHR A;  5BPP A;  3LEW A;  3Q5M A;  4GYO A;  3ULY A;  4M7C A;  3UT4 A;  3TWU A;  2HM8 A;  3IHV A;  3UIP C;  1OCC E;  2GRM A;  3W9F A;  3R9M A;  3UPV A;  4KBQ A;  5E75 A;  1O1T A;  3CEQ A;  2PNN A; 
#chains in the Genus database with same CATH homology
 5G2N A;  5FT9 A;  5T8I A;  3D3M A;  4G25 A;  4R7L A;  4U0Z A;  4Y6C A;  1N52 A;  2CHX A;  4KVO A;  2FI7 A;  4YVQ C;  3FTS A;  3UUX A;  3CVU A;  2RD0 A;  1UJK A;  2HO1 A;  1EDU A;  2L9B A;  4AP2 A;  1WY6 A;  3PNL B;  4KXK B;  2VGX B;  3LYA A;  4APO A;  1E7V A;  1IQU A;  5AIJ A;  2VGX A;  3APD A;  1TEZ A;  3KAE A;  2XPZ A;  1A17 A;  3MYV A;  1E8Z A;  2VSO E;  4FJZ A;  5AYW D;  2YQ8 A;  2VGY A;  4MRU A;  4BFR A;  4CRW A;  3HVE B;  4GZ6 A;  2MRI A;  4EZJ A;  4U0U A;  2A5U A;  2KCL A;  3FUL A;  4FUL A;  3AS5 A;  3HVE A;  5FQ8 A;  3U4T A;  3IV0 A;  5A23 A;  3AS4 A;  4UI9 K;  2WXH A;  2WB2 A;  4I9E A;  4GZ5 A;  3CGH A;  5CMY A;  4XI0 A;  1EYH A;  4BY6 A;  3JCK C;  1H6K A;  3R9A B;  3URZ A;  3VLF A;  4N3C A;  4U63 A;  3P1U A;  3CVW A;  1P5Q A;  2P58 C;  4KMO A;  1E96 B;  2AW6 A;  5FTP A;  3ZPJ A;  3FUK A;  3IKO B;  3EHN A;  3NZS A;  4FC8 A;  3LXU X;  4AV7 A;  2BUG A;  2XGM A;  1EPU A;  3UQ3 A;  5BT1 A;  3TJP A;  1HO8 A;  1HE8 A;  2WXN A;  1H0A A;  1HZ4 A;  2XCC A;  4UWH A;  2WMO A;  2Y4U A;  3JYS A;  2R59 A;  4JA7 A;  2X38 A;  2WPV A;  4EBA G;  4E85 A;  4C9B B;  5CCL A;  4FP7 A;  3RKV A;  4GYY A;  4H7X A;  1QZ2 A;  2Y4T A;  3EHM A;  3CVP A;  3ZVV A;  3I3N A;  4Q69 A;  4HOQ A;  5EX0 A;  3FUI A;  4F53 A;  2LSU A;  1H2T C;  3FUN A;  3IBE A;  2BTD A;  3Q47 B;  2J09 A;  4LEU A;  4RVB A;  5HI7 A;  3FDH A;  2CG2 A;  2QY7 A;  3FY4 A;  3SI5 A;  3APF A;  2IQC A;  4JHK A;  3PE4 A;  4OVU A;  5DBK A;  3AU4 A;  5FWQ A;  4F3V A;  4OVV A;  4AJW A;  3L22 A;  4PS3 A;  4IRU A;  5G04 J;  3LCA A;  5M72 A;  4M3O A;  4KZC A;  3UMV A;  2WXR A;  3PUK A;  3QWV A;  4JEU A;  4BWR A;  4XI9 A;  3N71 A;  5C2Y A;  1PC2 A;  3FU6 A;  2WXL A;  3VTY A;  4B94 A;  3FUE A;  3ZYL A;  3D9J A;  4JC8 A;  5LP0 A;  3OTN A;  2QFC A;  1VDY A;  3FHE A;  5JJT A;  3D9M A;  2WQH A;  2J4D A;  1PAQ A;  1E8Y A;  4L2Y A;  4XIF A;  3ULQ A;  3FP3 A;  3ZYQ A;  4G24 A;  1FVF A;  2WXK A;  5FZS A;  5G04 C;  4BTA A;  5EDS A;  3LPZ A;  3KD7 A;  3RRU A;  3L6A A;  4PS8 A;  2M63 A;  1TJC A;  1DVP A;  5EX3 A;  4E6H A;  4JL0 A;  1XNF A;  3PZD A;  1GW6 A;  4L2L A;  4MKT A;  3NZU A;  5ARF A;  4I1O B;  1B89 A;  3APC A;  3CQC B;  3MA5 A;  5JJ7 A;  2OV8 A;  4N2Q A;  1KT0 A;  3SGH A;  4OYS A;  2ION A;  3BEE A;  2L0I A;  3D9K A;  4I1M A;  2WXQ A;  4CEM A;  2OVF A;  4AOF A;  2XHE A;  3D9I A;  3UX4 A;  2I9C A;  2WMN A;  3LKU A;  4D10 C;  4A1S A;  1HU3 A;  3G2U A;  3DPD A;  2WXO A;  2XEV A;  3FEY A;  4UQZ A;  2V0P A;  5FQ4 A;  4EPZ A;  4HLE A;  2WQ6 A;  4JZY A;  3RU0 A;  5DIZ A;  3PEU B;  2FEZ A;  4IYP A;  5HQ8 A;  5KJM A;  3IEG A;  2WXM A;  5T4Y A;  1E8W A;  4NAC A;  3CQG B;  4Q96 A;  3QAQ A;  3G2W A;  4V3I A;  2XPI A;  4U07 A;  2PL2 A;  3FFL A;  3HHM A;  2FBN A;  1BPO A;  5FZR A;  2X6J A;  5LCW J;  4WND A;  4UI9 J;  2R17 C;  4DI4 A;  4K0R A;  4GA0 A;  2CHW A;  4G23 A;  3FH7 A;  2R5S A;  5G05 J;  4ILI A;  2V4L A;  1FCH A;  2FO7 A;  4HOR A;  2WVI A;  2PM7 A;  4AIF A;  4BT8 A;  1HG5 A;  3LY8 A;  3CHR A;  4J8S A;  4JHR A;  5KJN A;  1TJF A;  1IYG A;  2OVB A;  3ZXS A;  3SBS A;  3Q4A B;  4I1A A;  2WQ7 A;  2PQN A;  4FHJ A;  4G2V A;  4KZ0 A;  3TG5 A;  3CR3 A;  4AXH A;  3CK8 A;  3FTU A;  4GB9 A;  1IQR A;  3UT7 A;  5LCW C;  3GZ1 A;  4UI9 C;  4WUY A;  1JWG A;  2X3M A;  3CHO A;  4L7T A;  1HG2 A;  1NA3 A;  2AXV A;  5G05 C;  5EKQ D;  3RK6 A;  5ANR A;  1WAO 1;  4ILG A;  1MHQ A;  3OXF A;  4G26 A;  4JVS A;  4GML A;  1UN9 A;  3LDZ A;  4N3A A;  2Q7F A;  3PUJ A;  3CV0 A;  1INZ A;  4UQY A;  4IN3 B;  2YHC A;  1QQE A;  1E90 A;  4B8A A;  3FUF A;  4RSY A;  3ASD A;  2J49 A;  4B0Z A;  4LER A;  4AM9 A;  2DBA A;  2UY1 B;  1OWN A;  1U3D A;  3MEK A;  4N2S A;  3SD5 A;  3LY9 A;  4AY5 A;  4AEZ C;  3AS8 A;  2AVP A;  2VQ2 A;  3JQ0 A;  3QWW A;  1QNF A;  3QJZ A;  4AY6 A;  2ZU6 B;  4GU5 A;  3ZN3 A;  5CHE E;  4N5C A;  2WXJ A;  3FTY A;  3LS8 A;  2WXG A;  3QB2 A;  4TUU A;  2YHE A;  2L6J A;  2V5F A;  4P29 A;  4FLH A;  2KAT A;  3CK9 A;  4DK5 A;  1OWM A;  1HXI A;  2J9Q A;  3RO3 A;  1ZU2 A;  3WXX A;  2ILR A;  5KJL A;  4HOT A;  3FTX A;  4I2Z A;  5CCM A;  4URK A;  2PQR A;  3HYM B;  3ONL A;  2CFZ A;  2UWJ G;  4NRH B;  3MKR A;  2LAH A;  3OXL A;  4UQX A;  5FJY A;  3FU3 A;  2XRZ A;  1HX8 A;  4QFV A;  3EDT B;  1N54 A;  2XQ0 A;  3QNK A;  4AVX A;  3D9O A;  3U64 A;  2C0L A;  3VLE A;  2IFU A;  4G1T A;  3CHQ A;  4ANV A;  3GZS A;  4FLB A;  2YIN A;  3QK0 A;  4XKC A;  3FTZ A;  3CHP A;  3B7S A;  3GW4 A;  2I1K A;  3CVY A;  4XZ4 A;  1UN8 A;  5LFA A;  3QC1 A;  2V8S E;  5BNW A;  5E76 A;  2AWI A;  3I5P A;  2AXU A;  4DLO A;  4ATG A;  4EZL A;  3P2B A;  4A55 A;  5JHB A;  3LVQ E;  3FUD A;  2DIW A;  3JQ1 A;  5D0O D;  4UWK A;  4BSX A;  3S7F A;  3VLD A;  1JWF A;  2J07 A;  2NC9 A;  1ELK A;  4I6J A;  3ZGQ A;  3MGB A;  4U0S A;  2GW1 A;  3T8M A;  5J90 A;  4JHJ A;  3B7R L;  4JPS A;  4CDN A;  3ZIM A;  4JXT A;  4UWG A;  3RRM B;  3ASH A;  1PY1 A;  4I6G A;  3CIA A;  3R7Q A;  5FQ6 A;  1Z3X A;  2WM9 A;  3O4Z A;  4ACK A;  3JUI A;  2FUL A;  4C0M A;  2X6H A;  4DLQ A;  2XPY A;  2JLB A;  3CSF A;  3MKQ B;  4NUR A;  3NF1 A;  5ANL A;  1UG3 A;  3MKQ A;  2KCV A;  4HS2 A;  4KT6 B;  3TXN A;  1SQM A;  1HH8 A;  2MHK A;  3CLJ A;  2NSZ A;  4KYO B;  3MCX A;  4A3T A;  5BV0 A;  1W3B A;  1LF8 A;  5J08 A;  3I4G A;  1JUQ A;  2WXI A;  5BW8 C;  5ARG A;  3ENE A;  3ESK A;  2YNQ A;  2XCB A;  2CG3 A;  1HFA A;  3BG0 B;  3K9I A;  3ML9 A;  5KCM A;  4A3V A;  1X5B A;  2VYI A;  5ENN A;  3ZFW A;  4HOU A;  2C0M A;  1UW4 B;  2X6K A;  3IHY A;  1ELW A;  3FU0 A;  3I4R B;  3NQP A;  3QDN A;  4I17 A;  4BTB A;  4MLP A;  5LX8 A;  1ELR A;  2VSX E;  4FJY A;  1JPL A;  4CT0 A;  5FQ7 A;  4G11 A;  3B7U X;  4UWL A;  2GRL A;  3TXM A;  1HF8 A;  3FU5 A;  4O6F A;  3PNT B;  3ZRH A;  4CGV A;  3SF4 A;  4CDR A;  2OND A;  3G2V A;  4JW1 A;  1NA0 A;  4PH4 B;  4EZK A;  3TG4 A;  2KCK A;  3RIB A;  5C1D A;  2VJ8 A;  2I1J A;  2AXZ A;  4J8F A;  1OWP A;  5JHA A;  2I6H A;  3GZ2 A;  3RRN B;  5CMW A;  2HR2 A;  1NZN A;  2A4Z A;  2NXP A;  1XGW A;  3QKY A;  4F1S A;  3S7J A;  3CVN A;  4WWO A;  3FTW A;  3KS2 A;  2IU1 A;  3MX3 A;  4Y6W A;  4GYW A;  4Q94 A;  2OOE A;  2XGO A;  4CDM A;  3PVL A;  4YND A;  3PDN A;  3LVR E;  3SHF A;  3D9L A;  4H7Y A;  2I2O A;  1Z3Y A;  3FUJ A;  1Y6I A;  2Y3A A;  1OUV A;  3ML8 A;  4J6I A;  3S2A A;  3CKB A;  4UWF A;  2CFU A;  2PZI A;  4XX5 A;  4ANW A;  5BV1 A;  1H19 A;  2X6I A;  2KZT B;  3PH0 C;  4JEH A;  4LUN U;  3G2T A;  4GA1 A;  3QAR A;  2KZT A;  4GCO A;  1NP7 A;  3L08 A;  4TRQ A;  1SZA A;  3ZHE B;  4PDX A;  3ZHE A;  5BUZ A;  3L16 A;  4A1G A;  4ILH B;  4DI3 A;  4ACL A;  3FTV A;  4K03 A;  2UY1 A;  1OWO A;  3Q49 B;  3G2S A;  3T5X A;  1UJJ A;  2J08 A;  3TAX A;  4BT9 A;  3CHS A;  3TGO A;  3FUH A;  3B7T A;  3S7B A;  3MZL B;  3C98 A;  5AJD A;  3D9P A;  5KJK A;  2LO6 A;  3ESL A;  4L1B A;  5JJ6 A;  4TV3 A;  2CHZ A;  3HDX A;  4ME2 A;  4L23 A;  3TL5 A;  1H2V C;  3PRZ A;  4BX9 A;  4HXI A;  2MOW A;  3QWP A;  4I6E A;  4CCA A;  4W9R A;  3U9W A;  2EQX A;  3FUM A;  1Y8M A;  5A6C A;  4I9C A;  3EIQ C;  3CST A;  4EEC A;  4PUC A;  2IOS A;  2RG8 A;  3OXG A;  3EJN A;  4XE0 A;  1E8X A;  2E0I A;  3ONK A;  4FHK A;  4KVM A;  2LAI A;  1WM5 A;  3SNX A;  2BF0 X;  2IF4 A;  3ASF A;  3LJ3 A;  1Z6T A;  2E2E A;  3O48 A;  1MQS A;  5G55 A;  3SBT B;  3AU5 A;  3CK7 A;  4GZ3 A;  4PS7 A;  4DJA A;  2J4B A;  2FF4 A;  4N39 A;  4J8E A;  4HFG A;  3PEV B;  3MV3 B;  4I2W A;  4MS6 A;  4GZC A;  4WNG A;  3VTX A;  1U3C A;  3R7R A;  4B8C B;  3CHM A;  4C0E A;  4GPK A;  3ASG A;  3CKC A;  4F7A A;  3CVL A;  4WWN A;  1KLX A;  5T3R A;  3D9N A;  2HYZ A;  3L17 A;  4U04 A;  5D0Q D;  5AJL A;  4CGW A;  4LCT A;  3UT8 A;  2PM6 A;  4GA2 A;  4WNF A;  4GZD A;  3MJW A;  3E4B A;  4U8H A;  4YVO A;  4FAD A;  4GMJ A;  4DPR A;  4NQ0 A;  1KT1 A;  4IUL A;  4ANX A;  5AEN A;  3FH5 A;  1E7U A;  3KEZ A;  4HOS A;  3U66 A;  3QOU A;  3RO2 A;  4JA9 A;  4LRZ A;  4N3B A;  4EQF A;  3U3W A;  4WAF A;  4GAA A;  4FA6 A;  3L54 A;  3LY7 A;  3PRE A;  4J8D A;  3OAW A;  2KM4 A;  4XKB A;  1YA0 A;  3CVQ A;  3GYZ A;  4WNE A;  2C2L A;  1SZ9 A;  2LNI A;  3EIJ A;  1DNP A;  2L0T B;  3SFZ A;  2IJG X;  2VSY A;  4RG6 A;  1OWL A;  5FZQ A;  2WXF A;  3L13 A;  3ZYM A;  2WXP A;  4J0U A;  2X6F A;  3MV2 B;  3ZEF A;  3PS6 A;  3RJV A;  3ZYK A;  1IHG A;  3B13 A;  4ABN A;  1ZBP A;  2JEK A;  4ANU A;  2VTB B;  1S0P A;  1L5J A;  3S7D A;  3FH8 A;  2KC7 A;  5BPP A;  2VSN A;  3T5V A;  1FVH A;  2VTB A;  3LEW A;  2XGS A;  3Q5M A;  4GYO A;  4APF A;  5A7D B;  4EBA A;  4B89 A;  2XRY A;  3FEX A;  3BG1 B;  2LSV A;  4FU3 A;  3UT4 A;  4CT4 A;  4I43 A;  2HM8 A;  3HIZ A;  3DBS A;  2GGF A;  3IHV A;  3Q15 A;  4HVB A;  3FWV A;  1HS6 A;  4RG9 A;  5LOZ A;  3SZ7 A;  3ZW3 A;  2IOL A;  2GRM A;  1H2U A;  4GCN A;  3UPV A;  4BX8 A;  3CVV A;  4WWP A;  2DCP A;  3PE3 A;  3CVX A;  4KBQ A;  1EF1 C;  5E75 A;  3CEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...