1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
3ONKA 1H0AA 2MOWA 4NACA 2LO6A 3D9KA 1ELKA 3D9OA 3D9NA 4JXTA 1HFAA 3D9LA 3RRUA 1EYHA 1LF8A 3G2SA 4GZDA 1XGWA 1VDYA 1X5BA 1EDUA 4GZCA 4Q96A 5J08A 1JWGA 2KM4A 3G2VA 2L0TB 3G2WA 3G2UA 1JWFA 3D9PA 1SZAA 3ZYKA 4Q94A 1DVPA 1JUQA 5LOZA 1HG2A 5CMYA 2V8SE 3ZYQA 3ONLA 1UJJA 2L0IA 3D9MA 2QY7A 3CLJA 1INZA 4HFGA 1HG5A 1UJKA 1MHQA 1HF8A 1PY1A 2DIWA 4AVXA 3G2TA 4FU3A 3D9JA 2BF0X 3ZYLA 3LDZA 3ZYMA 2DCPA 5CMWA 1JPLA 4FLBA 5LP0A 3D9IA 1SZ9A 1HX8A
chains in the Genus database with same CATH superfamily
3ZRHA 5JDFA 3RRWA 2ETAA 4ISSA 4ILAA 2KCVA 4DR2T 3UQ7A 4E85A 4UXNB 2IOLA 5FYMA 4DV0T 1S63A 3FZLB 2ZXWE 4QH4A 2X6FA 1E8ZA 4BERA 4EV6A 4PK6A 4YDYA 4U8VD 4LF4T 2YN6A 4GU5A 2NP9A 4C0MA 4DX6D 2WXQA 1U5PA 4EZKA 3IHRA 3ABME 3PEUB 3PJAA 3AE1A 4JBWF 2IEJA 3L08A 3E08A 5JDMA 3ONKA 2V1DB 3B7BA 2UXNB 2IFUA 3OXGA 4BSZB 5EIBE 4KBMB 5KJMA 2JEKA 2B1EA 2KZ7B 2I1KA 2LSJA 4AKIA 2HE0A 3I9WA 3DSXA 4GPMA 3ZIMA 1MX6A 1JWFA 3DWLG 5KX5E 2VVSA 2QFCA 4HWHA 1XNQT 2UXXB 2V8SE 2OV9A 2UU9T 2L0IA 1IHGA 5AQGB 1FPPA 5JDGA 2PM7A 3SBTB 5AQMB 3EDVA 5F5WA 3CHQA 3SHFA 3UTMA 4WAFA 1Y8MA 4GZ5A 4EBAA 1S70B 3EDTB 5JJTA 3SFEA 2IJGX 5KJKA 2V7LA 3BQIA 4UI9C 2XQYA 4AQYT 2CG2A 4TXPA 2BKOA 4KMCA 1B89A 2A2FX 4HOSA 5EZYE 1OWPA 4IL9A 3RIUA 5G04J 2FJAA 3RRUA 5AQJB 4HOTA 5FIOA 1W3BA 5LJMA 4LMLA 3PS6A 4C90A 1HX1B 1WDYA 5CGMA 2R6GF 1MNEA 1B7TA 3C51A 3B7TA 3O4XE 4H63H 4UQYA 4YDEA 1O5MA 3HI2A 1LD7A 4JVSA 2LSVA 3C3RA 3AXJB 2V5QC 4DPRA 1E7UA 4DK5A 5JDHA 2EIJE 3ESKA 4ANUA 3VLFA 3PV0F 2QC9A 3VHLA 1N95A 4PJNA 4ZS3A 3MV3B 4BY6A 3RIAA 2V7JA 1N4PA 2HN1A 2VSXE 4OYJA 3UXGA 1N54A 2MBGA 3I3NA 3AE7A 5G55A 1FJGT 3ZSSA 1TYQG 3DPDA 5CERB 4WUYA 3ZKRA 3CVUA 3L54A 3UIOC 1WFDA 3P7IA 2CXLA 4EBAG 2IIUA 3AVRA 4A56A 2EHOC 1ELKA 3FFLA 5BPPA 4JI4T 4I43B 3MYVA 4A1SA 4YLHA 5HXHA 2YNQA 2D2SA 4L7TA 4K0RA 3AU4A 4K5BA 3RYHE 4UI9K 4PUCA 3SO8A 5FTPA 4QQIA 2NXPA 1W0BA 4WNKA 5L2LA 3AE5A 3ZYLA 4FA6A 2K5BB 3QNKA 3FU5A 3IKOB 2LSUA 3EAMA 1WR0A 4FLHA 5BMVE 3Q7FA 2DYRE 5HS0A 3ZVVA 1M7KA 1WCRA 3CVYA 4ZXLA 5G04C 3MJXA 3TWWA 4HXIA 3ETUA 1N4RA 3FHNA 5E0OA 4WWPA 2E9XD 1ZB1A 2DWGA 3A8YC 4M1PA 3OYXA 4ILUA 1BLXB 3CK6A 4U96D 3ETVA 3D9IA 5HCJA 1T8BA 3T8MA 2PQRA 4H9QC 3LCAA 4UUCA 2YU2A 5DABA 3RK6A 3VKGA 2R02A 4G8LA 2VB6A 3GA8A 1XMQT 2KCKA 2CWOA 4KI0F 3HA4A 2V26A 5D2MC 2BBJA 5KCMA 2JQHA 3PU3A 1Z6TA 3FUEA 5JVDE 4HRNA 2JQKA 2HHHT 4EZLA 1Y6IA 3ONJA 2B76A 2YHEA 4HQDA 1L0VA 1I94T 3RH3A 1WY6A 4HNAD 2ZU6B 2LM2A 1D8EA 4ZFHA 4PS3A 3UUMA 2XQ9A 4NXMT 3AEDA 4B3RT 3O1IA 3VKHA 3ABKE 4KZ0A 2KWIB 2XS1A 4RLYA 4O60A 1OCCE 3L9TA 5JMND 5AQFB 5L3CB 4WBNE 3DXMG 3MA9A 3RYFE 3D3MA 5L3BB 3N9QA 2GRPB 3DRAA 3PZ1A 4UWKA 3ZJ1A 2JMKA 2KZTA 3CQGB 4DLQA 5AQIB 3SFXA 4DR6T 1MX2A 2X68A 4Y6WA 4DV7T 2WY2A 1HH8A 3PTRB 2A4ZA 3L09A 4EHMA 5AQUB 3AAAB 3PUZF 3D9PA 1DNPA 3SD5A 1YQ3A 2YEVC 3N2OA 3DSVA 4ANWA 3H3AA 3VU7H 4IE4A 2AXDS 3RPUA 4ERRA 2I9CA 3SBSA 4JA9A 2WP9A 5GONE 4HRMB 5KJNA 4V3IA 4DUYT 1S64A 2D9DA 2XAFB 3CKCA 3KFWX 3HDXA 4LG6A 3ZT7A 5LNKA 4NACA 3FUKA 4JXTA 3UKRG 2UXBT 5FJYA 3E30A 2HM8A 3G2SA 5C3JA 4Z68A 5EK3A 1KLXA 4LF6T 1UX4A 3KVBA 2V7KA 4DR7T 5JH7E 1UUSA 4YY3T 1U3DA 4WNGA 3D9HA 3SWHA 4JV5T 4YJ3E 4NQ0A 4DI4A 1CHUA 3FTUA 4JW1A 2RG8A 2J07A 2A3DA 3VRAA 2N2NA 2BDEA 3BQLA 4AKLA 3DP7A 3N2GE 4K03A 3PUGA 3LDQB 2IUBA 3T8KA 2W0GA 3IF8B 3TWXA 5DQWA 5H6QB 4BWRA 2M67A 2J47A 3SRZA 1SVXA 3PZ4A 4IT4A 3AS4A 4MBGA 2JQQA 1PY1A 1O1SA 3B95A 3QNUA 3ZMSB 2CPTA 1TJFA 4GYOA 4U04A 2BG9B 4H9PC 4GMRA 2LNIA 4I9EA 5EN5D 2FJEA 2KT9A 3NAWA 4K5CA 5CRUA 5ABHA 4H7XA 4L2YA 2CRBA 3PE3A 1LVKA 5AQBA 4HORA 1ZHCA 1T72A 5ARFA 1H2VC 3B7UX 1ZP0A 2J4BA 2PTFA 4MLKA 2WWVA 3VLEA 4AQFC 2F37A 4N5QA 4WWOA 1YKHB 5FVKA 3AAEB 3WAJA 1H6OA 5LFAA 4ZI3D 3U3IA 4FHKA 3ZNGA 5D66A 3JXJA 3FEXA 2WMNA 4CGWA 1IHBA 5A23A 1TNBA 3L22A 5FVLA 4GOUA 2CM0A 3ZFWA 1OXZA 5HEHA 5JDNA 3DSUA 1UK5A 3I0OA 4U7IA 5AQNB 2ONDA 2L6BA 2J09A 4UWFA 3FU0A 4P0BA 1E90A 3UT8A 4KYOB 2XQ3A 3IA3A 3ZLIA 1E8XA 5ENOD 2JRKA 1WAO1 3MKQA 1XMOT 4U07A 3E32A 3EUVA 5BW8C 2AE9A 2P9NG 2KINB 1YKEB 4LCTA 1MIWA 2XASB 3QOUA 5AQ9A 4URKA 2WDQA 2X9XA 4G2AA 4B3TT 2DLRA 2E2EA 4DRXE 4PFPA 2UUAT 2V6XA 2ZGDA 1LVFA 2NC9A 5JA4D 4TXRA 2MRIA 3K8PC 4TNVA 2IO3C 2BG9A 4U3CA 3F57A 3B13A 3W9FA 4HOQA 4XKBA 2B6CA 2VL0A 4EZ4A 4GMJA 5JJ7A 3ZCJA 2MHKA 3EIQC 2BTDA 5KNHD 2YK0A 1WRDA 3CX8B 3L6AA 3ZYMA 2WZIA 3AEAA 3FBZA 1MQSA 4AXPA 2V7MA 3E33A 1KT0A 2VURA 1UW4B 3ZSTA 2XAQB 4CN4A 1K3ZD 2CHNA 3HXEA 3Q4AB 4HTEA 3CIRA 4G25A 4KZCA 5EX0A 1H6KA 3T1YT 2C5JA 3ISMC 2R2LA 4TUMA 4FU3A 3Q73A 1WLXA 2DL1A 2WZHA 3WXXA 3UTKA 3CVLA 5LX8A 4HWIB 5BUZA 1KK7A 2Q9QB 5CA1E 2E5LT 4FJZA 4GA1A 4HFHA 4YHJA 3OJAA 3N2KE 2Y48B 4LF8T 1BR2A 5IHYA 4YVQC 5JR9A 3MXZA 1X79A 1OEDE 4WNDA 3JCFA 1GQEA 2W62A 3TG5A 4WZXA 5J2UE 3HXDA 4F8HA 3PZ2A 4E7ZA 4HRLA 5TAOA 4J8SA 4LEUA 4ABNA 3HVEB 4LMJA 4TV9E 1UCUA 3TWTA 2V5FA 3CKBA 2X38A 5G05C 4OYKA 4UF0A 3ABLE 3TKLB 4N3AA 3U9WA 2K24A 3AA7B 3FY4A 3FTZA 1OCOE 2XY8B 3E22E 2KXPC 3AE6A 3T9KA 2OVFA 2V6YA 1KZOA 1YW0A 4M7CA 1MMDA 3ZMUB 4MBQA 4OYSA 2FO1E 1D1BA 2NW9A 1YXRA 2LO6A 4J0UA 2E9XB 4LF5T 2HYZA 4J8DA 5EK2A 5L3FB 5LHGB 3K1SA 1H7CA 1ZOYA 4I1AA 2L0TB 2Q7FA 4KBQA 4O2AE 4Y6CA 4DV1T 5A6CA 1JUQA 4DV3T 2MTQA 4OFZA 4X65T 3FUJA 3RU0A 2Q9QA 1UJJA 2P9PG 3PUWF 3P1UA 5JREA 1KFYA 2XEEA 5HEUA 4IULA 4AISA 1OEDA 4TN7B 3N9NA 1N34T 3GZ1A 4HI9A 3FH5A 4RQIA 4PH4B 3L16A 3RRCA 5HKPA 2IOSA 2XRZA 3EABA 5ABFB 4CXXA 1QSDA 1NFIE 1IJ6A 5B1AE 2PJQA 5BT1A 4D10C 5LXTE 3KAEA 4NIQA 4F6RD 1N0QA 3ZHEA 3X1DA 4GCOA 3SOLA 1LTXA 3TL5A 1OCZE 3PUJA 4JI1T 4IE7A 3RF1A 2XQ4A 2BS3A 3M65A 1H0AA 2QA7A 4TXQA 5T4YA 4U33A 3ULYA 3V5UA 1ZEEA 2E0IA 3UUXB 1E7VA 2VL8A 2CEAA 2X51A 3FH8A 4BTAA 1V54E 5DQVA 4OVUA 4DLOA 2CHOA 5CEAA 3CQCB 1HG2A 4FJOA 4JHRA 3FH7A 5L3GB 4UI9J 1H2UA 2XQ8A 2DBAA 2WB5A 3C64A 3QWPA 1S35A 3WAKA 4N39A 3QAQA 4U2ZA 2OA5A 3UUNA 1TR4A 3O1HA 2VYIA 3KVAA 4DV5T 2LKHA 2VKHA 3QWWA 2GK9A 3AEEA 4ZS2A 2IMLA 3R7QA 5FXVA 5B3SE 4JYAT 3G2VA 4ZI2C 4J2CA 4ATGA 3QC9A 2Y4TA 1XNRT 2XAGB 1SHZC 2UXDT 5ABFA 2YDRA 3T8OA 5FNVE 3QK6A 4FADA 3G2TA 3SGHA 3NBXX 5LG3A 2C2LA 3RLFF 4NXNT 3ZCIA 2I0MA 3PDNA 3MJWA 4J8EA 3Q47B 5A7DB 1NP7A 4BESA 1OUVA 3O48A 1G8XA 2R03A 5IY5E 3ANWB 3O1JA 1N11A 3P2BA 3UU8A 4JC8A 3AE2A 3ABVA 4IDPA 3SQVA 4GZDA 3CR3A 2VASA 3PREA 4EEBA 3PU8A 5C8YE 3PUSA 4YTNA 4PK4A 4IREA 5L3EB 4JI3T 4CYMD 2XTLA 5FXXA 2LOSA 3CHPA 1UGOA 1G73A 4LNUD 5JRCA 3UUXA 1KF6A 4IE6A 4ME2A 5FXWA 2X9WA 4HFEA 3L3PA 4DBQA 2UY1B 2L3LA 2I59A 3BQKA 3MCXA 3TWRA 4HWDA 5HEOA 3Q5XA 3APDA 3J9X1 1TNOA 3CQXC 4BT8A 3FDHA 3KV9A 4TUYE 3SFYA 2SPCA 4PS8A 4BJMA 2XQAA 4WW0A 4YJ2E 4U31A 3C4ZA 2P9IG 1TNZA 4UWLA 3DSWA 2H6GA 4O4HE 3UMVA 3MZKB 2WXFA 2XJ7A 2WXOA 3NF1A 4UWHA 3RC3A 3EHQA 3S2AA 5AQLB 2XQ6A 4UQZA 1X81A 1T98A 3APFA 3FTXA 4X8QA 4XKCA 3AEGA 3E0ZA 3AA6B 3JQ1A 4B93B 3QKYA 2PG8A 2ZM8A 2H6FA 2LRKA 2W4XA 3KV6A 5CFBA 3ZYQA 3ANWA 1IYGA 4GCNA 2H88A 3LVRE 4O1PA 1UN9A 3CKDA 1K8KG 2OEWA 1JNRA 3AG2E 3Q7AA 2X0LB 1NENA 1SA4A 4JD2G 5FZQA 3LJ3A 3I0QA 2IQCA 2RD0A 4X66T 1JCQA 3P50A 4GMLA 4HGAA 1N9AA 3X2QE 3I9YA 4JI8T 4DR5T 2UWJG 3MKDA 4IYPA 4IDZA 5L4EA 2UY1A 2CE7A 2J9QA 5H6RB 5AQPB 3ZEFA 3JAFA 3C3QA 2Q9QD 4HE8A 4YDOA 3NWIA 4B89A 4HFGA 5HRYA 3MK7C 1HG5A 3AE9A 4TRQA 3MEKA 3RKOA 3EVYA 4LSZE 1JNZA 3UM2A 3CEQA 3B57A 3PUKA 5AQQB 4XIFA 2LSKA 3KV5A 5C2YA 2K48A 2WDVA 1EZ3A 2UXCT 3Q2MA 3RYCE 3R9MA 4AI6A 2WQ7A 4AIUA 4GTSA 1SQMA 4IIJE 5LBQB 5FZRA 4QXCB 3UU6A 2WPVA 5LGTB 4N2SA 4H9SE 4PDXA 2AXUA 4U8YD 2V4HC 3ZT6A 5HEGA 5FQ6A 1BU9A 4GB9A 3PH0C 1UG3A 4ILIA 2C0LA 4PK5A 1J5ET 3D9JA 2GRRB 3UM0A 5ENRD 4ACKA 5AJLA 3UUBA 3ZJ2A 2R5SA 1YQ4A 2ZISA 2I2OA 2JPFA 3F6QA 3LEWA 4G8KA 5ARGA 4G26A 4PW8A 1VDYA 2P9UG 2ZIRA 5FINA 2AW6A 5DBKA 4E7SA 4ANJA 5FL1A 5JHBA 4XI0A 2AWIA 3JCKC 5LHIB 4I1MA 2PZIA 3GW4A 3NZQA 5FQ4A 2KZTB 3MV2B 4CEMA 4LFBT 1L5JA 1QUUA 5HXRA 5T3RA 4YSZA 2RPAA 5ENSD 5M72A 5ITZF 3UULA 3MZLB 1ZBPA 2DIWA 1SW6A 5J1GA 5FQ7A 2XUEA 2HO1A 2YHCA 5LA6E 1JCRA 2QGSA 3I1AA 4N78D 4HWFA 3F2EA 2RFMA 1W0AA 4UEMA 3H3MA 1KNPA 3OTOT 4Q94A 5ABGA 4IGUA 4B3MT 3MACA 2CMRA 4DR3T 4GKKT 2Y4UA 2YKSA 2E9XC 1NAFA 3OYZA 3CK8A 3CHSA 5CCLA 1JPLA 2WXMA 2M6IA 5EYPF 3C72A 3S7FA 5AQAA 1SE7A 4JEHA 4KUMB 2MOWA 3K3NA 3KSQA 2OVBA 4NRHB 2J4GA 3HXBA 3PUAA 2CXDA 5KNGA 3ZPJA 1N4SA 1E8WA 3Q78A 2KCLA 3DXKG 2PM6A 2VKOA 3KDSE 3FUHA 3T1HT 5JDLA 4EXTA 3GWHA 3TLUA 2X3MA 2Y8DA 3OVUA 2EIME 5FQ8A 2RKKA 3RKVA 5AQKB 1BI8B 4KP3C 2VSOE 4A98A 3O4ZA 3RGLA 1NA0A 3C5RA 4WWNA 5AQ7A 3P4SA 3NZUA 3EUHA 1TNYA 3NZPA 2EILE 2MYOA 2NSZA 4J8YA 5FY0A 3Q5EA 4GTQA 4GA2A 3QOFA 4APFA 4DX7D 5CA0E 3DBSA 4EQFA 4BETA 2VVNA 3SNXA 3GN5A 4H9RC 3ZPOA 3ONLA 4BT9A 3HKDE 4CCAA 4U95D 3AAIA 3UT5E 2ETBA 2J4DA 4X1IE 3T5XA 5HCMA 3RQUA 4EIWA 4UVCB 4W9RA 4G2VA 2V5CA 4TX5A 3PEVB 4WNEA 4HLEA 4AY6A 3ZN1B 2IF4A 5KXJA 1EYHA 3OKQA 3ASNE 3PNLB 2L9BA 1OXJA 5FY7A 1OWLA 4BTBA 2AXZA 3RKGA 4RG9A 2P58C 5CB4E 4H9NC 4FP7A 3OXFA 5EX3A 4UIGA 4RG6A 3SZ7A 4GYYA 4UQXA 3MKRA 2VGXA 4B3ST 3AVSA 1IQUA 1Q2ZA 3ML8A 2A5EA 2VQ2A 5KMGP 3BEEA 3C3OA 3QWVA 2QZAA 2C5IT 3TLVA 3MKQB 4GTPA 3AEBA 2GGFA 5J0ZA 2CHWA 4GK0E 3NBNB 2X6JA 2F8XK 2ZM0A 3JAEA 4UELA 3RIUC 2FBNA 3BK9A 3SFDA 4F53A 4DMWA 3AA1B 5L47A 3HIZA 2K3WA 3U66A 4HOUA 3LY7A 1E7PA 4G23A 3PVLA 3FEYA 1AJ3A 3PE0A 2R05A 3R6NA 4IDOA 1D0YA 2LUHA 4H7YA 2L9QA 2XPYA 5FT9A 2GROB 1NA3A 4EYUA 2PFVA 5FZSA 5LCWC 5AAOA 3Q5MA 4I50E 4LMKA 3FTYA 1NZNA 3LPZA 2LSYA 4PJLA 5LHHB 3PZ3A 4MS6A 3Q5WA 3CLJA 2VTBA 4TV3A 4TWFA 1MNDA 4HFBA 3CK7A 2J62A 2W66A 4HLLA 4CZ2D 2A72A 2N1GA 3FZMB 4U72A 1E8YA 1Z3XA 3ULQA 1LD8A 2ILRA 3Q79A 4EZJA 4I55E 3CSFA 3NVOA 4RSYA 4U2YA 2GW1A 4YSXA 3FTVA 2J1DG 3PZDA 4N3BA 4U0UA 4QXBB 3LSVA 4KX6A 3Q49B 5AQHB 3TG4A 1YYHA 2X67A 1MHQA 1TNUA 3FTWA 2KSRA 1N36T 1IJ5A 2D0TA 3U64A 4BEPA 2J08A 4C48B 2QYWA 4ZI3C 4BJNA 5LGUB 5BNWA 2LRLA 2H89A 5FL0A 4O1OA 2LXMA 1IXVA 5G05J 5JR9B 3UINC 1O1TA 1DCEA 2HPJA 3TJPA 4GZCA 4L0RA 3K3QC 3N9PA 3HKBE 2QVAA 2MPKA 3S7JA 5FY1A 3B5MA 5JJ6A 1TJCA 2BEDA 4ATZD 3UU5A 1XDPA 4HFCA 1GW6A 1LRZA 2X0YA 5FKYA 4DUZT 1V55E 3BU8A 1VCSA 2XZTG 3PUVF 1BPOA 1UN8A 2WU5A 1U3CA 3BUAA 4CT0A 2A9UA 4UF0B 2J49A 3CHMA 3FHEA 2XPZA 2WU2A 3IBEA 5HAXA 3VRBA 3DEOA 4KVOA 2V5DA 3AJIA 4AKGA 2NWBA 3ONXA 4O6FA 4U7EB 2XGOA 2IAKA 2X9HA 1N94A 3J5PA 3C50A 2V6YB 3R9AB 2XCCA 2XM1A 3Q9NC 3J7Yq 2LKGA 3QB5A 2XQ0A 3PNTB 3HL6A 3N71A 4X62T 1HU3A 4I0UA 3LY9A 2LT3A 2YQ8A 4OX9T 4CXYA 3FULA 5HYAA 5AJDA 4KMOA 4MHCA 2VSNA 3ZXPA 4K0UA 1SA0E 2BUGA 3UU4A 5HXEA 1HNXT 2GRQB 3JUEA 3QUJA 5BXOA 4ISTA 4GYWA 3GZ2A 1XWMA 4JI7T 3HKCE 4DVDA 2OCCE 4A3VA 4GK5E 5BXUA 2WXLA 2VKJA 3CK9A 3UU3A 4AOFA 3HG0D 4DMVA 3E37A 3VLDA 4NURA 1OEDB 5ABEA 2BKNA 3J5QB 4YFSA 2IC6A 3NOGD 4TNWA 1ELWA 4CN6A 4IRUA 4PS7A 2BKGA 3I5PA 4I2ZA 3AE3A 3V79K 4B94A 2W67A 3HYMB 4DR1T 3CX6B 3CVQA 4Q25A 3S4UA 1FT1A 3ZHEB 2MAWA 2AJAA 3BG0B 2J8SD 5JQGE 2KM4A 2XZDG 5AFUL 2BBHA 3ZMVB 4LUNU 1KEYA 4G24A 1MJ0A 3SFZA 3CV0A 1N52A 4ZEYA 4U8HA 4X64T 3A7MA 2F8YA 3QJZA 4EECA 1H2TC 5C1DA 5BR8T 3DTOA 5J90A 3RHWA 3D9LA 4EEDA 1HE8A 3FWVA 3BG1B 4DV2T 3KEAA 3RX6A 2V7IA 1OCRE 1DVPA 3FUIA 1KT1A 1E96B 4U0ZA 3H37A 3IV0A 1E2AA 1BR4A 3LBXA 2ZLYA 3UM1A 3AS5A 3A5XA 4GKJT 2LXLA 1LKXA 3NB2A 4AM9A 4ACLA 2EHOA 2H6IA 3IHVA 4DNDA 2ZMAA 3OTNA 1SUMB 2XSAA 3N9MA 1QLBA 2GRNB 1YD8G 5LG4A 1VCTA 2OEVA 3ESLA 1ZV4X 4CT4A 1IBMT 2KATA 3HXCA 3JADA 3HR0A 3FB2A 5KDMC 3AU5A 2NOXA 5CBNA 4TWDA 4IE5A 3G2UA 2BS2A 2AVPA 2QYUA 4KXKB 3T5VA 5LJNA 2LSIA 4J8FA 1VOMA 3B7RL 3QK0A 5H7PA 3W15B 3U78A 3C98A 1UURA 2WM9A 4APOA 3N5LA 5KBAA 3SF4A 3FBLA 4CN1A 2WQ6A 3AAAC 4O8SA 4QH5A 5EKQD 5HWXA 3E4BA 5JRCB 3CPZA 2VGYA 1M62A 2LJLA 3CHOA 4BFRA 4CDRA 2P9KG 2LM9A 4CZZB 5ANRA 4EPZA 3L13A 2W63A 2XCBA 4I6JA 2LAHA 4O4JE 4F6RC 2GRLA 1US7B 3FUFA 5HWYA 2DNXA 3TAXA 2X66A 2E5VA 2HN2A 2ACZA 3EIJA 3P4QA 4L1BA 4PJMA 1H19A 2VKDA 3PUQA 1JWGA 3CX7B 4B8CB 3CVWA 2RA1A 2XHEA 4AV7A 4FI5A 1WR6A 2JIWA 3DJBA 3IEGA 1OT8A 4YTPA 2MOZA 1S0PA 4C9BB 4JEUA 5AARA 3JC6C 3RI5A 2ZM6T 2VWAA 4P29A 4TUUA 3UX4A 4NUVA 1AWCB 3LK42 4AKRB 4XX5A 3TXNA 2PNNA 1HFAA 3TWSA 3V2XA 4XI9A 4XZ4A 1BD8A 4GTRA 4NUUA 4A5XA 1J1JA 4PAGA 4GAAA 4JI5T 4BX9A 1Z8UA 1FCHA 1AP7A 4IDQA 2BG9C 3NKZA 3LFMA 4WBOA 1OWMA 3JYSA 2IDOB 3PRZA 3EDUA 4ILBA 3CVVA 2XM2A 2QYJA 3NQPA 1Z0PA 1XZYA 5AIJA 3ZEFB 5LMUT 2R59A 3ENEA 2PQNA 1HO8A 2KNDA 4XAXB 2CG3A 4JHKA 5CRVA 4YHHT 1W09A 3WG7E 4P0AA 4HKAA 2QY7A 4AEZC 3FU6A 4JI0T 4Z91A 1UJKA 5HEJA 1HF8A 4CI2B 3Q9DA 2IC9A 4N2QA 5CBOA 2FULA 3NRYA 4G11A 5AENA 4QWNB 4PJJA 2IY0C 1OY3D 3NZSA 1TEZA 5JHAA 3PE4A 4MFRA 1WYBA 5EDSA 2KLQA 3CWZB 1A17A 3HHMA 3IBPA 1HNZT 3CIAA 3LVQE 4JHJA 3ZYKA 2CFUA 2BVMA 3Q15A 3CMLA 2B0OE 3ML9A 3KS2A 2C5KT 5AN8A 2H7OA 3CHRA 3ASGA 1ZKEA 3OXLA 4CGVA 1BR0A 4R7LA 3L39A 3FZHB 1D8DA 2PBIA 5JR9C 2LEHA 4AY5A 2DCPA 1EPUA 2PL2A 3OPCA 3ZGQA 2XQ5A 4IE0A 3TLSA 2C0MA 3D9NA 1S94A 3ZC1A 2WXRA 3PUYF 5HQ8A 3AS8A 5HXSA 4B0ZA 4QFVA 3LY8A 1EDUA 1IAPA 5A1LA 3IXEA 4OAUC 4BSXA 5DJQC 2VGEA 4CI3B 4HBDA 2M63A 3LXUX 3FZFB 4J6IA 1NI1A 4HN9A 2LAIA 2IU1A 3RSEG 3W9GA 3VTXA 3IEEA 1N0RA 3LYAA 1PAQA 1D0XA 2AXVA 2YU1A 4U0SA 2EHOD 5ENNA 4ANXA 4F1PA 3LG7A 1SZ9A 2ZM2A 1DU2A 4J7WA 4AQFA 2OLTA 3ZC0A 4QX8B 4CI1B 1HXIA 3B7SA 4U63A 3KINB 5LYJE 1O3XA 2DCFA 3C4XA 5ANLA 3TWVA 3QB5K 5BV0A 2QRXA 4LERA 3P4RA 4JEHB 3AG4E 2VQET 1N4QA 3UFGA 1IBKT 3AEFA 2CLYB 1Z3YA 3KD7A 2Q9QC 4Z8XA 4YXDA 3V2OA 5FXZA 4NPPA 4I1OB 2JJ9A 2V8SV 4AKHA 5T8IA 1MIVA 1OEDC 2ODVA 5CJ5A 5ENPD 5EK4A 1MIYA 3AE4A 4GPKA 2Y0BG 4EB6E 3PUXF 4IL4A 5LCYA 4GTVA 2VQFT 2NW8A 2FBWA 1KNRA 3ZMTB 2Y69E 5ETWA 4FC8A 5CMYA 3RRNB 5AQRB 3LK3B 2KWHA 1JCSA 1MMAA 4JUYA 4DUIA 5M4YA 1W9RA 2WBLA 1RW2A 2P9SG 4K5AB 2KBXA 3UM3A 3LJNA 2BF0X 4EOZB 2NTYA 3GMIA 2DVWA 3LDZA 3AECA 4DI3A 4QH1A 3PJAJ 3EJNA 3KSLA 2IO2C 4COFA 4CDMA 3FXDB 5G2NA 3GN5B 4A1GA 3Q5DA 1MYOA 2X6HA 4YDWA 2RP4A 1X5BA 4WYVA 2L6JA 4L23A 5ENTD 3RIBA 4I2WA 1QNFA 3AXJA 4TZ4C 1BI7B 4TV8E 4K0KT 5IYZE 4EAHA 2HH7A 1HR0T 3Q75A 1Z5SC 4I9CA 1FVHA 2KXPB 2WXIA 4JI6T 2YOEA 2M6BA 3DPYA 1TN7A 2C0SA 2W2UA 5EYLA 3CSTA 1FIOA 2GRMA 3TLWA 5J08A 2FO7A 3DSTA 3G2WA 2VGXB 3HRAA 2LE8A 4L9IA 4QX7B 4I6EA 2CA5A 5L4HA 5C2TA 3HXFA 2KC7A 3UPVA 4XE0A 3DEPA 3CGHA 4I43A 2XQ7A 1SA5A 5L3DB 2CBIA 2IHR1 4HFIA 2X9YA 1HS6A 4JLEA 5LGNB 3PDYA 4FLBA 4F7AA 3EHNA 1VRBA 3UFEA 4A3TA 5LCWJ 4LFCT 4L5GA 2DWZA 4ZHQE 1IBLT 1CUNA 5FP3A 4O4LE 2XS8A 1QQEA 1D1CA 2DHRA 2P9LG 2WCAA 2XEVA 2CCQA 2WSSV 4G63A 2ACXA 2XPKA 3GZSA 5EIDA 2YINA 3AG1E 2X6KA 1KZPA 1RZ4A 2D0UA 4LRZA 4B8AA 3PURA 2BS4A 3RRMB 1U4QA 4FJYA 2CWYA 2MYSA 4NIKA 1HZ4A 3UQ4A 1LF8A 3SY2A 2VTBB 1NL4A 2XRYA 1FMVA 1N33T 1EF1C 1XNFA 2VSYA 1OWNA 4AQGA 2LHNA 4ZI7E 1H6PA 1P5QA 2UUBT 2IW5B 1FT2A 3ZXSA 2CHZA 2WVIA 3CVPA 4X1YE 4ZZCA 3UIPC 3FP3A 1MX4A 2VK9A 2WXNA 2XENA 3TXMA 1O1RA 4FHJA 3TLTA 3ZKJA 3RAUA 5CEDB 2KMFA 1MMGA 2DI4A 5LB7B 1R8IA 4HVBA 2BKPA 3OAWA 3UT4A 3SI5A 2R17C 2Y6XA 4HEAA 4ZZBA 2EINE 3LKUA 5B1BE 4L9PA 2XSBA 3ASHA 2P2CP 5BV1A 1HX8A 3TWUA 4YNDA 4H63V 4Q69A 5AYWD 4X1KE 3FUDA 3RO2A 2WXGA 1YMPA 2NW7A 2V4LA 1V9DA 4KHPT 1OWOA 4Z90A 3IHYA 4DIDB 2WXHA 3RIFA 3N9OA 5DIZA 2L8KA 4I4TE 2IONA 1FMWA 4O4IE 2Y1LE 3RC8A 4GZ3A 4BX8A 2DYSE 2X6IA 3K3OA 3ZN3A 1PC2A 1E1HB 2A5UA 1QYMA 3RQWA 2FJBA 2FUPA 2BG9E 4UVAB 3EU9A 4CDNA 2EIKE 5HXCA 2BVLA 4HFDA 4ILCA 4EGWA 4QKNA 4I17A 3EU5A 3FUNA 4YT0A 1G3NB 3L82A 3QB2A 4HS2A 5IWAT 3R84B 3E34A 2ETCA 4QXHB 1QBQA 2YDSA 4TWHA 3AB3B 1UX5A 4HB5A 2XGMA 4UWGA 4B6XA 3MA5A 4JB8P 3CVNA 4HI8A 2D5UA 1HNWT 3FTSA 3UT7A 1WG0A 2Z6EA 1KPSB 1ZU2A 4ANVA 4JZYA 4KVMA 4LF7T 2WDRA 3S7DA 4DX1A 1QZ2A 1T7SA 3KBUA 5F8PA 4RVBA 4EYYR 3ASFA 1U2VG 3ZU7B 1IQRA 2NR4A 4IDNA 2K9AA 4GYSA 4C0EA 2RFAA 4YVOA 1FVFA 2N9DA 3KV4A 2DWKA 3FUMA 3CVRA 2LHRA 1YCSB 3L17A 2YDQA 2F0YA 3U4TA 3Q9UC 4DX2A 1XDOA 5LMNT 4P09A 2E8IA 3O9XA 4M3OA 2DZNA 2ZGGA 3BQOA 2LLYA 2LSGA 4JPSA 3URZA 4E6HA 3WI3A 2WQHA 3VR8A 4HWCA 2W61A 2F4VT 2OV8A 5FWQA 1HS7A 4N3CA 4V1Av 3AA0B 4JA7A 4LFAT 2CHXA 2I1JA 2CXFA 4AJWA 3LJCA 4C91A 2G0UA 5LBMA 4DV4T 3KEZA 3D0TA 5AQVB 3LBXB 2FJDA 4WNFA 2EHOB 1HCIA 2CLYC 3NOCD 1MZCA 2XPIA 2WAUA 4AIFA 4KT6B 4DBRA 2WWUA 2DZOA 2CBJA 1N32T 3JXIA 2CFZA 4A97A 4GTMA 1J5WA 2HPLA 5LOVE 3JQ0A 3TWQA 4OAVB 2I6HA 3ASDA 4DJAA 2EQXA 4YTMA 1UOHA 3D9KA 1BR1A 2JLBA 4LF9T 2XZEA 1NEKA 4IHJE 4KHZF 4U74A 4G1TA 1MMNA 2BZBA 3ZW3A 2WXKA 3C98B 3D9MA 4XZCA 1WM5A 4DO0A 4UVBB 4PNIA 3GYZA 4UV9B 4L2LA 3OBVE 3G06A 2H6HA 3ONLC 2WS3A 1D1AA 2UUCT 4MKTA 4AVXA 4ZHBA 4O2BE 3UI2A 3VTYA 5JDQA 4BA9A 3ZT5A 3RJVA 3D9OA 3FU3A 5CHEE 1DCQA 1A5EA 5J2TE 2ODUA 4ADZA 4U7YA 4AXHA 4F1SA 4MRUA 3VR9A 1K1BA 1WYCA 1SZAA 3I4GA 2FEZA 5LOZA 4CRWA 3UKUG 1KNZA 2FF4A 3ZN0B 5CMWA 5LP0A 4LNGA 1NWMX 4MLPA 2XHEB 1IZNB 4HFVA 3U3WA 1I6ZA 3DSSA 3RYIE 1ELRA 5KWDA 4BAYB 4X5TA 3F31A 1XGWA 4GIWA 2WMOA 3EHZA 3EI0A 4JEUB 5F3JA 4DV6T 3L8RA 4JL0A 1IKND 3UQ3A 4FULA 2W00A 3JUIA 3LS8A 2WQYA 3AE8A 5ENQD 1INZA 1FEWA 4X20E 3RO3A 3FXEB 3V30A 3ZUVB 4XEIG 4XBFB 2ES0A 3MGBA 3NRXA 2E2AA 2XAJB 2Y3AA 3QDNA 4GTOA 4ILGA 1OWAA 3N9LA 1D0ZA 4CXWA 2HR2A 3MX3A 4GTTA 3EHMA 3TGOA 5AQOB 5KJLA 4EZHA 1K1AA 3SS1A 4OVVA 3HVEA 3C4WA 5AQSB 2BKKB 1YA0A 2XEHA 4DR4T 3P8CD 4QHOA 4YSYA 5D0OD 4UV8B 4CQIA 2OOEA 5CCMA 3ULEG 4ILHB 5EILA 5D0QD 3K9IA 4A55A 3S7BA 4ZI2D 4P1NA 5AQTB 2WB2A 3AG3E 3I4RB 2XAHB 4A63B 4IN3B 1TN8A 4GA0A 5FMNA 1X9BA 4N5CA 4OK0A 3LK2B 3JC6D 4GYRA 2E9XA 3EHRA 1Y64B 4H9OC 2NYJA 5LP6E 2H7VC 3CVXA 1DC2A 4ZOLE 4LNBA 5IUXA 4JI2T 2FI7A 1TN6A 2JQ9A 3QARA 4GZ6A 4F3VA 4PFOA 2VJ8A 4I6GA 2JABA 2LOPA 2NTXA 2H3RA 2WXPA 5ADXL 2V0PA 4Q96A 3M3ZB 1D9SA 3ZMZB 5E75A 3V31A 5JTGA 1Y01A 2JMHA 4AP2A 3P4WA 5CECB 3FZKB 4OHFA 3ASOE 3HKEE 4UR9A 1HTJF 3QC1A 3APCA 3R7RA 4DX5D 4ASKA 2P9BA 3P4PA 4MALA 3V5SA 2X0HA 5E76A 3KBTA 2WXJA 5HI7A 2XGSA
chains in the Genus database with same CATH topology
3ZRHA 5JDFA 3RRWA 4ISSA 2KCVA 4E85A 4UXNB 2IOLA 5FYMA 2X6FA 1E8ZA 4PK6A 4GU5A 2NP9A 4C0MA 2WXQA 1U5PA 4EZKA 3IHRA 3PEUB 3L08A 3E08A 5JDMA 3ONKA 2V1DB 3OXGA 2UXNB 2IFUA 5KJMA 4KBMB 2JEKA 2B1EA 2KZ7B 2I1KA 2LSJA 4AKIA 3I9WA 3ZIMA 1JWFA 5KX5E 2QFCA 2V8SE 2UXXB 2L0IA 1IHGA 2PM7A 5JDGA 3SBTB 3EDVA 3CHQA 3SHFA 4WAFA 1Y8MA 4GZ5A 4EBAA 3EDTB 5JJTA 2IJGX 5KJKA 2V7LA 3BQIA 4UI9C 2XQYA 2CG2A 4KMCA 1B89A 2A2FX 4HOSA 5EZYE 1OWPA 5G04J 3RRUA 4HOTA 1W3BA 5LJMA 3PS6A 4C90A 1MNEA 1B7TA 3C51A 3B7TA 3O4XE 4H63H 4UQYA 3HI2A 4JVSA 2LSVA 4DPRA 1E7UA 4DK5A 5JDHA 3ESKA 4ANUA 3VLFA 4BY6A 3VHLA 3MV3B 4PJNA 4ZS3A 2V7JA 2VSXE 4OYJA 1N54A 2MBGA 3I3NA 5G55A 3DPDA 4WUYA 3CVUA 3L54A 3P7IA 2CXLA 4EBAG 1ELKA 3AVRA 4A56A 2EHOC 3FFLA 5BPPA 4I43B 3MYVA 4A1SA 4YLHA 5HXHA 2YNQA 2D2SA 4L7TA 4K0RA 3AU4A 3RYHE 4UI9K 4PUCA 5FTPA 2NXPA 4WNKA 5L2LA 3ZYLA 4FA6A 2K5BB 3QNKA 3FU5A 3IKOB 2LSUA 4FLHA 5BMVE 3ZVVA 3CVYA 5G04C 3MJXA 4HXIA 3ETUA 3FHNA 5E0OA 4WWPA 2E9XD 2DWGA 4M1PA 3OYXA 4ILUA 3ETVA 3D9IA 3T8MA 2PQRA 4H9QC 3LCAA 2YU2A 5DABA 3RK6A 3VKGA 2VB6A 3GA8A 2KCKA 2CWOA 3HA4A 2V26A 5KCMA 3PU3A 1Z6TA 3FUEA 5JVDE 4EZLA 1Y6IA 2YHEA 3RH3A 1WY6A 2ZU6B 4PS3A 3UUMA 3O1IA 3VKHA 4KZ0A 2KWIB 5L3CB 4WBNE 3MA9A 3RYFE 3D3MA 5L3BB 3N9QA 4UWKA 3ZJ1A 2JMKA 2KZTA 3CQGB 4DLQA 2X68A 4Y6WA 1HH8A 3PTRB 2A4ZA 3L09A 3AAAB 3D9PA 1DNPA 3SD5A 2YEVC 3N2OA 4ANWA 3H3AA 3VU7H 4IE4A 3RPUA 4ERRA 2I9CA 3SBSA 4JA9A 5GONE 5KJNA 4V3IA 2XAFB 3CKCA 3KFWX 3HDXA 5LNKA 4NACA 3FUKA 4JXTA 5FJYA 2HM8A 3G2SA 5EK3A 1KLXA 1UX4A 3KVBA 2V7KA 5JH7E 1U3DA 4WNGA 3SWHA 4YJ3E 4NQ0A 4DI4A 3FTUA 4JW1A 2RG8A 2J07A 2A3DA 2N2NA 2BDEA 3BQLA 4AKLA 3DP7A 3N2GE 4K03A 3PUGA 2W0GA 3IF8B 5DQWA 5H6QB 4BWRA 2M67A 3SRZA 3AS4A 2JQQA 1PY1A 3ZMSB 1TJFA 4GYOA 4U04A 4H9PC 4I9EA 2LNIA 2KT9A 4H7XA 4L2YA 3PE3A 1LVKA 4HORA 1ZHCA 5ARFA 1H2VC 3B7UX 2J4BA 4MLKA 3VLEA 4AQFC 4WWOA 1YKHB 3AAEB 3WAJA 5LFAA 4ZI3D 3U3IA 4FHKA 3FEXA 2WMNA 4CGWA 5A23A 3L22A 4GOUA 2CM0A 3ZFWA 1OXZA 5JDNA 3I0OA 2ONDA 2J09A 4UWFA 3FU0A 4P0BA 1E90A 3UT8A 4KYOB 3ZLIA 1E8XA 2JRKA 1WAO1 3MKQA 4U07A 5BW8C 2KINB 1YKEB 4LCTA 1MIWA 2XASB 3QOUA 4URKA 2X9XA 4G2AA 2DLRA 2E2EA 4PFPA 1LVFA 2NC9A 2MRIA 3K8PC 3F57A 3B13A 4HOQA 4XKBA 4EZ4A 4GMJA 5JJ7A 3ZCJA 2MHKA 3EIQC 2BTDA 2YK0A 1WRDA 3CX8B 3L6AA 3ZYMA 3FBZA 1MQSA 4AXPA 2V7MA 1KT0A 1UW4B 2XAQB 3Q4AB 4HTEA 4G25A 4KZCA 5EX0A 1H6KA 2C5JA 4FU3A 1WLXA 3WXXA 3UTKA 3CVLA 5LX8A 5BUZA 2Q9QB 1KK7A 5CA1E 4FJZA 4GA1A 4YHJA 3OJAA 3N2KE 2Y48B 1BR2A 5IHYA 4YVQC 3MXZA 1X79A 5JR9A 4WNDA 2W62A 3TG5A 5J2UE 4E7ZA 5TAOA 4J8SA 4LEUA 4ABNA 3HVEB 4TV9E 1UCUA 2V5FA 3CKBA 2X38A 5G05C 4OYKA 4UF0A 3TKLB 4N3AA 3U9WA 2K24A 3AA7B 3FY4A 3FTZA 3E22E 2OVFA 1YW0A 1MMDA 3ZMUB 4MBQA 4OYSA 1D1BA 2NW9A 2LO6A 4J0UA 2E9XB 2HYZA 4J8DA 5EK2A 5L3FB 5LHGB 1H7CA 4I1AA 2L0TB 2Q7FA 4KBQA 4O2AE 4Y6CA 5A6CA 1JUQA 3FUJA 2MTQA 4OFZA 3RU0A 2Q9QA 1UJJA 3P1UA 5JREA 4IULA 4TN7B 3N9NA 3GZ1A 3FH5A 4PH4B 3L16A 3RRCA 2IOSA 2XRZA 4CXXA 1QSDA 1IJ6A 2PJQA 5BT1A 4D10C 5LXTE 3KAEA 3ZHEA 4GCOA 3SOLA 3TL5A 3PUJA 4IE7A 3M65A 1H0AA 2QA7A 5T4YA 3V5UA 1ZEEA 2E0IA 3UUXB 1E7VA 2VL8A 2CEAA 2X51A 3FH8A 4BTAA 5DQVA 4OVUA 4DLOA 3CQCB 1HG2A 4FJOA 4JHRA 3FH7A 5L3GB 4UI9J 1H2UA 3QWPA 2DBAA 3C64A 1S35A 3WAKA 4N39A 3QAQA 2OA5A 3UUNA 3O1HA 2VYIA 3KVAA 2VKHA 3QWWA 2GK9A 4ZS2A 3R7QA 5FXVA 3G2VA 4ZI2C 4J2CA 4ATGA 3QC9A 2Y4TA 2XAGB 1SHZC 3T8OA 5FNVE 3QK6A 4FADA 3G2TA 3SGHA 3NBXX 2C2LA 3ZCIA 3PDNA 3MJWA 4J8EA 3Q47B 5A7DB 1NP7A 1OUVA 3O48A 1G8XA 3ANWB 3O1JA 3P2BA 4JC8A 4GZDA 3CR3A 2VASA 3PREA 3PU8A 5C8YE 3PUSA 4PK4A 5L3EB 2XTLA 5FXXA 2LOSA 3CHPA 1G73A 5JRCA 3UUXA 4IE6A 4ME2A 5FXWA 2X9WA 3L3PA 4DBQA 2UY1B 2L3LA 2I59A 3BQKA 3MCXA 3Q5XA 3APDA 3J9X1 3CQXC 4BT8A 3FDHA 3KV9A 4TUYE 2SPCA 4PS8A 4BJMA 4WW0A 4YJ2E 3C4ZA 4UWLA 4O4HE 3UMVA 3MZKB 2WXFA 2WXOA 3NF1A 4UWHA 3RC3A 3S2AA 4UQZA 1T98A 3APFA 3FTXA 4XKCA 3E0ZA 3AA6B 3JQ1A 3QKYA 2PG8A 2ZM8A 3KV6A 3ZYQA 3ANWA 1IYGA 4GCNA 3LVRE 1UN9A 3CKDA 2X0LB 5FZQA 3LJ3A 3I0QA 2IQCA 2RD0A 4GMLA 4HGAA 3I9YA 2UWJG 3MKDA 4IYPA 4IDZA 2UY1A 2CE7A 2J9QA 5H6RB 3ZEFA 2Q9QD 4HE8A 4B89A 4HFGA 3MK7C 1HG5A 4TRQA 3MEKA 3RKOA 3EVYA 3CEQA 3B57A 3PUKA 4XIFA 2LSKA 3KV5A 5C2YA 2K48A 1EZ3A 3Q2MA 3RYCE 4AI6A 2WQ7A 1SQMA 4IIJE 5LBQB 5FZRA 4QXCB 2WPVA 5LGTB 4N2SA 4H9SE 4PDXA 2AXUA 5FQ6A 4GB9A 3PH0C 1UG3A 4ILIA 2C0LA 4PK5A 3D9JA 4ACKA 5AJLA 3ZJ2A 2R5SA 2I2OA 2JPFA 3LEWA 5ARGA 4G26A 4PW8A 1VDYA 2AW6A 5DBKA 4E7SA 4ANJA 5JHBA 4XI0A 2AWIA 3JCKC 5LHIB 4I1MA 2PZIA 3GW4A 3NZQA 5FQ4A 2KZTB 3MV2B 4CEMA 1L5JA 1QUUA 5HXRA 5T3RA 5M72A 3UULA 3MZLB 1ZBPA 2DIWA 5J1GA 5FQ7A 2XUEA 2HO1A 2YHCA 5LA6E 2QGSA 3I1AA 4N78D 3F2EA 4UEMA 4Q94A 4IGUA 3MACA 2CMRA 2Y4UA 3CHSA 2E9XC 1NAFA 3OYZA 3CK8A 5CCLA 1JPLA 2WXMA 3S7FA 4JEHA 4KUMB 2MOWA 3K3NA 2OVBA 4NRHB 3PUAA 2CXDA 3ZPJA 1E8WA 2KCLA 2PM6A 2VKOA 3KDSE 3FUHA 5JDLA 4EXTA 3GWHA 2X3MA 2Y8DA 5FQ8A 3RKVA 4KP3C 2VSOE 3O4ZA 1NA0A 4WWNA 3NZUA 3EUHA 3NZPA 2NSZA 5FY0A 4GA2A 4APFA 5CA0E 3DBSA 4EQFA 3SNXA 3GN5A 4H9RC 3ZPOA 3ONLA 4BT9A 3HKDE 4CCAA 3AAIA 3UT5E 2J4DA 4X1IE 3T5XA 4EIWA 4UVCB 4W9RA 4G2VA 4TX5A 3PEVB 4WNEA 4HLEA 4AY6A 3ZN1B 2IF4A 1EYHA 3OKQA 3PNLB 2L9BA 5FY7A 1OWLA 4BTBA 2AXZA 4RG9A 2P58C 5CB4E 4H9NC 4FP7A 3OXFA 5EX3A 4UIGA 4RG6A 3SZ7A 4GYYA 4UQXA 3MKRA 2VGXA 3AVSA 1IQUA 3ML8A 2VQ2A 5KMGP 3BEEA 3QWVA 2C5IT 3MKQB 2GGFA 2CHWA 4GK0E 2X6JA 2ZM0A 4UELA 2FBNA 3BK9A 4F53A 3AA1B 4DMWA 3HIZA 3U66A 4HOUA 3LY7A 4G23A 3PVLA 3FEYA 1AJ3A 3PE0A 3R6NA 1D0YA 4H7YA 2L9QA 2XPYA 5FT9A 1NA3A 4EYUA 2PFVA 5FZSA 5LCWC 3Q5MA 4I50E 3FTYA 1NZNA 3LPZA 2LSYA 4PJLA 5LHHB 4MS6A 3Q5WA 3CLJA 2VTBA 4TV3A 1MNDA 3CK7A 2A72A 2N1GA 4U72A 1E8YA 1Z3XA 3ULQA 2ILRA 4EZJA 4I55E 3CSFA 4RSYA 2GW1A 3FTVA 4N3BA 2J1DG 3PZDA 4U0UA 4QXBB 3Q49B 3TG4A 2X67A 1MHQA 3FTWA 1IJ5A 2D0TA 3U64A 2J08A 4ZI3C 4BJNA 5LGUB 5BNWA 5G05J 5JR9B 2HPJA 3TJPA 4GZCA 4L0RA 3K3QC 3N9PA 3HKBE 3S7JA 5FY1A 5JJ6A 1TJCA 1GW6A 1LRZA 1UN8A 1BPOA 1U3CA 4CT0A 3CHMA 4UF0B 2J49A 3FHEA 2XPZA 3IBEA 5HAXA 4KVOA 4AKGA 2NWBA 3ONXA 4O6FA 2XGOA 2IAKA 2X9HA 3C50A 3R9AB 2XCCA 3J7Yq 2XQ0A 3PNTB 3HL6A 3N71A 1HU3A 3LY9A 2LT3A 2YQ8A 4CXYA 3FULA 5HYAA 5AJDA 4KMOA 4MHCA 2VSNA 4K0UA 1SA0E 2BUGA 5HXEA 3QUJA 4ISTA 4GYWA 3GZ2A 3HKCE 4DVDA 4A3VA 4GK5E 2WXLA 2VKJA 3CK9A 4AOFA 4DMVA 3VLDA 4NURA 4YFSA 2IC6A 1ELWA 4IRUA 4PS7A 3I5PA 4I2ZA 4B94A 3HYMB 3CX6B 3CVQA 3S4UA 3ZHEB 3BG0B 5JQGE 2KM4A 5AFUL 3ZMVB 4LUNU 4G24A 3SFZA 3CV0A 1N52A 4U8HA 3QJZA 4EECA 1H2TC 5C1DA 3DTOA 5J90A 3D9LA 1HE8A 3FWVA 3BG1B 3RX6A 2V7IA 1DVPA 3FUIA 1KT1A 1E96B 4U0ZA 3H37A 3IV0A 1BR4A 3LBXA 2ZLYA 3AS5A 3A5XA 1LKXA 4AM9A 4ACLA 2EHOA 3IHVA 4DNDA 2ZMAA 3OTNA 3N9MA 1YD8G 5LG4A 3ESLA 1ZV4X 4CT4A 2KATA 3HR0A 3FB2A 5KDMC 3AU5A 2NOXA 4IE5A 3G2UA 2AVPA 4KXKB 3T5VA 5LJNA 2LSIA 4J8FA 1VOMA 3B7RL 3QK0A 3W15B 3U78A 3C98A 2WM9A 4APOA 3N5LA 3SF4A 3FBLA 2WQ6A 4O8SA 5EKQD 5HWXA 3E4BA 5JRCB 3CPZA 2VGYA 2LJLA 3CHOA 4BFRA 4CDRA 2LM9A 4CZZB 5ANRA 4EPZA 3L13A 2W63A 2XCBA 4I6JA 2LAHA 4O4JE 4F6RC 2GRLA 1US7B 3FUFA 5HWYA 2DNXA 3TAXA 2X66A 3EIJA 4L1BA 4PJMA 1H19A 2VKDA 3PUQA 1JWGA 3CX7B 4B8CB 3CVWA 2RA1A 2XHEA 4AV7A 4FI5A 1WR6A 3DJBA 3IEGA 2MOZA 1S0PA 4C9BB 4JEUA 3JC6C 2VWAA 4P29A 4TUUA 3UX4A 4NUVA 3LK42 4AKRB 4XX5A 3TXNA 1HFAA 4XI9A 4XZ4A 4NUUA 4PAGA 4GAAA 4BX9A 1FCHA 1OWMA 3JYSA 3LFMA 4WBOA 3PRZA 3EDUA 3CVVA 3NQPA 1Z0PA 5AIJA 3ZEFB 2R59A 3ENEA 2PQNA 1HO8A 2KNDA 4XAXB 2CG3A 4JHKA 4P0AA 4HKAA 2QY7A 4AEZC 3FU6A 1UJKA 1HF8A 4CI2B 3Q9DA 2IC9A 4N2QA 2FULA 3NRYA 4G11A 5AENA 4QWNB 4PJJA 3NZSA 1TEZA 5JHAA 3PE4A 4MFRA 1WYBA 5EDSA 2KLQA 3CWZB 1A17A 3HHMA 3IBPA 3CIAA 3LVQE 4JHJA 3ZYKA 2CFUA 2BVMA 3Q15A 3CMLA 3ML9A 3KS2A 2C5KT 2H7OA 3CHRA 3ASGA 1ZKEA 3OXLA 4CGVA 1BR0A 4R7LA 2PBIA 5JR9C 2LEHA 4AY5A 2DCPA 1EPUA 2PL2A 3ZGQA 4IE0A 2C0MA 3D9NA 1S94A 3ZC1A 2WXRA 5HQ8A 3AS8A 5HXSA 4B0ZA 4QFVA 3LY8A 1EDUA 1IAPA 5A1LA 4BSXA 5DJQC 4CI3B 2M63A 3LXUX 4J6IA 4HN9A 2LAIA 2IU1A 3VTXA 3IEEA 3LYAA 1PAQA 1D0XA 2AXVA 2YU1A 4U0SA 2EHOD 5ENNA 4ANXA 3LG7A 1SZ9A 2ZM2A 4AQFA 3ZC0A 4QX8B 4CI1B 1HXIA 3B7SA 4U63A 3KINB 5LYJE 1O3XA 2DCFA 3C4XA 5ANLA 5BV0A 4LERA 4JEHB 2CLYB 1Z3YA 3KD7A 2Q9QC 4Z8XA 5FXZA 4I1OB 2JJ9A 4AKHA 5T8IA 1MIVA 2ODVA 5EK4A 1MIYA 4GPKA 4EB6E 5LCYA 2NW8A 4FC8A 3ZMTB 5ETWA 5CMYA 3RRNB 3LK3B 2KWHA 1MMAA 4JUYA 5M4YA 2WBLA 2BF0X 4EOZB 2NTYA 3GMIA 3LDZA 4DI3A 3EJNA 4CDMA 3FXDB 5G2NA 3GN5B 4A1GA 2X6HA 2RP4A 1X5BA 2L6JA 4L23A 3RIBA 4I2WA 1QNFA 4TZ4C 4TV8E 5IYZE 4EAHA 2HH7A 4I9CA 1FVHA 2KXPB 2WXIA 2C0SA 3CSTA 1FIOA 2GRMA 5J08A 2FO7A 3G2WA 2VGXB 2LE8A 4L9IA 4QX7B 4I6EA 2CA5A 2KC7A 3UPVA 4XE0A 3CGHA 4I43A 5L3DB 1HS6A 2X9YA 4JLEA 5LGNB 3PDYA 4FLBA 4F7AA 3EHNA 1VRBA 3UFEA 4A3TA 5LCWJ 4L5GA 4ZHQE 1CUNA 5FP3A 4O4LE 1QQEA 1D1CA 2DHRA 2XEVA 2CCQA 2WSSV 4G63A 2ACXA 3GZSA 2YINA 2X6KA 2D0UA 4LRZA 4B8AA 3PURA 3RRMB 1U4QA 4FJYA 2CWYA 2MYSA 1HZ4A 1LF8A 2VTBB 2XRYA 1FMVA 1EF1C 1XNFA 2VSYA 1OWNA 4AQGA 2LHNA 4ZI7E 1P5QA 2IW5B 3ZXSA 2CHZA 2WVIA 3CVPA 4X1YE 3FP3A 2VK9A 2WXNA 3TXMA 4FHJA 2KMFA 1MMGA 2DI4A 4HVBA 3OAWA 3UT4A 3SI5A 2R17C 2Y6XA 4HEAA 3LKUA 3ASHA 5BV1A 1HX8A 4YNDA 4H63V 4Q69A 5AYWD 4X1KE 3FUDA 3RO2A 2WXGA 2NW7A 2V4LA 1V9DA 1OWOA 3IHYA 2WXHA 3N9OA 5DIZA 2L8KA 4I4TE 2IONA 1FMWA 4O4IE 3RC8A 4GZ3A 4BX8A 2X6IA 3K3OA 3ZN3A 1PC2A 1E1HB 2A5UA 4UVAB 4CDNA 5HXCA 2BVLA 4QKNA 4I17A 3FUNA 3QB2A 4HS2A 3R84B 4QXHB 3AB3B 1UX5A 2XGMA 4UWGA 4B6XA 3MA5A 3CVNA 2D5UA 3FTSA 3UT7A 2Z6EA 1ZU2A 4ANVA 4JZYA 4KVMA 3S7DA 1QZ2A 3KBUA 5F8PA 4RVBA 4EYYR 3ASFA 1IQRA 2K9AA 4GYSA 4C0EA 4YVOA 1FVFA 2N9DA 3KV4A 2DWKA 3FUMA 3CVRA 2LHRA 3L17A 3U4TA 4P09A 2E8IA 3O9XA 4M3OA 2LSGA 4JPSA 3URZA 4E6HA 3WI3A 2WQHA 2W61A 2OV8A 5FWQA 1HS7A 4N3CA 4V1Av 3AA0B 4JA7A 2CHXA 2I1JA 2CXFA 4AJWA 3LJCA 4C91A 2G0UA 5LBMA 3KEZA 3D0TA 3LBXB 4WNFA 2EHOB 1HCIA 2CLYC 2XPIA 2WAUA 4AIFA 4KT6B 4DBRA 2WWUA 2CFZA 2HPLA 5LOVE 3JQ0A 2I6HA 3ASDA 4DJAA 2EQXA 3D9KA 1BR1A 2JLBA 4IHJE 4U74A 4G1TA 1MMNA 2BZBA 3ZW3A 2WXKA 3C98B 3D9MA 4XZCA 1WM5A 4DO0A 4UVBB 4PNIA 3GYZA 4UV9B 4L2LA 3OBVE 1D1AA 4MKTA 4AVXA 4O2BE 3VTYA 5JDQA 4BA9A 3RJVA 3D9OA 3FU3A 5CHEE 5J2TE 2ODUA 4ADZA 4AXHA 4F1SA 4MRUA 1WYCA 1SZAA 3I4GA 2FEZA 5LOZA 4CRWA 1KNZA 2FF4A 3ZN0B 5CMWA 5LP0A 1NWMX 4MLPA 2XHEB 1IZNB 4HFVA 3U3WA 3RYIE 1ELRA 4BAYB 1XGWA 3F31A 4GIWA 2WMOA 4JEUB 5F3JA 4JL0A 3UQ3A 4FULA 2W00A 3JUIA 3LS8A 1INZA 1FEWA 4X20E 3RO3A 3FXEB 4XBFB 2ES0A 3MGBA 3NRXA 2XAJB 2Y3AA 3QDNA 4ILGA 1OWAA 3N9LA 1D0ZA 4CXWA 2HR2A 3MX3A 3EHMA 3TGOA 5KJLA 4EZHA 3SS1A 4OVVA 3HVEA 3C4WA 1YA0A 3P8CD 4QHOA 5D0OD 4UV8B 4CQIA 2OOEA 5CCMA 4ILHB 5D0QD 3K9IA 4A55A 3S7BA 4ZI2D 2WB2A 3I4RB 2XAHB 4IN3B 4GA0A 5FMNA 4N5CA 4OK0A 3LK2B 3JC6D 4GYRA 2E9XA 1Y64B 4H9OC 5LP6E 2H7VC 3CVXA 4ZOLE 2FI7A 3QARA 4GZ6A 4F3VA 4PFOA 2VJ8A 4I6GA 2LOPA 2NTXA 2H3RA 2WXPA 5ADXL 2V0PA 4Q96A 3ZMZB 5E75A 4AP2A 2JMHA 4OHFA 3HKEE 1HTJF 3QC1A 3APCA 3R7RA 4ASKA 2P9BA 4MALA 3V5SA 5E76A 3KBTA 2WXJA 5HI7A 2XGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONK A;  1H0A A;  2MOW A;  4NAC A;  2LO6 A;  3D9K A;  1ELK A;  3D9O A;  3D9N A;  4JXT A;  1HFA A;  3D9L A;  3RRU A;  1EYH A;  1LF8 A;  3G2S A;  4GZD A;  1XGW A;  1VDY A;  1X5B A;  1EDU A;  4GZC A;  4Q96 A;  5J08 A;  1JWG A;  2KM4 A;  3G2V A;  2L0T B;  3G2W A;  3G2U A;  1JWF A;  3D9P A;  1SZA A;  3ZYK A;  4Q94 A;  1DVP A;  1JUQ A;  5LOZ A;  1HG2 A;  5CMY A;  2V8S E;  3ZYQ A;  3ONL A;  1UJJ A;  2L0I A;  3D9M A;  2QY7 A;  3CLJ A;  1INZ A;  4HFG A;  1HG5 A;  1UJK A;  1MHQ A;  1HF8 A;  1PY1 A;  2DIW A;  4AVX A;  3G2T A;  4FU3 A;  3D9J A;  2BF0 X;  3ZYL A;  3LDZ A;  3ZYM A;  2DCP A;  5CMW A;  1JPL A;  4FLB A;  5LP0 A;  3D9I A;  1SZ9 A;  1HX8 A; 
#chains in the Genus database with same CATH topology
 3ZRH A;  5JDF A;  3RRW A;  2ETA A;  4ISS A;  4ILA A;  2KCV A;  4DR2 T;  3UQ7 A;  4E85 A;  4UXN B;  2IOL A;  5FYM A;  4DV0 T;  1S63 A;  3FZL B;  2ZXW E;  4QH4 A;  2X6F A;  1E8Z A;  4BER A;  4EV6 A;  4PK6 A;  4YDY A;  4U8V D;  4LF4 T;  2YN6 A;  4GU5 A;  2NP9 A;  4C0M A;  4DX6 D;  2WXQ A;  1U5P A;  4EZK A;  3IHR A;  3ABM E;  3PEU B;  3PJA A;  3AE1 A;  4JBW F;  2IEJ A;  3L08 A;  3E08 A;  5JDM A;  3ONK A;  2V1D B;  3B7B A;  2UXN B;  2IFU A;  3OXG A;  4BSZ B;  5EIB E;  4KBM B;  5KJM A;  2JEK A;  2B1E A;  2KZ7 B;  2I1K A;  2LSJ A;  4AKI A;  2HE0 A;  3I9W A;  3DSX A;  4GPM A;  3ZIM A;  1MX6 A;  1JWF A;  3DWL G;  5KX5 E;  2VVS A;  2QFC A;  4HWH A;  1XNQ T;  2UXX B;  2V8S E;  2OV9 A;  2UU9 T;  2L0I A;  1IHG A;  5AQG B;  1FPP A;  5JDG A;  2PM7 A;  3SBT B;  5AQM B;  3EDV A;  5F5W A;  3CHQ A;  3SHF A;  3UTM A;  4WAF A;  1Y8M A;  4GZ5 A;  4EBA A;  1S70 B;  3EDT B;  5JJT A;  3SFE A;  2IJG X;  5KJK A;  2V7L A;  3BQI A;  4UI9 C;  2XQY A;  4AQY T;  2CG2 A;  4TXP A;  2BKO A;  4KMC A;  1B89 A;  2A2F X;  4HOS A;  5EZY E;  1OWP A;  4IL9 A;  3RIU A;  5G04 J;  2FJA A;  3RRU A;  5AQJ B;  4HOT A;  5FIO A;  1W3B A;  5LJM A;  4LML A;  3PS6 A;  4C90 A;  1HX1 B;  1WDY A;  5CGM A;  2R6G F;  1MNE A;  1B7T A;  3C51 A;  3B7T A;  3O4X E;  4H63 H;  4UQY A;  4YDE A;  1O5M A;  3HI2 A;  1LD7 A;  4JVS A;  2LSV A;  3C3R A;  3AXJ B;  2V5Q C;  4DPR A;  1E7U A;  4DK5 A;  5JDH A;  2EIJ E;  3ESK A;  4ANU A;  3VLF A;  3PV0 F;  2QC9 A;  3VHL A;  1N95 A;  4PJN A;  4ZS3 A;  3MV3 B;  4BY6 A;  3RIA A;  2V7J A;  1N4P A;  2HN1 A;  2VSX E;  4OYJ A;  3UXG A;  1N54 A;  2MBG A;  3I3N A;  3AE7 A;  5G55 A;  1FJG T;  3ZSS A;  1TYQ G;  3DPD A;  5CER B;  4WUY A;  3ZKR A;  3CVU A;  3L54 A;  3UIO C;  1WFD A;  3P7I A;  2CXL A;  4EBA G;  2IIU A;  3AVR A;  4A56 A;  2EHO C;  1ELK A;  3FFL A;  5BPP A;  4JI4 T;  4I43 B;  3MYV A;  4A1S A;  4YLH A;  5HXH A;  2YNQ A;  2D2S A;  4L7T A;  4K0R A;  3AU4 A;  4K5B A;  3RYH E;  4UI9 K;  4PUC A;  3SO8 A;  5FTP A;  4QQI A;  2NXP A;  1W0B A;  4WNK A;  5L2L A;  3AE5 A;  3ZYL A;  4FA6 A;  2K5B B;  3QNK A;  3FU5 A;  3IKO B;  2LSU A;  3EAM A;  1WR0 A;  4FLH A;  5BMV E;  3Q7F A;  2DYR E;  5HS0 A;  3ZVV A;  1M7K A;  1WCR A;  3CVY A;  4ZXL A;  5G04 C;  3MJX A;  3TWW A;  4HXI A;  3ETU A;  1N4R A;  3FHN A;  5E0O A;  4WWP A;  2E9X D;  1ZB1 A;  2DWG A;  3A8Y C;  4M1P A;  3OYX A;  4ILU A;  1BLX B;  3CK6 A;  4U96 D;  3ETV A;  3D9I A;  5HCJ A;  1T8B A;  3T8M A;  2PQR A;  4H9Q C;  3LCA A;  4UUC A;  2YU2 A;  5DAB A;  3RK6 A;  3VKG A;  2R02 A;  4G8L A;  2VB6 A;  3GA8 A;  1XMQ T;  2KCK A;  2CWO A;  4KI0 F;  3HA4 A;  2V26 A;  5D2M C;  2BBJ A;  5KCM A;  2JQH A;  3PU3 A;  1Z6T A;  3FUE A;  5JVD E;  4HRN A;  2JQK A;  2HHH T;  4EZL A;  1Y6I A;  3ONJ A;  2B76 A;  2YHE A;  4HQD A;  1L0V A;  1I94 T;  3RH3 A;  1WY6 A;  4HNA D;  2ZU6 B;  2LM2 A;  1D8E A;  4ZFH A;  4PS3 A;  3UUM A;  2XQ9 A;  4NXM T;  3AED A;  4B3R T;  3O1I A;  3VKH A;  3ABK E;  4KZ0 A;  2KWI B;  2XS1 A;  4RLY A;  4O60 A;  1OCC E;  3L9T A;  5JMN D;  5AQF B;  5L3C B;  4WBN E;  3DXM G;  3MA9 A;  3RYF E;  3D3M A;  5L3B B;  3N9Q A;  2GRP B;  3DRA A;  3PZ1 A;  4UWK A;  3ZJ1 A;  2JMK A;  2KZT A;  3CQG B;  4DLQ A;  5AQI B;  3SFX A;  4DR6 T;  1MX2 A;  2X68 A;  4Y6W A;  4DV7 T;  2WY2 A;  1HH8 A;  3PTR B;  2A4Z A;  3L09 A;  4EHM A;  5AQU B;  3AAA B;  3PUZ F;  3D9P A;  1DNP A;  3SD5 A;  1YQ3 A;  2YEV C;  3N2O A;  3DSV A;  4ANW A;  3H3A A;  3VU7 H;  4IE4 A;  2AXD S;  3RPU A;  4ERR A;  2I9C A;  3SBS A;  4JA9 A;  2WP9 A;  5GON E;  4HRM B;  5KJN A;  4V3I A;  4DUY T;  1S64 A;  2D9D A;  2XAF B;  3CKC A;  3KFW X;  3HDX A;  4LG6 A;  3ZT7 A;  5LNK A;  4NAC A;  3FUK A;  4JXT A;  3UKR G;  2UXB T;  5FJY A;  3E30 A;  2HM8 A;  3G2S A;  5C3J A;  4Z68 A;  5EK3 A;  1KLX A;  4LF6 T;  1UX4 A;  3KVB A;  2V7K A;  4DR7 T;  5JH7 E;  1UUS A;  4YY3 T;  1U3D A;  4WNG A;  3D9H A;  3SWH A;  4JV5 T;  4YJ3 E;  4NQ0 A;  4DI4 A;  1CHU A;  3FTU A;  4JW1 A;  2RG8 A;  2J07 A;  2A3D A;  3VRA A;  2N2N A;  2BDE A;  3BQL A;  4AKL A;  3DP7 A;  3N2G E;  4K03 A;  3PUG A;  3LDQ B;  2IUB A;  3T8K A;  2W0G A;  3IF8 B;  3TWX A;  5DQW A;  5H6Q B;  4BWR A;  2M67 A;  2J47 A;  3SRZ A;  1SVX A;  3PZ4 A;  4IT4 A;  3AS4 A;  4MBG A;  2JQQ A;  1PY1 A;  1O1S A;  3B95 A;  3QNU A;  3ZMS B;  2CPT A;  1TJF A;  4GYO A;  4U04 A;  2BG9 B;  4H9P C;  4GMR A;  2LNI A;  4I9E A;  5EN5 D;  2FJE A;  2KT9 A;  3NAW A;  4K5C A;  5CRU A;  5ABH A;  4H7X A;  4L2Y A;  2CRB A;  3PE3 A;  1LVK A;  5AQB A;  4HOR A;  1ZHC A;  1T72 A;  5ARF A;  1H2V C;  3B7U X;  1ZP0 A;  2J4B A;  2PTF A;  4MLK A;  2WWV A;  3VLE A;  4AQF C;  2F37 A;  4N5Q A;  4WWO A;  1YKH B;  5FVK A;  3AAE B;  3WAJ A;  1H6O A;  5LFA A;  4ZI3 D;  3U3I A;  4FHK A;  3ZNG A;  5D66 A;  3JXJ A;  3FEX A;  2WMN A;  4CGW A;  1IHB A;  5A23 A;  1TNB A;  3L22 A;  5FVL A;  4GOU A;  2CM0 A;  3ZFW A;  1OXZ A;  5HEH A;  5JDN A;  3DSU A;  1UK5 A;  3I0O A;  4U7I A;  5AQN B;  2OND A;  2L6B A;  2J09 A;  4UWF A;  3FU0 A;  4P0B A;  1E90 A;  3UT8 A;  4KYO B;  2XQ3 A;  3IA3 A;  3ZLI A;  1E8X A;  5ENO D;  2JRK A;  1WAO 1;  3MKQ A;  1XMO T;  4U07 A;  3E32 A;  3EUV A;  5BW8 C;  2AE9 A;  2P9N G;  2KIN B;  1YKE B;  4LCT A;  1MIW A;  2XAS B;  3QOU A;  5AQ9 A;  4URK A;  2WDQ A;  2X9X A;  4G2A A;  4B3T T;  2DLR A;  2E2E A;  4DRX E;  4PFP A;  2UUA T;  2V6X A;  2ZGD A;  1LVF A;  2NC9 A;  5JA4 D;  4TXR A;  2MRI A;  3K8P C;  4TNV A;  2IO3 C;  2BG9 A;  4U3C A;  3F57 A;  3B13 A;  3W9F A;  4HOQ A;  4XKB A;  2B6C A;  2VL0 A;  4EZ4 A;  4GMJ A;  5JJ7 A;  3ZCJ A;  2MHK A;  3EIQ C;  2BTD A;  5KNH D;  2YK0 A;  1WRD A;  3CX8 B;  3L6A A;  3ZYM A;  2WZI A;  3AEA A;  3FBZ A;  1MQS A;  4AXP A;  2V7M A;  3E33 A;  1KT0 A;  2VUR A;  1UW4 B;  3ZST A;  2XAQ B;  4CN4 A;  1K3Z D;  2CHN A;  3HXE A;  3Q4A B;  4HTE A;  3CIR A;  4G25 A;  4KZC A;  5EX0 A;  1H6K A;  3T1Y T;  2C5J A;  3ISM C;  2R2L A;  4TUM A;  4FU3 A;  3Q73 A;  1WLX A;  2DL1 A;  2WZH A;  3WXX A;  3UTK A;  3CVL A;  5LX8 A;  4HWI B;  5BUZ A;  1KK7 A;  2Q9Q B;  5CA1 E;  2E5L T;  4FJZ A;  4GA1 A;  4HFH A;  4YHJ A;  3OJA A;  3N2K E;  2Y48 B;  4LF8 T;  1BR2 A;  5IHY A;  4YVQ C;  5JR9 A;  3MXZ A;  1X79 A;  1OED E;  4WND A;  3JCF A;  1GQE A;  2W62 A;  3TG5 A;  4WZX A;  5J2U E;  3HXD A;  4F8H A;  3PZ2 A;  4E7Z A;  4HRL A;  5TAO A;  4J8S A;  4LEU A;  4ABN A;  3HVE B;  4LMJ A;  4TV9 E;  1UCU A;  3TWT A;  2V5F A;  3CKB A;  2X38 A;  5G05 C;  4OYK A;  4UF0 A;  3ABL E;  3TKL B;  4N3A A;  3U9W A;  2K24 A;  3AA7 B;  3FY4 A;  3FTZ A;  1OCO E;  2XY8 B;  3E22 E;  2KXP C;  3AE6 A;  3T9K A;  2OVF A;  2V6Y A;  1KZO A;  1YW0 A;  4M7C A;  1MMD A;  3ZMU B;  4MBQ A;  4OYS A;  2FO1 E;  1D1B A;  2NW9 A;  1YXR A;  2LO6 A;  4J0U A;  2E9X B;  4LF5 T;  2HYZ A;  4J8D A;  5EK2 A;  5L3F B;  5LHG B;  3K1S A;  1H7C A;  1ZOY A;  4I1A A;  2L0T B;  2Q7F A;  4KBQ A;  4O2A E;  4Y6C A;  4DV1 T;  5A6C A;  1JUQ A;  4DV3 T;  2MTQ A;  4OFZ A;  4X65 T;  3FUJ A;  3RU0 A;  2Q9Q A;  1UJJ A;  2P9P G;  3PUW F;  3P1U A;  5JRE A;  1KFY A;  2XEE A;  5HEU A;  4IUL A;  4AIS A;  1OED A;  4TN7 B;  3N9N A;  1N34 T;  3GZ1 A;  4HI9 A;  3FH5 A;  4RQI A;  4PH4 B;  3L16 A;  3RRC A;  5HKP A;  2IOS A;  2XRZ A;  3EAB A;  5ABF B;  4CXX A;  1QSD A;  1NFI E;  1IJ6 A;  5B1A E;  2PJQ A;  5BT1 A;  4D10 C;  5LXT E;  3KAE A;  4NIQ A;  4F6R D;  1N0Q A;  3ZHE A;  3X1D A;  4GCO A;  3SOL A;  1LTX A;  3TL5 A;  1OCZ E;  3PUJ A;  4JI1 T;  4IE7 A;  3RF1 A;  2XQ4 A;  2BS3 A;  3M65 A;  1H0A A;  2QA7 A;  4TXQ A;  5T4Y A;  4U33 A;  3ULY A;  3V5U A;  1ZEE A;  2E0I A;  3UUX B;  1E7V A;  2VL8 A;  2CEA A;  2X51 A;  3FH8 A;  4BTA A;  1V54 E;  5DQV A;  4OVU A;  4DLO A;  2CHO A;  5CEA A;  3CQC B;  1HG2 A;  4FJO A;  4JHR A;  3FH7 A;  5L3G B;  4UI9 J;  1H2U A;  2XQ8 A;  2DBA A;  2WB5 A;  3C64 A;  3QWP A;  1S35 A;  3WAK A;  4N39 A;  3QAQ A;  4U2Z A;  2OA5 A;  3UUN A;  1TR4 A;  3O1H A;  2VYI A;  3KVA A;  4DV5 T;  2LKH A;  2VKH A;  3QWW A;  2GK9 A;  3AEE A;  4ZS2 A;  2IML A;  3R7Q A;  5FXV A;  5B3S E;  4JYA T;  3G2V A;  4ZI2 C;  4J2C A;  4ATG A;  3QC9 A;  2Y4T A;  1XNR T;  2XAG B;  1SHZ C;  2UXD T;  5ABF A;  2YDR A;  3T8O A;  5FNV E;  3QK6 A;  4FAD A;  3G2T A;  3SGH A;  3NBX X;  5LG3 A;  2C2L A;  3RLF F;  4NXN T;  3ZCI A;  2I0M A;  3PDN A;  3MJW A;  4J8E A;  3Q47 B;  5A7D B;  1NP7 A;  4BES A;  1OUV A;  3O48 A;  1G8X A;  2R03 A;  5IY5 E;  3ANW B;  3O1J A;  1N11 A;  3P2B A;  3UU8 A;  4JC8 A;  3AE2 A;  3ABV A;  4IDP A;  3SQV A;  4GZD A;  3CR3 A;  2VAS A;  3PRE A;  4EEB A;  3PU8 A;  5C8Y E;  3PUS A;  4YTN A;  4PK4 A;  4IRE A;  5L3E B;  4JI3 T;  4CYM D;  2XTL A;  5FXX A;  2LOS A;  3CHP A;  1UGO A;  1G73 A;  4LNU D;  5JRC A;  3UUX A;  1KF6 A;  4IE6 A;  4ME2 A;  5FXW A;  2X9W A;  4HFE A;  3L3P A;  4DBQ A;  2UY1 B;  2L3L A;  2I59 A;  3BQK A;  3MCX A;  3TWR A;  4HWD A;  5HEO A;  3Q5X A;  3APD A;  3J9X 1;  1TNO A;  3CQX C;  4BT8 A;  3FDH A;  3KV9 A;  4TUY E;  3SFY A;  2SPC A;  4PS8 A;  4BJM A;  2XQA A;  4WW0 A;  4YJ2 E;  4U31 A;  3C4Z A;  2P9I G;  1TNZ A;  4UWL A;  3DSW A;  2H6G A;  4O4H E;  3UMV A;  3MZK B;  2WXF A;  2XJ7 A;  2WXO A;  3NF1 A;  4UWH A;  3RC3 A;  3EHQ A;  3S2A A;  5AQL B;  2XQ6 A;  4UQZ A;  1X81 A;  1T98 A;  3APF A;  3FTX A;  4X8Q A;  4XKC A;  3AEG A;  3E0Z A;  3AA6 B;  3JQ1 A;  4B93 B;  3QKY A;  2PG8 A;  2ZM8 A;  2H6F A;  2LRK A;  2W4X A;  3KV6 A;  5CFB A;  3ZYQ A;  3ANW A;  1IYG A;  4GCN A;  2H88 A;  3LVR E;  4O1P A;  1UN9 A;  3CKD A;  1K8K G;  2OEW A;  1JNR A;  3AG2 E;  3Q7A A;  2X0L B;  1NEN A;  1SA4 A;  4JD2 G;  5FZQ A;  3LJ3 A;  3I0Q A;  2IQC A;  2RD0 A;  4X66 T;  1JCQ A;  3P50 A;  4GML A;  4HGA A;  1N9A A;  3X2Q E;  3I9Y A;  4JI8 T;  4DR5 T;  2UWJ G;  3MKD A;  4IYP A;  4IDZ A;  5L4E A;  2UY1 A;  2CE7 A;  2J9Q A;  5H6R B;  5AQP B;  3ZEF A;  3JAF A;  3C3Q A;  2Q9Q D;  4HE8 A;  4YDO A;  3NWI A;  4B89 A;  4HFG A;  5HRY A;  3MK7 C;  1HG5 A;  3AE9 A;  4TRQ A;  3MEK A;  3RKO A;  3EVY A;  4LSZ E;  1JNZ A;  3UM2 A;  3CEQ A;  3B57 A;  3PUK A;  5AQQ B;  4XIF A;  2LSK A;  3KV5 A;  5C2Y A;  2K48 A;  2WDV A;  1EZ3 A;  2UXC T;  3Q2M A;  3RYC E;  3R9M A;  4AI6 A;  2WQ7 A;  4AIU A;  4GTS A;  1SQM A;  4IIJ E;  5LBQ B;  5FZR A;  4QXC B;  3UU6 A;  2WPV A;  5LGT B;  4N2S A;  4H9S E;  4PDX A;  2AXU A;  4U8Y D;  2V4H C;  3ZT6 A;  5HEG A;  5FQ6 A;  1BU9 A;  4GB9 A;  3PH0 C;  1UG3 A;  4ILI A;  2C0L A;  4PK5 A;  1J5E T;  3D9J A;  2GRR B;  3UM0 A;  5ENR D;  4ACK A;  5AJL A;  3UUB A;  3ZJ2 A;  2R5S A;  1YQ4 A;  2ZIS A;  2I2O A;  2JPF A;  3F6Q A;  3LEW A;  4G8K A;  5ARG A;  4G26 A;  4PW8 A;  1VDY A;  2P9U G;  2ZIR A;  5FIN A;  2AW6 A;  5DBK A;  4E7S A;  4ANJ A;  5FL1 A;  5JHB A;  4XI0 A;  2AWI A;  3JCK C;  5LHI B;  4I1M A;  2PZI A;  3GW4 A;  3NZQ A;  5FQ4 A;  2KZT B;  3MV2 B;  4CEM A;  4LFB T;  1L5J A;  1QUU A;  5HXR A;  5T3R A;  4YSZ A;  2RPA A;  5ENS D;  5M72 A;  5ITZ F;  3UUL A;  3MZL B;  1ZBP A;  2DIW A;  1SW6 A;  5J1G A;  5FQ7 A;  2XUE A;  2HO1 A;  2YHC A;  5LA6 E;  1JCR A;  2QGS A;  3I1A A;  4N78 D;  4HWF A;  3F2E A;  2RFM A;  1W0A A;  4UEM A;  3H3M A;  1KNP A;  3OTO T;  4Q94 A;  5ABG A;  4IGU A;  4B3M T;  3MAC A;  2CMR A;  4DR3 T;  4GKK T;  2Y4U A;  2YKS A;  2E9X C;  1NAF A;  3OYZ A;  3CK8 A;  3CHS A;  5CCL A;  1JPL A;  2WXM A;  2M6I A;  5EYP F;  3C72 A;  3S7F A;  5AQA A;  1SE7 A;  4JEH A;  4KUM B;  2MOW A;  3K3N A;  3KSQ A;  2OVB A;  4NRH B;  2J4G A;  3HXB A;  3PUA A;  2CXD A;  5KNG A;  3ZPJ A;  1N4S A;  1E8W A;  3Q78 A;  2KCL A;  3DXK G;  2PM6 A;  2VKO A;  3KDS E;  3FUH A;  3T1H T;  5JDL A;  4EXT A;  3GWH A;  3TLU A;  2X3M A;  2Y8D A;  3OVU A;  2EIM E;  5FQ8 A;  2RKK A;  3RKV A;  5AQK B;  1BI8 B;  4KP3 C;  2VSO E;  4A98 A;  3O4Z A;  3RGL A;  1NA0 A;  3C5R A;  4WWN A;  5AQ7 A;  3P4S A;  3NZU A;  3EUH A;  1TNY A;  3NZP A;  2EIL E;  2MYO A;  2NSZ A;  4J8Y A;  5FY0 A;  3Q5E A;  4GTQ A;  4GA2 A;  3QOF A;  4APF A;  4DX7 D;  5CA0 E;  3DBS A;  4EQF A;  4BET A;  2VVN A;  3SNX A;  3GN5 A;  4H9R C;  3ZPO A;  3ONL A;  4BT9 A;  3HKD E;  4CCA A;  4U95 D;  3AAI A;  3UT5 E;  2ETB A;  2J4D A;  4X1I E;  3T5X A;  5HCM A;  3RQU A;  4EIW A;  4UVC B;  4W9R A;  4G2V A;  2V5C A;  4TX5 A;  3PEV B;  4WNE A;  4HLE A;  4AY6 A;  3ZN1 B;  2IF4 A;  5KXJ A;  1EYH A;  3OKQ A;  3ASN E;  3PNL B;  2L9B A;  1OXJ A;  5FY7 A;  1OWL A;  4BTB A;  2AXZ A;  3RKG A;  4RG9 A;  2P58 C;  5CB4 E;  4H9N C;  4FP7 A;  3OXF A;  5EX3 A;  4UIG A;  4RG6 A;  3SZ7 A;  4GYY A;  4UQX A;  3MKR A;  2VGX A;  4B3S T;  3AVS A;  1IQU A;  1Q2Z A;  3ML8 A;  2A5E A;  2VQ2 A;  5KMG P;  3BEE A;  3C3O A;  3QWV A;  2QZA A;  2C5I T;  3TLV A;  3MKQ B;  4GTP A;  3AEB A;  2GGF A;  5J0Z A;  2CHW A;  4GK0 E;  3NBN B;  2X6J A;  2F8X K;  2ZM0 A;  3JAE A;  4UEL A;  3RIU C;  2FBN A;  3BK9 A;  3SFD A;  4F53 A;  4DMW A;  3AA1 B;  5L47 A;  3HIZ A;  2K3W A;  3U66 A;  4HOU A;  3LY7 A;  1E7P A;  4G23 A;  3PVL A;  3FEY A;  1AJ3 A;  3PE0 A;  2R05 A;  3R6N A;  4IDO A;  1D0Y A;  2LUH A;  4H7Y A;  2L9Q A;  2XPY A;  5FT9 A;  2GRO B;  1NA3 A;  4EYU A;  2PFV A;  5FZS A;  5LCW C;  5AAO A;  3Q5M A;  4I50 E;  4LMK A;  3FTY A;  1NZN A;  3LPZ A;  2LSY A;  4PJL A;  5LHH B;  3PZ3 A;  4MS6 A;  3Q5W A;  3CLJ A;  2VTB A;  4TV3 A;  4TWF A;  1MND A;  4HFB A;  3CK7 A;  2J62 A;  2W66 A;  4HLL A;  4CZ2 D;  2A72 A;  2N1G A;  3FZM B;  4U72 A;  1E8Y A;  1Z3X A;  3ULQ A;  1LD8 A;  2ILR A;  3Q79 A;  4EZJ A;  4I55 E;  3CSF A;  3NVO A;  4RSY A;  4U2Y A;  2GW1 A;  4YSX A;  3FTV A;  2J1D G;  3PZD A;  4N3B A;  4U0U A;  4QXB B;  3LSV A;  4KX6 A;  3Q49 B;  5AQH B;  3TG4 A;  1YYH A;  2X67 A;  1MHQ A;  1TNU A;  3FTW A;  2KSR A;  1N36 T;  1IJ5 A;  2D0T A;  3U64 A;  4BEP A;  2J08 A;  4C48 B;  2QYW A;  4ZI3 C;  4BJN A;  5LGU B;  5BNW A;  2LRL A;  2H89 A;  5FL0 A;  4O1O A;  2LXM A;  1IXV A;  5G05 J;  5JR9 B;  3UIN C;  1O1T A;  1DCE A;  2HPJ A;  3TJP A;  4GZC A;  4L0R A;  3K3Q C;  3N9P A;  3HKB E;  2QVA A;  2MPK A;  3S7J A;  5FY1 A;  3B5M A;  5JJ6 A;  1TJC A;  2BED A;  4ATZ D;  3UU5 A;  1XDP A;  4HFC A;  1GW6 A;  1LRZ A;  2X0Y A;  5FKY A;  4DUZ T;  1V55 E;  3BU8 A;  1VCS A;  2XZT G;  3PUV F;  1BPO A;  1UN8 A;  2WU5 A;  1U3C A;  3BUA A;  4CT0 A;  2A9U A;  4UF0 B;  2J49 A;  3CHM A;  3FHE A;  2XPZ A;  2WU2 A;  3IBE A;  5HAX A;  3VRB A;  3DEO A;  4KVO A;  2V5D A;  3AJI A;  4AKG A;  2NWB A;  3ONX A;  4O6F A;  4U7E B;  2XGO A;  2IAK A;  2X9H A;  1N94 A;  3J5P A;  3C50 A;  2V6Y B;  3R9A B;  2XCC A;  2XM1 A;  3Q9N C;  3J7Y q;  2LKG A;  3QB5 A;  2XQ0 A;  3PNT B;  3HL6 A;  3N71 A;  4X62 T;  1HU3 A;  4I0U A;  3LY9 A;  2LT3 A;  2YQ8 A;  4OX9 T;  4CXY A;  3FUL A;  5HYA A;  5AJD A;  4KMO A;  4MHC A;  2VSN A;  3ZXP A;  4K0U A;  1SA0 E;  2BUG A;  3UU4 A;  5HXE A;  1HNX T;  2GRQ B;  3JUE A;  3QUJ A;  5BXO A;  4IST A;  4GYW A;  3GZ2 A;  1XWM A;  4JI7 T;  3HKC E;  4DVD A;  2OCC E;  4A3V A;  4GK5 E;  5BXU A;  2WXL A;  2VKJ A;  3CK9 A;  3UU3 A;  4AOF A;  3HG0 D;  4DMV A;  3E37 A;  3VLD A;  4NUR A;  1OED B;  5ABE A;  2BKN A;  3J5Q B;  4YFS A;  2IC6 A;  3NOG D;  4TNW A;  1ELW A;  4CN6 A;  4IRU A;  4PS7 A;  2BKG A;  3I5P A;  4I2Z A;  3AE3 A;  3V79 K;  4B94 A;  2W67 A;  3HYM B;  4DR1 T;  3CX6 B;  3CVQ A;  4Q25 A;  3S4U A;  1FT1 A;  3ZHE B;  2MAW A;  2AJA A;  3BG0 B;  2J8S D;  5JQG E;  2KM4 A;  2XZD G;  5AFU L;  2BBH A;  3ZMV B;  4LUN U;  1KEY A;  4G24 A;  1MJ0 A;  3SFZ A;  3CV0 A;  1N52 A;  4ZEY A;  4U8H A;  4X64 T;  3A7M A;  2F8Y A;  3QJZ A;  4EEC A;  1H2T C;  5C1D A;  5BR8 T;  3DTO A;  5J90 A;  3RHW A;  3D9L A;  4EED A;  1HE8 A;  3FWV A;  3BG1 B;  4DV2 T;  3KEA A;  3RX6 A;  2V7I A;  1OCR E;  1DVP A;  3FUI A;  1KT1 A;  1E96 B;  4U0Z A;  3H37 A;  3IV0 A;  1E2A A;  1BR4 A;  3LBX A;  2ZLY A;  3UM1 A;  3AS5 A;  3A5X A;  4GKJ T;  2LXL A;  1LKX A;  3NB2 A;  4AM9 A;  4ACL A;  2EHO A;  2H6I A;  3IHV A;  4DND A;  2ZMA A;  3OTN A;  1SUM B;  2XSA A;  3N9M A;  1QLB A;  2GRN B;  1YD8 G;  5LG4 A;  1VCT A;  2OEV A;  3ESL A;  1ZV4 X;  4CT4 A;  1IBM T;  2KAT A;  3HXC A;  3JAD A;  3HR0 A;  3FB2 A;  5KDM C;  3AU5 A;  2NOX A;  5CBN A;  4TWD A;  4IE5 A;  3G2U A;  2BS2 A;  2AVP A;  2QYU A;  4KXK B;  3T5V A;  5LJN A;  2LSI A;  4J8F A;  1VOM A;  3B7R L;  3QK0 A;  5H7P A;  3W15 B;  3U78 A;  3C98 A;  1UUR A;  2WM9 A;  4APO A;  3N5L A;  5KBA A;  3SF4 A;  3FBL A;  4CN1 A;  2WQ6 A;  3AAA C;  4O8S A;  4QH5 A;  5EKQ D;  5HWX A;  3E4B A;  5JRC B;  3CPZ A;  2VGY A;  1M62 A;  2LJL A;  3CHO A;  4BFR A;  4CDR A;  2P9K G;  2LM9 A;  4CZZ B;  5ANR A;  4EPZ A;  3L13 A;  2W63 A;  2XCB A;  4I6J A;  2LAH A;  4O4J E;  4F6R C;  2GRL A;  1US7 B;  3FUF A;  5HWY A;  2DNX A;  3TAX A;  2X66 A;  2E5V A;  2HN2 A;  2ACZ A;  3EIJ A;  3P4Q A;  4L1B A;  4PJM A;  1H19 A;  2VKD A;  3PUQ A;  1JWG A;  3CX7 B;  4B8C B;  3CVW A;  2RA1 A;  2XHE A;  4AV7 A;  4FI5 A;  1WR6 A;  2JIW A;  3DJB A;  3IEG A;  1OT8 A;  4YTP A;  2MOZ A;  1S0P A;  4C9B B;  4JEU A;  5AAR A;  3JC6 C;  3RI5 A;  2ZM6 T;  2VWA A;  4P29 A;  4TUU A;  3UX4 A;  4NUV A;  1AWC B;  3LK4 2;  4AKR B;  4XX5 A;  3TXN A;  2PNN A;  1HFA A;  3TWS A;  3V2X A;  4XI9 A;  4XZ4 A;  1BD8 A;  4GTR A;  4NUU A;  4A5X A;  1J1J A;  4PAG A;  4GAA A;  4JI5 T;  4BX9 A;  1Z8U A;  1FCH A;  1AP7 A;  4IDQ A;  2BG9 C;  3NKZ A;  3LFM A;  4WBO A;  1OWM A;  3JYS A;  2IDO B;  3PRZ A;  3EDU A;  4ILB A;  3CVV A;  2XM2 A;  2QYJ A;  3NQP A;  1Z0P A;  1XZY A;  5AIJ A;  3ZEF B;  5LMU T;  2R59 A;  3ENE A;  2PQN A;  1HO8 A;  2KND A;  4XAX B;  2CG3 A;  4JHK A;  5CRV A;  4YHH T;  1W09 A;  3WG7 E;  4P0A A;  4HKA A;  2QY7 A;  4AEZ C;  3FU6 A;  4JI0 T;  4Z91 A;  1UJK A;  5HEJ A;  1HF8 A;  4CI2 B;  3Q9D A;  2IC9 A;  4N2Q A;  5CBO A;  2FUL A;  3NRY A;  4G11 A;  5AEN A;  4QWN B;  4PJJ A;  2IY0 C;  1OY3 D;  3NZS A;  1TEZ A;  5JHA A;  3PE4 A;  4MFR A;  1WYB A;  5EDS A;  2KLQ A;  3CWZ B;  1A17 A;  3HHM A;  3IBP A;  1HNZ T;  3CIA A;  3LVQ E;  4JHJ A;  3ZYK A;  2CFU A;  2BVM A;  3Q15 A;  3CML A;  2B0O E;  3ML9 A;  3KS2 A;  2C5K T;  5AN8 A;  2H7O A;  3CHR A;  3ASG A;  1ZKE A;  3OXL A;  4CGV A;  1BR0 A;  4R7L A;  3L39 A;  3FZH B;  1D8D A;  2PBI A;  5JR9 C;  2LEH A;  4AY5 A;  2DCP A;  1EPU A;  2PL2 A;  3OPC A;  3ZGQ A;  2XQ5 A;  4IE0 A;  3TLS A;  2C0M A;  3D9N A;  1S94 A;  3ZC1 A;  2WXR A;  3PUY F;  5HQ8 A;  3AS8 A;  5HXS A;  4B0Z A;  4QFV A;  3LY8 A;  1EDU A;  1IAP A;  5A1L A;  3IXE A;  4OAU C;  4BSX A;  5DJQ C;  2VGE A;  4CI3 B;  4HBD A;  2M63 A;  3LXU X;  3FZF B;  4J6I A;  1NI1 A;  4HN9 A;  2LAI A;  2IU1 A;  3RSE G;  3W9G A;  3VTX A;  3IEE A;  1N0R A;  3LYA A;  1PAQ A;  1D0X A;  2AXV A;  2YU1 A;  4U0S A;  2EHO D;  5ENN A;  4ANX A;  4F1P A;  3LG7 A;  1SZ9 A;  2ZM2 A;  1DU2 A;  4J7W A;  4AQF A;  2OLT A;  3ZC0 A;  4QX8 B;  4CI1 B;  1HXI A;  3B7S A;  4U63 A;  3KIN B;  5LYJ E;  1O3X A;  2DCF A;  3C4X A;  5ANL A;  3TWV A;  3QB5 K;  5BV0 A;  2QRX A;  4LER A;  3P4R A;  4JEH B;  3AG4 E;  2VQE T;  1N4Q A;  3UFG A;  1IBK T;  3AEF A;  2CLY B;  1Z3Y A;  3KD7 A;  2Q9Q C;  4Z8X A;  4YXD A;  3V2O A;  5FXZ A;  4NPP A;  4I1O B;  2JJ9 A;  2V8S V;  4AKH A;  5T8I A;  1MIV A;  1OED C;  2ODV A;  5CJ5 A;  5ENP D;  5EK4 A;  1MIY A;  3AE4 A;  4GPK A;  2Y0B G;  4EB6 E;  3PUX F;  4IL4 A;  5LCY A;  4GTV A;  2VQF T;  2NW8 A;  2FBW A;  1KNR A;  3ZMT B;  2Y69 E;  5ETW A;  4FC8 A;  5CMY A;  3RRN B;  5AQR B;  3LK3 B;  2KWH A;  1JCS A;  1MMA A;  4JUY A;  4DUI A;  5M4Y A;  1W9R A;  2WBL A;  1RW2 A;  2P9S G;  4K5A B;  2KBX A;  3UM3 A;  3LJN A;  2BF0 X;  4EOZ B;  2NTY A;  3GMI A;  2DVW A;  3LDZ A;  3AEC A;  4DI3 A;  4QH1 A;  3PJA J;  3EJN A;  3KSL A;  2IO2 C;  4COF A;  4CDM A;  3FXD B;  5G2N A;  3GN5 B;  4A1G A;  3Q5D A;  1MYO A;  2X6H A;  4YDW A;  2RP4 A;  1X5B A;  4WYV A;  2L6J A;  4L23 A;  5ENT D;  3RIB A;  4I2W A;  1QNF A;  3AXJ A;  4TZ4 C;  1BI7 B;  4TV8 E;  4K0K T;  5IYZ E;  4EAH A;  2HH7 A;  1HR0 T;  3Q75 A;  1Z5S C;  4I9C A;  1FVH A;  2KXP B;  2WXI A;  4JI6 T;  2YOE A;  2M6B A;  3DPY A;  1TN7 A;  2C0S A;  2W2U A;  5EYL A;  3CST A;  1FIO A;  2GRM A;  3TLW A;  5J08 A;  2FO7 A;  3DST A;  3G2W A;  2VGX B;  3HRA A;  2LE8 A;  4L9I A;  4QX7 B;  4I6E A;  2CA5 A;  5L4H A;  5C2T A;  3HXF A;  2KC7 A;  3UPV A;  4XE0 A;  3DEP A;  3CGH A;  4I43 A;  2XQ7 A;  1SA5 A;  5L3D B;  2CBI A;  2IHR 1;  4HFI A;  2X9Y A;  1HS6 A;  4JLE A;  5LGN B;  3PDY A;  4FLB A;  4F7A A;  3EHN A;  1VRB A;  3UFE A;  4A3T A;  5LCW J;  4LFC T;  4L5G A;  2DWZ A;  4ZHQ E;  1IBL T;  1CUN A;  5FP3 A;  4O4L E;  2XS8 A;  1QQE A;  1D1C A;  2DHR A;  2P9L G;  2WCA A;  2XEV A;  2CCQ A;  2WSS V;  4G63 A;  2ACX A;  2XPK A;  3GZS A;  5EID A;  2YIN A;  3AG1 E;  2X6K A;  1KZP A;  1RZ4 A;  2D0U A;  4LRZ A;  4B8A A;  3PUR A;  2BS4 A;  3RRM B;  1U4Q A;  4FJY A;  2CWY A;  2MYS A;  4NIK A;  1HZ4 A;  3UQ4 A;  1LF8 A;  3SY2 A;  2VTB B;  1NL4 A;  2XRY A;  1FMV A;  1N33 T;  1EF1 C;  1XNF A;  2VSY A;  1OWN A;  4AQG A;  2LHN A;  4ZI7 E;  1H6P A;  1P5Q A;  2UUB T;  2IW5 B;  1FT2 A;  3ZXS A;  2CHZ A;  2WVI A;  3CVP A;  4X1Y E;  4ZZC A;  3UIP C;  3FP3 A;  1MX4 A;  2VK9 A;  2WXN A;  2XEN A;  3TXM A;  1O1R A;  4FHJ A;  3TLT A;  3ZKJ A;  3RAU A;  5CED B;  2KMF A;  1MMG A;  2DI4 A;  5LB7 B;  1R8I A;  4HVB A;  2BKP A;  3OAW A;  3UT4 A;  3SI5 A;  2R17 C;  2Y6X A;  4HEA A;  4ZZB A;  2EIN E;  3LKU A;  5B1B E;  4L9P A;  2XSB A;  3ASH A;  2P2C P;  5BV1 A;  1HX8 A;  3TWU A;  4YND A;  4H63 V;  4Q69 A;  5AYW D;  4X1K E;  3FUD A;  3RO2 A;  2WXG A;  1YMP A;  2NW7 A;  2V4L A;  1V9D A;  4KHP T;  1OWO A;  4Z90 A;  3IHY A;  4DID B;  2WXH A;  3RIF A;  3N9O A;  5DIZ A;  2L8K A;  4I4T E;  2ION A;  1FMW A;  4O4I E;  2Y1L E;  3RC8 A;  4GZ3 A;  4BX8 A;  2DYS E;  2X6I A;  3K3O A;  3ZN3 A;  1PC2 A;  1E1H B;  2A5U A;  1QYM A;  3RQW A;  2FJB A;  2FUP A;  2BG9 E;  4UVA B;  3EU9 A;  4CDN A;  2EIK E;  5HXC A;  2BVL A;  4HFD A;  4ILC A;  4EGW A;  4QKN A;  4I17 A;  3EU5 A;  3FUN A;  4YT0 A;  1G3N B;  3L82 A;  3QB2 A;  4HS2 A;  5IWA T;  3R84 B;  3E34 A;  2ETC A;  4QXH B;  1QBQ A;  2YDS A;  4TWH A;  3AB3 B;  1UX5 A;  4HB5 A;  2XGM A;  4UWG A;  4B6X A;  3MA5 A;  4JB8 P;  3CVN A;  4HI8 A;  2D5U A;  1HNW T;  3FTS A;  3UT7 A;  1WG0 A;  2Z6E A;  1KPS B;  1ZU2 A;  4ANV A;  4JZY A;  4KVM A;  4LF7 T;  2WDR A;  3S7D A;  4DX1 A;  1QZ2 A;  1T7S A;  3KBU A;  5F8P A;  4RVB A;  4EYY R;  3ASF A;  1U2V G;  3ZU7 B;  1IQR A;  2NR4 A;  4IDN A;  2K9A A;  4GYS A;  4C0E A;  2RFA A;  4YVO A;  1FVF A;  2N9D A;  3KV4 A;  2DWK A;  3FUM A;  3CVR A;  2LHR A;  1YCS B;  3L17 A;  2YDQ A;  2F0Y A;  3U4T A;  3Q9U C;  4DX2 A;  1XDO A;  5LMN T;  4P09 A;  2E8I A;  3O9X A;  4M3O A;  2DZN A;  2ZGG A;  3BQO A;  2LLY A;  2LSG A;  4JPS A;  3URZ A;  4E6H A;  3WI3 A;  2WQH A;  3VR8 A;  4HWC A;  2W61 A;  2F4V T;  2OV8 A;  5FWQ A;  1HS7 A;  4N3C A;  4V1A v;  3AA0 B;  4JA7 A;  4LFA T;  2CHX A;  2I1J A;  2CXF A;  4AJW A;  3LJC A;  4C91 A;  2G0U A;  5LBM A;  4DV4 T;  3KEZ A;  3D0T A;  5AQV B;  3LBX B;  2FJD A;  4WNF A;  2EHO B;  1HCI A;  2CLY C;  3NOC D;  1MZC A;  2XPI A;  2WAU A;  4AIF A;  4KT6 B;  4DBR A;  2WWU A;  2DZO A;  2CBJ A;  1N32 T;  3JXI A;  2CFZ A;  4A97 A;  4GTM A;  1J5W A;  2HPL A;  5LOV E;  3JQ0 A;  3TWQ A;  4OAV B;  2I6H A;  3ASD A;  4DJA A;  2EQX A;  4YTM A;  1UOH A;  3D9K A;  1BR1 A;  2JLB A;  4LF9 T;  2XZE A;  1NEK A;  4IHJ E;  4KHZ F;  4U74 A;  4G1T A;  1MMN A;  2BZB A;  3ZW3 A;  2WXK A;  3C98 B;  3D9M A;  4XZC A;  1WM5 A;  4DO0 A;  4UVB B;  4PNI A;  3GYZ A;  4UV9 B;  4L2L A;  3OBV E;  3G06 A;  2H6H A;  3ONL C;  2WS3 A;  1D1A A;  2UUC T;  4MKT A;  4AVX A;  4ZHB A;  4O2B E;  3UI2 A;  3VTY A;  5JDQ A;  4BA9 A;  3ZT5 A;  3RJV A;  3D9O A;  3FU3 A;  5CHE E;  1DCQ A;  1A5E A;  5J2T E;  2ODU A;  4ADZ A;  4U7Y A;  4AXH A;  4F1S A;  4MRU A;  3VR9 A;  1K1B A;  1WYC A;  1SZA A;  3I4G A;  2FEZ A;  5LOZ A;  4CRW A;  3UKU G;  1KNZ A;  2FF4 A;  3ZN0 B;  5CMW A;  5LP0 A;  4LNG A;  1NWM X;  4MLP A;  2XHE B;  1IZN B;  4HFV A;  3U3W A;  1I6Z A;  3DSS A;  3RYI E;  1ELR A;  5KWD A;  4BAY B;  4X5T A;  3F31 A;  1XGW A;  4GIW A;  2WMO A;  3EHZ A;  3EI0 A;  4JEU B;  5F3J A;  4DV6 T;  3L8R A;  4JL0 A;  1IKN D;  3UQ3 A;  4FUL A;  2W00 A;  3JUI A;  3LS8 A;  2WQY A;  3AE8 A;  5ENQ D;  1INZ A;  1FEW A;  4X20 E;  3RO3 A;  3FXE B;  3V30 A;  3ZUV B;  4XEI G;  4XBF B;  2ES0 A;  3MGB A;  3NRX A;  2E2A A;  2XAJ B;  2Y3A A;  3QDN A;  4GTO A;  4ILG A;  1OWA A;  3N9L A;  1D0Z A;  4CXW A;  2HR2 A;  3MX3 A;  4GTT A;  3EHM A;  3TGO A;  5AQO B;  5KJL A;  4EZH A;  1K1A A;  3SS1 A;  4OVV A;  3HVE A;  3C4W A;  5AQS B;  2BKK B;  1YA0 A;  2XEH A;  4DR4 T;  3P8C D;  4QHO A;  4YSY A;  5D0O D;  4UV8 B;  4CQI A;  2OOE A;  5CCM A;  3ULE G;  4ILH B;  5EIL A;  5D0Q D;  3K9I A;  4A55 A;  3S7B A;  4ZI2 D;  4P1N A;  5AQT B;  2WB2 A;  3AG3 E;  3I4R B;  2XAH B;  4A63 B;  4IN3 B;  1TN8 A;  4GA0 A;  5FMN A;  1X9B A;  4N5C A;  4OK0 A;  3LK2 B;  3JC6 D;  4GYR A;  2E9X A;  3EHR A;  1Y64 B;  4H9O C;  2NYJ A;  5LP6 E;  2H7V C;  3CVX A;  1DC2 A;  4ZOL E;  4LNB A;  5IUX A;  4JI2 T;  2FI7 A;  1TN6 A;  2JQ9 A;  3QAR A;  4GZ6 A;  4F3V A;  4PFO A;  2VJ8 A;  4I6G A;  2JAB A;  2LOP A;  2NTX A;  2H3R A;  2WXP A;  5ADX L;  2V0P A;  4Q96 A;  3M3Z B;  1D9S A;  3ZMZ B;  5E75 A;  3V31 A;  5JTG A;  1Y01 A;  2JMH A;  4AP2 A;  3P4W A;  5CEC B;  3FZK B;  4OHF A;  3ASO E;  3HKE E;  4UR9 A;  1HTJ F;  3QC1 A;  3APC A;  3R7R A;  4DX5 D;  4ASK A;  2P9B A;  3P4P A;  4MAL A;  3V5S A;  2X0H A;  5E76 A;  3KBT A;  2WXJ A;  5HI7 A;  2XGS A; 
#chains in the Genus database with same CATH homology
 3ZRH A;  5JDF A;  3RRW A;  4ISS A;  2KCV A;  4E85 A;  4UXN B;  2IOL A;  5FYM A;  2X6F A;  1E8Z A;  4PK6 A;  4GU5 A;  2NP9 A;  4C0M A;  2WXQ A;  1U5P A;  4EZK A;  3IHR A;  3PEU B;  3L08 A;  3E08 A;  5JDM A;  3ONK A;  2V1D B;  3OXG A;  2UXN B;  2IFU A;  5KJM A;  4KBM B;  2JEK A;  2B1E A;  2KZ7 B;  2I1K A;  2LSJ A;  4AKI A;  3I9W A;  3ZIM A;  1JWF A;  5KX5 E;  2QFC A;  2V8S E;  2UXX B;  2L0I A;  1IHG A;  2PM7 A;  5JDG A;  3SBT B;  3EDV A;  3CHQ A;  3SHF A;  4WAF A;  1Y8M A;  4GZ5 A;  4EBA A;  3EDT B;  5JJT A;  2IJG X;  5KJK A;  2V7L A;  3BQI A;  4UI9 C;  2XQY A;  2CG2 A;  4KMC A;  1B89 A;  2A2F X;  4HOS A;  5EZY E;  1OWP A;  5G04 J;  3RRU A;  4HOT A;  1W3B A;  5LJM A;  3PS6 A;  4C90 A;  1MNE A;  1B7T A;  3C51 A;  3B7T A;  3O4X E;  4H63 H;  4UQY A;  3HI2 A;  4JVS A;  2LSV A;  4DPR A;  1E7U A;  4DK5 A;  5JDH A;  3ESK A;  4ANU A;  3VLF A;  4BY6 A;  3VHL A;  3MV3 B;  4PJN A;  4ZS3 A;  2V7J A;  2VSX E;  4OYJ A;  1N54 A;  2MBG A;  3I3N A;  5G55 A;  3DPD A;  4WUY A;  3CVU A;  3L54 A;  3P7I A;  2CXL A;  4EBA G;  1ELK A;  3AVR A;  4A56 A;  2EHO C;  3FFL A;  5BPP A;  4I43 B;  3MYV A;  4A1S A;  4YLH A;  5HXH A;  2YNQ A;  2D2S A;  4L7T A;  4K0R A;  3AU4 A;  3RYH E;  4UI9 K;  4PUC A;  5FTP A;  2NXP A;  4WNK A;  5L2L A;  3ZYL A;  4FA6 A;  2K5B B;  3QNK A;  3FU5 A;  3IKO B;  2LSU A;  4FLH A;  5BMV E;  3ZVV A;  3CVY A;  5G04 C;  3MJX A;  4HXI A;  3ETU A;  3FHN A;  5E0O A;  4WWP A;  2E9X D;  2DWG A;  4M1P A;  3OYX A;  4ILU A;  3ETV A;  3D9I A;  3T8M A;  2PQR A;  4H9Q C;  3LCA A;  2YU2 A;  5DAB A;  3RK6 A;  3VKG A;  2VB6 A;  3GA8 A;  2KCK A;  2CWO A;  3HA4 A;  2V26 A;  5KCM A;  3PU3 A;  1Z6T A;  3FUE A;  5JVD E;  4EZL A;  1Y6I A;  2YHE A;  3RH3 A;  1WY6 A;  2ZU6 B;  4PS3 A;  3UUM A;  3O1I A;  3VKH A;  4KZ0 A;  2KWI B;  5L3C B;  4WBN E;  3MA9 A;  3RYF E;  3D3M A;  5L3B B;  3N9Q A;  4UWK A;  3ZJ1 A;  2JMK A;  2KZT A;  3CQG B;  4DLQ A;  2X68 A;  4Y6W A;  1HH8 A;  3PTR B;  2A4Z A;  3L09 A;  3AAA B;  3D9P A;  1DNP A;  3SD5 A;  2YEV C;  3N2O A;  4ANW A;  3H3A A;  3VU7 H;  4IE4 A;  3RPU A;  4ERR A;  2I9C A;  3SBS A;  4JA9 A;  5GON E;  5KJN A;  4V3I A;  2XAF B;  3CKC A;  3KFW X;  3HDX A;  5LNK A;  4NAC A;  3FUK A;  4JXT A;  5FJY A;  2HM8 A;  3G2S A;  5EK3 A;  1KLX A;  1UX4 A;  3KVB A;  2V7K A;  5JH7 E;  1U3D A;  4WNG A;  3SWH A;  4YJ3 E;  4NQ0 A;  4DI4 A;  3FTU A;  4JW1 A;  2RG8 A;  2J07 A;  2A3D A;  2N2N A;  2BDE A;  3BQL A;  4AKL A;  3DP7 A;  3N2G E;  4K03 A;  3PUG A;  2W0G A;  3IF8 B;  5DQW A;  5H6Q B;  4BWR A;  2M67 A;  3SRZ A;  3AS4 A;  2JQQ A;  1PY1 A;  3ZMS B;  1TJF A;  4GYO A;  4U04 A;  4H9P C;  4I9E A;  2LNI A;  2KT9 A;  4H7X A;  4L2Y A;  3PE3 A;  1LVK A;  4HOR A;  1ZHC A;  5ARF A;  1H2V C;  3B7U X;  2J4B A;  4MLK A;  3VLE A;  4AQF C;  4WWO A;  1YKH B;  3AAE B;  3WAJ A;  5LFA A;  4ZI3 D;  3U3I A;  4FHK A;  3FEX A;  2WMN A;  4CGW A;  5A23 A;  3L22 A;  4GOU A;  2CM0 A;  3ZFW A;  1OXZ A;  5JDN A;  3I0O A;  2OND A;  2J09 A;  4UWF A;  3FU0 A;  4P0B A;  1E90 A;  3UT8 A;  4KYO B;  3ZLI A;  1E8X A;  2JRK A;  1WAO 1;  3MKQ A;  4U07 A;  5BW8 C;  2KIN B;  1YKE B;  4LCT A;  1MIW A;  2XAS B;  3QOU A;  4URK A;  2X9X A;  4G2A A;  2DLR A;  2E2E A;  4PFP A;  1LVF A;  2NC9 A;  2MRI A;  3K8P C;  3F57 A;  3B13 A;  4HOQ A;  4XKB A;  4EZ4 A;  4GMJ A;  5JJ7 A;  3ZCJ A;  2MHK A;  3EIQ C;  2BTD A;  2YK0 A;  1WRD A;  3CX8 B;  3L6A A;  3ZYM A;  3FBZ A;  1MQS A;  4AXP A;  2V7M A;  1KT0 A;  1UW4 B;  2XAQ B;  3Q4A B;  4HTE A;  4G25 A;  4KZC A;  5EX0 A;  1H6K A;  2C5J A;  4FU3 A;  1WLX A;  3WXX A;  3UTK A;  3CVL A;  5LX8 A;  5BUZ A;  2Q9Q B;  1KK7 A;  5CA1 E;  4FJZ A;  4GA1 A;  4YHJ A;  3OJA A;  3N2K E;  2Y48 B;  1BR2 A;  5IHY A;  4YVQ C;  3MXZ A;  1X79 A;  5JR9 A;  4WND A;  2W62 A;  3TG5 A;  5J2U E;  4E7Z A;  5TAO A;  4J8S A;  4LEU A;  4ABN A;  3HVE B;  4TV9 E;  1UCU A;  2V5F A;  3CKB A;  2X38 A;  5G05 C;  4OYK A;  4UF0 A;  3TKL B;  4N3A A;  3U9W A;  2K24 A;  3AA7 B;  3FY4 A;  3FTZ A;  3E22 E;  2OVF A;  1YW0 A;  1MMD A;  3ZMU B;  4MBQ A;  4OYS A;  1D1B A;  2NW9 A;  2LO6 A;  4J0U A;  2E9X B;  2HYZ A;  4J8D A;  5EK2 A;  5L3F B;  5LHG B;  1H7C A;  4I1A A;  2L0T B;  2Q7F A;  4KBQ A;  4O2A E;  4Y6C A;  5A6C A;  1JUQ A;  3FUJ A;  2MTQ A;  4OFZ A;  3RU0 A;  2Q9Q A;  1UJJ A;  3P1U A;  5JRE A;  4IUL A;  4TN7 B;  3N9N A;  3GZ1 A;  3FH5 A;  4PH4 B;  3L16 A;  3RRC A;  2IOS A;  2XRZ A;  4CXX A;  1QSD A;  1IJ6 A;  2PJQ A;  5BT1 A;  4D10 C;  5LXT E;  3KAE A;  3ZHE A;  4GCO A;  3SOL A;  3TL5 A;  3PUJ A;  4IE7 A;  3M65 A;  1H0A A;  2QA7 A;  5T4Y A;  3V5U A;  1ZEE A;  2E0I A;  3UUX B;  1E7V A;  2VL8 A;  2CEA A;  2X51 A;  3FH8 A;  4BTA A;  5DQV A;  4OVU A;  4DLO A;  3CQC B;  1HG2 A;  4FJO A;  4JHR A;  3FH7 A;  5L3G B;  4UI9 J;  1H2U A;  3QWP A;  2DBA A;  3C64 A;  1S35 A;  3WAK A;  4N39 A;  3QAQ A;  2OA5 A;  3UUN A;  3O1H A;  2VYI A;  3KVA A;  2VKH A;  3QWW A;  2GK9 A;  4ZS2 A;  3R7Q A;  5FXV A;  3G2V A;  4ZI2 C;  4J2C A;  4ATG A;  3QC9 A;  2Y4T A;  2XAG B;  1SHZ C;  3T8O A;  5FNV E;  3QK6 A;  4FAD A;  3G2T A;  3SGH A;  3NBX X;  2C2L A;  3ZCI A;  3PDN A;  3MJW A;  4J8E A;  3Q47 B;  5A7D B;  1NP7 A;  1OUV A;  3O48 A;  1G8X A;  3ANW B;  3O1J A;  3P2B A;  4JC8 A;  4GZD A;  3CR3 A;  2VAS A;  3PRE A;  3PU8 A;  5C8Y E;  3PUS A;  4PK4 A;  5L3E B;  2XTL A;  5FXX A;  2LOS A;  3CHP A;  1G73 A;  5JRC A;  3UUX A;  4IE6 A;  4ME2 A;  5FXW A;  2X9W A;  3L3P A;  4DBQ A;  2UY1 B;  2L3L A;  2I59 A;  3BQK A;  3MCX A;  3Q5X A;  3APD A;  3J9X 1;  3CQX C;  4BT8 A;  3FDH A;  3KV9 A;  4TUY E;  2SPC A;  4PS8 A;  4BJM A;  4WW0 A;  4YJ2 E;  3C4Z A;  4UWL A;  4O4H E;  3UMV A;  3MZK B;  2WXF A;  2WXO A;  3NF1 A;  4UWH A;  3RC3 A;  3S2A A;  4UQZ A;  1T98 A;  3APF A;  3FTX A;  4XKC A;  3E0Z A;  3AA6 B;  3JQ1 A;  3QKY A;  2PG8 A;  2ZM8 A;  3KV6 A;  3ZYQ A;  3ANW A;  1IYG A;  4GCN A;  3LVR E;  1UN9 A;  3CKD A;  2X0L B;  5FZQ A;  3LJ3 A;  3I0Q A;  2IQC A;  2RD0 A;  4GML A;  4HGA A;  3I9Y A;  2UWJ G;  3MKD A;  4IYP A;  4IDZ A;  2UY1 A;  2CE7 A;  2J9Q A;  5H6R B;  3ZEF A;  2Q9Q D;  4HE8 A;  4B89 A;  4HFG A;  3MK7 C;  1HG5 A;  4TRQ A;  3MEK A;  3RKO A;  3EVY A;  3CEQ A;  3B57 A;  3PUK A;  4XIF A;  2LSK A;  3KV5 A;  5C2Y A;  2K48 A;  1EZ3 A;  3Q2M A;  3RYC E;  4AI6 A;  2WQ7 A;  1SQM A;  4IIJ E;  5LBQ B;  5FZR A;  4QXC B;  2WPV A;  5LGT B;  4N2S A;  4H9S E;  4PDX A;  2AXU A;  5FQ6 A;  4GB9 A;  3PH0 C;  1UG3 A;  4ILI A;  2C0L A;  4PK5 A;  3D9J A;  4ACK A;  5AJL A;  3ZJ2 A;  2R5S A;  2I2O A;  2JPF A;  3LEW A;  5ARG A;  4G26 A;  4PW8 A;  1VDY A;  2AW6 A;  5DBK A;  4E7S A;  4ANJ A;  5JHB A;  4XI0 A;  2AWI A;  3JCK C;  5LHI B;  4I1M A;  2PZI A;  3GW4 A;  3NZQ A;  5FQ4 A;  2KZT B;  3MV2 B;  4CEM A;  1L5J A;  1QUU A;  5HXR A;  5T3R A;  5M72 A;  3UUL A;  3MZL B;  1ZBP A;  2DIW A;  5J1G A;  5FQ7 A;  2XUE A;  2HO1 A;  2YHC A;  5LA6 E;  2QGS A;  3I1A A;  4N78 D;  3F2E A;  4UEM A;  4Q94 A;  4IGU A;  3MAC A;  2CMR A;  2Y4U A;  3CHS A;  2E9X C;  1NAF A;  3OYZ A;  3CK8 A;  5CCL A;  1JPL A;  2WXM A;  3S7F A;  4JEH A;  4KUM B;  2MOW A;  3K3N A;  2OVB A;  4NRH B;  3PUA A;  2CXD A;  3ZPJ A;  1E8W A;  2KCL A;  2PM6 A;  2VKO A;  3KDS E;  3FUH A;  5JDL A;  4EXT A;  3GWH A;  2X3M A;  2Y8D A;  5FQ8 A;  3RKV A;  4KP3 C;  2VSO E;  3O4Z A;  1NA0 A;  4WWN A;  3NZU A;  3EUH A;  3NZP A;  2NSZ A;  5FY0 A;  4GA2 A;  4APF A;  5CA0 E;  3DBS A;  4EQF A;  3SNX A;  3GN5 A;  4H9R C;  3ZPO A;  3ONL A;  4BT9 A;  3HKD E;  4CCA A;  3AAI A;  3UT5 E;  2J4D A;  4X1I E;  3T5X A;  4EIW A;  4UVC B;  4W9R A;  4G2V A;  4TX5 A;  3PEV B;  4WNE A;  4HLE A;  4AY6 A;  3ZN1 B;  2IF4 A;  1EYH A;  3OKQ A;  3PNL B;  2L9B A;  5FY7 A;  1OWL A;  4BTB A;  2AXZ A;  4RG9 A;  2P58 C;  5CB4 E;  4H9N C;  4FP7 A;  3OXF A;  5EX3 A;  4UIG A;  4RG6 A;  3SZ7 A;  4GYY A;  4UQX A;  3MKR A;  2VGX A;  3AVS A;  1IQU A;  3ML8 A;  2VQ2 A;  5KMG P;  3BEE A;  3QWV A;  2C5I T;  3MKQ B;  2GGF A;  2CHW A;  4GK0 E;  2X6J A;  2ZM0 A;  4UEL A;  2FBN A;  3BK9 A;  4F53 A;  3AA1 B;  4DMW A;  3HIZ A;  3U66 A;  4HOU A;  3LY7 A;  4G23 A;  3PVL A;  3FEY A;  1AJ3 A;  3PE0 A;  3R6N A;  1D0Y A;  4H7Y A;  2L9Q A;  2XPY A;  5FT9 A;  1NA3 A;  4EYU A;  2PFV A;  5FZS A;  5LCW C;  3Q5M A;  4I50 E;  3FTY A;  1NZN A;  3LPZ A;  2LSY A;  4PJL A;  5LHH B;  4MS6 A;  3Q5W A;  3CLJ A;  2VTB A;  4TV3 A;  1MND A;  3CK7 A;  2A72 A;  2N1G A;  4U72 A;  1E8Y A;  1Z3X A;  3ULQ A;  2ILR A;  4EZJ A;  4I55 E;  3CSF A;  4RSY A;  2GW1 A;  3FTV A;  4N3B A;  2J1D G;  3PZD A;  4U0U A;  4QXB B;  3Q49 B;  3TG4 A;  2X67 A;  1MHQ A;  3FTW A;  1IJ5 A;  2D0T A;  3U64 A;  2J08 A;  4ZI3 C;  4BJN A;  5LGU B;  5BNW A;  5G05 J;  5JR9 B;  2HPJ A;  3TJP A;  4GZC A;  4L0R A;  3K3Q C;  3N9P A;  3HKB E;  3S7J A;  5FY1 A;  5JJ6 A;  1TJC A;  1GW6 A;  1LRZ A;  1UN8 A;  1BPO A;  1U3C A;  4CT0 A;  3CHM A;  4UF0 B;  2J49 A;  3FHE A;  2XPZ A;  3IBE A;  5HAX A;  4KVO A;  4AKG A;  2NWB A;  3ONX A;  4O6F A;  2XGO A;  2IAK A;  2X9H A;  3C50 A;  3R9A B;  2XCC A;  3J7Y q;  2XQ0 A;  3PNT B;  3HL6 A;  3N71 A;  1HU3 A;  3LY9 A;  2LT3 A;  2YQ8 A;  4CXY A;  3FUL A;  5HYA A;  5AJD A;  4KMO A;  4MHC A;  2VSN A;  4K0U A;  1SA0 E;  2BUG A;  5HXE A;  3QUJ A;  4IST A;  4GYW A;  3GZ2 A;  3HKC E;  4DVD A;  4A3V A;  4GK5 E;  2WXL A;  2VKJ A;  3CK9 A;  4AOF A;  4DMV A;  3VLD A;  4NUR A;  4YFS A;  2IC6 A;  1ELW A;  4IRU A;  4PS7 A;  3I5P A;  4I2Z A;  4B94 A;  3HYM B;  3CX6 B;  3CVQ A;  3S4U A;  3ZHE B;  3BG0 B;  5JQG E;  2KM4 A;  5AFU L;  3ZMV B;  4LUN U;  4G24 A;  3SFZ A;  3CV0 A;  1N52 A;  4U8H A;  3QJZ A;  4EEC A;  1H2T C;  5C1D A;  3DTO A;  5J90 A;  3D9L A;  1HE8 A;  3FWV A;  3BG1 B;  3RX6 A;  2V7I A;  1DVP A;  3FUI A;  1KT1 A;  1E96 B;  4U0Z A;  3H37 A;  3IV0 A;  1BR4 A;  3LBX A;  2ZLY A;  3AS5 A;  3A5X A;  1LKX A;  4AM9 A;  4ACL A;  2EHO A;  3IHV A;  4DND A;  2ZMA A;  3OTN A;  3N9M A;  1YD8 G;  5LG4 A;  3ESL A;  1ZV4 X;  4CT4 A;  2KAT A;  3HR0 A;  3FB2 A;  5KDM C;  3AU5 A;  2NOX A;  4IE5 A;  3G2U A;  2AVP A;  4KXK B;  3T5V A;  5LJN A;  2LSI A;  4J8F A;  1VOM A;  3B7R L;  3QK0 A;  3W15 B;  3U78 A;  3C98 A;  2WM9 A;  4APO A;  3N5L A;  3SF4 A;  3FBL A;  2WQ6 A;  4O8S A;  5EKQ D;  5HWX A;  3E4B A;  5JRC B;  3CPZ A;  2VGY A;  2LJL A;  3CHO A;  4BFR A;  4CDR A;  2LM9 A;  4CZZ B;  5ANR A;  4EPZ A;  3L13 A;  2W63 A;  2XCB A;  4I6J A;  2LAH A;  4O4J E;  4F6R C;  2GRL A;  1US7 B;  3FUF A;  5HWY A;  2DNX A;  3TAX A;  2X66 A;  3EIJ A;  4L1B A;  4PJM A;  1H19 A;  2VKD A;  3PUQ A;  1JWG A;  3CX7 B;  4B8C B;  3CVW A;  2RA1 A;  2XHE A;  4AV7 A;  4FI5 A;  1WR6 A;  3DJB A;  3IEG A;  2MOZ A;  1S0P A;  4C9B B;  4JEU A;  3JC6 C;  2VWA A;  4P29 A;  4TUU A;  3UX4 A;  4NUV A;  3LK4 2;  4AKR B;  4XX5 A;  3TXN A;  1HFA A;  4XI9 A;  4XZ4 A;  4NUU A;  4PAG A;  4GAA A;  4BX9 A;  1FCH A;  1OWM A;  3JYS A;  3LFM A;  4WBO A;  3PRZ A;  3EDU A;  3CVV A;  3NQP A;  1Z0P A;  5AIJ A;  3ZEF B;  2R59 A;  3ENE A;  2PQN A;  1HO8 A;  2KND A;  4XAX B;  2CG3 A;  4JHK A;  4P0A A;  4HKA A;  2QY7 A;  4AEZ C;  3FU6 A;  1UJK A;  1HF8 A;  4CI2 B;  3Q9D A;  2IC9 A;  4N2Q A;  2FUL A;  3NRY A;  4G11 A;  5AEN A;  4QWN B;  4PJJ A;  3NZS A;  1TEZ A;  5JHA A;  3PE4 A;  4MFR A;  1WYB A;  5EDS A;  2KLQ A;  3CWZ B;  1A17 A;  3HHM A;  3IBP A;  3CIA A;  3LVQ E;  4JHJ A;  3ZYK A;  2CFU A;  2BVM A;  3Q15 A;  3CML A;  3ML9 A;  3KS2 A;  2C5K T;  2H7O A;  3CHR A;  3ASG A;  1ZKE A;  3OXL A;  4CGV A;  1BR0 A;  4R7L A;  2PBI A;  5JR9 C;  2LEH A;  4AY5 A;  2DCP A;  1EPU A;  2PL2 A;  3ZGQ A;  4IE0 A;  2C0M A;  3D9N A;  1S94 A;  3ZC1 A;  2WXR A;  5HQ8 A;  3AS8 A;  5HXS A;  4B0Z A;  4QFV A;  3LY8 A;  1EDU A;  1IAP A;  5A1L A;  4BSX A;  5DJQ C;  4CI3 B;  2M63 A;  3LXU X;  4J6I A;  4HN9 A;  2LAI A;  2IU1 A;  3VTX A;  3IEE A;  3LYA A;  1PAQ A;  1D0X A;  2AXV A;  2YU1 A;  4U0S A;  2EHO D;  5ENN A;  4ANX A;  3LG7 A;  1SZ9 A;  2ZM2 A;  4AQF A;  3ZC0 A;  4QX8 B;  4CI1 B;  1HXI A;  3B7S A;  4U63 A;  3KIN B;  5LYJ E;  1O3X A;  2DCF A;  3C4X A;  5ANL A;  5BV0 A;  4LER A;  4JEH B;  2CLY B;  1Z3Y A;  3KD7 A;  2Q9Q C;  4Z8X A;  5FXZ A;  4I1O B;  2JJ9 A;  4AKH A;  5T8I A;  1MIV A;  2ODV A;  5EK4 A;  1MIY A;  4GPK A;  4EB6 E;  5LCY A;  2NW8 A;  4FC8 A;  3ZMT B;  5ETW A;  5CMY A;  3RRN B;  3LK3 B;  2KWH A;  1MMA A;  4JUY A;  5M4Y A;  2WBL A;  2BF0 X;  4EOZ B;  2NTY A;  3GMI A;  3LDZ A;  4DI3 A;  3EJN A;  4CDM A;  3FXD B;  5G2N A;  3GN5 B;  4A1G A;  2X6H A;  2RP4 A;  1X5B A;  2L6J A;  4L23 A;  3RIB A;  4I2W A;  1QNF A;  4TZ4 C;  4TV8 E;  5IYZ E;  4EAH A;  2HH7 A;  4I9C A;  1FVH A;  2KXP B;  2WXI A;  2C0S A;  3CST A;  1FIO A;  2GRM A;  5J08 A;  2FO7 A;  3G2W A;  2VGX B;  2LE8 A;  4L9I A;  4QX7 B;  4I6E A;  2CA5 A;  2KC7 A;  3UPV A;  4XE0 A;  3CGH A;  4I43 A;  5L3D B;  1HS6 A;  2X9Y A;  4JLE A;  5LGN B;  3PDY A;  4FLB A;  4F7A A;  3EHN A;  1VRB A;  3UFE A;  4A3T A;  5LCW J;  4L5G A;  4ZHQ E;  1CUN A;  5FP3 A;  4O4L E;  1QQE A;  1D1C A;  2DHR A;  2XEV A;  2CCQ A;  2WSS V;  4G63 A;  2ACX A;  3GZS A;  2YIN A;  2X6K A;  2D0U A;  4LRZ A;  4B8A A;  3PUR A;  3RRM B;  1U4Q A;  4FJY A;  2CWY A;  2MYS A;  1HZ4 A;  1LF8 A;  2VTB B;  2XRY A;  1FMV A;  1EF1 C;  1XNF A;  2VSY A;  1OWN A;  4AQG A;  2LHN A;  4ZI7 E;  1P5Q A;  2IW5 B;  3ZXS A;  2CHZ A;  2WVI A;  3CVP A;  4X1Y E;  3FP3 A;  2VK9 A;  2WXN A;  3TXM A;  4FHJ A;  2KMF A;  1MMG A;  2DI4 A;  4HVB A;  3OAW A;  3UT4 A;  3SI5 A;  2R17 C;  2Y6X A;  4HEA A;  3LKU A;  3ASH A;  5BV1 A;  1HX8 A;  4YND A;  4H63 V;  4Q69 A;  5AYW D;  4X1K E;  3FUD A;  3RO2 A;  2WXG A;  2NW7 A;  2V4L A;  1V9D A;  1OWO A;  3IHY A;  2WXH A;  3N9O A;  5DIZ A;  2L8K A;  4I4T E;  2ION A;  1FMW A;  4O4I E;  3RC8 A;  4GZ3 A;  4BX8 A;  2X6I A;  3K3O A;  3ZN3 A;  1PC2 A;  1E1H B;  2A5U A;  4UVA B;  4CDN A;  5HXC A;  2BVL A;  4QKN A;  4I17 A;  3FUN A;  3QB2 A;  4HS2 A;  3R84 B;  4QXH B;  3AB3 B;  1UX5 A;  2XGM A;  4UWG A;  4B6X A;  3MA5 A;  3CVN A;  2D5U A;  3FTS A;  3UT7 A;  2Z6E A;  1ZU2 A;  4ANV A;  4JZY A;  4KVM A;  3S7D A;  1QZ2 A;  3KBU A;  5F8P A;  4RVB A;  4EYY R;  3ASF A;  1IQR A;  2K9A A;  4GYS A;  4C0E A;  4YVO A;  1FVF A;  2N9D A;  3KV4 A;  2DWK A;  3FUM A;  3CVR A;  2LHR A;  3L17 A;  3U4T A;  4P09 A;  2E8I A;  3O9X A;  4M3O A;  2LSG A;  4JPS A;  3URZ A;  4E6H A;  3WI3 A;  2WQH A;  2W61 A;  2OV8 A;  5FWQ A;  1HS7 A;  4N3C A;  4V1A v;  3AA0 B;  4JA7 A;  2CHX A;  2I1J A;  2CXF A;  4AJW A;  3LJC A;  4C91 A;  2G0U A;  5LBM A;  3KEZ A;  3D0T A;  3LBX B;  4WNF A;  2EHO B;  1HCI A;  2CLY C;  2XPI A;  2WAU A;  4AIF A;  4KT6 B;  4DBR A;  2WWU A;  2CFZ A;  2HPL A;  5LOV E;  3JQ0 A;  2I6H A;  3ASD A;  4DJA A;  2EQX A;  3D9K A;  1BR1 A;  2JLB A;  4IHJ E;  4U74 A;  4G1T A;  1MMN A;  2BZB A;  3ZW3 A;  2WXK A;  3C98 B;  3D9M A;  4XZC A;  1WM5 A;  4DO0 A;  4UVB B;  4PNI A;  3GYZ A;  4UV9 B;  4L2L A;  3OBV E;  1D1A A;  4MKT A;  4AVX A;  4O2B E;  3VTY A;  5JDQ A;  4BA9 A;  3RJV A;  3D9O A;  3FU3 A;  5CHE E;  5J2T E;  2ODU A;  4ADZ A;  4AXH A;  4F1S A;  4MRU A;  1WYC A;  1SZA A;  3I4G A;  2FEZ A;  5LOZ A;  4CRW A;  1KNZ A;  2FF4 A;  3ZN0 B;  5CMW A;  5LP0 A;  1NWM X;  4MLP A;  2XHE B;  1IZN B;  4HFV A;  3U3W A;  3RYI E;  1ELR A;  4BAY B;  1XGW A;  3F31 A;  4GIW A;  2WMO A;  4JEU B;  5F3J A;  4JL0 A;  3UQ3 A;  4FUL A;  2W00 A;  3JUI A;  3LS8 A;  1INZ A;  1FEW A;  4X20 E;  3RO3 A;  3FXE B;  4XBF B;  2ES0 A;  3MGB A;  3NRX A;  2XAJ B;  2Y3A A;  3QDN A;  4ILG A;  1OWA A;  3N9L A;  1D0Z A;  4CXW A;  2HR2 A;  3MX3 A;  3EHM A;  3TGO A;  5KJL A;  4EZH A;  3SS1 A;  4OVV A;  3HVE A;  3C4W A;  1YA0 A;  3P8C D;  4QHO A;  5D0O D;  4UV8 B;  4CQI A;  2OOE A;  5CCM A;  4ILH B;  5D0Q D;  3K9I A;  4A55 A;  3S7B A;  4ZI2 D;  2WB2 A;  3I4R B;  2XAH B;  4IN3 B;  4GA0 A;  5FMN A;  4N5C A;  4OK0 A;  3LK2 B;  3JC6 D;  4GYR A;  2E9X A;  1Y64 B;  4H9O C;  5LP6 E;  2H7V C;  3CVX A;  4ZOL E;  2FI7 A;  3QAR A;  4GZ6 A;  4F3V A;  4PFO A;  2VJ8 A;  4I6G A;  2LOP A;  2NTX A;  2H3R A;  2WXP A;  5ADX L;  2V0P A;  4Q96 A;  3ZMZ B;  5E75 A;  4AP2 A;  2JMH A;  4OHF A;  3HKE E;  1HTJ F;  3QC1 A;  3APC A;  3R7R A;  4ASK A;  2P9B A;  4MAL A;  3V5S A;  5E76 A;  3KBT A;  2WXJ A;  5HI7 A;  2XGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...