1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
3D9OA 3D9MA 1JWGA 1SZAA 2KM4A 4FLBA 4FU3A 5J08A 1EDUA 1UJKA 2L0TB 3ONLA 3G2VA 2DIWA 3ZYLA 2V8SE 2BF0X 3D9PA 2MOWA 2DCPA 3D9IA 3G2SA 4GZCA 1JWFA 3ZYMA 2QY7A 3D9LA 5CMWA 1JUQA 4HFGA 3G2UA 3G2WA 3ZYQA 1X5BA 1ELKA 1HG2A 3LDZA 3CLJA 1H0AA 4JXTA 1PY1A 1SZ9A 1JPLA 4AVXA 4Q96A 1HG5A 1UJJA 4NACA 3D9NA 1INZA 3G2TA 1XGWA 1HX8A 2LO6A 3D9KA 1HF8A 1MHQA 3RRUA 3D9JA 3ONKA 5CMYA 1VDYA 2L0IA 1LF8A 5LOZA 3ZYKA 5LP0A 4Q94A 1HFAA 4GZDA 1EYHA 1DVPA
chains in the Genus database with same CATH superfamily
2F37A 2DZNA 5LXTE 5ABGA 4HWCA 4I6JA 1D8DA 4F6RC 4I6GA 5CEDB 3AECA 4WAFA 2VVNA 1XNFA 2XENA 3PDNA 1BR2A 4L0RA 3VKHA 4LMLA 4J8FA 5AQAA 4LUNU 1XDOA 3NB2A 4LERA 5AQFB 4K5CA 4WUYA 2HN2A 3CHPA 3BU8A 5EYPF 3H37A 3HKEE 1OCCE 4IE7A 3RIUA 3S2AA 2UUBT 2Q9QC 2ZGDA 4PFOA 3PRZA 4U8HA 4IE0A 3Q7FA 4KT6B 5HXSA 4AQYT 3ZJ2A 5FXZA 3PEUB 1MMGA 5CHEE 5C1DA 3PNTB 2C5IT 3P4SA 2OLTA 4UI9C 3LKUA 1QLBA 4QX7B 2XRZA 4F1PA 4P1NA 4U7IA 4XI9A 5D66A 3FEYA 1O1TA 4YFSA 3AA1B 4DX5D 5FY0A 2JPFA 4O8SA 1INZA 5KCMA 5HKPA 2LSVA 2BKPA 4UWHA 4B94A 5GONE 5LGUB 5HWYA 4UXNB 3SZ7A 3MKRA 1TN6A 1IZNB 4UF0B 3CHRA 4KHPT 3CR3A 4H9NC 3PU3A 4TUYE 3ZKRA 4RVBA 4N5CA 2R6GF 4KX6A 3R7QA 3SFYA 5ENTD 3FH8A 2HR2A 4PS7A 3U3IA 5L4HA 4HFEA 5HI7A 2D5UA 4MBQA 4DR1T 1US7B 5KJMA 5KMGP 1XMOT 5L2LA 1KF6A 1YCSB 1E7UA 3FTWA 2IAKA 1QSDA 3ANWB 4AV7A 4TN7B 4G24A 1SA0E 5EK4A 5EIDA 2BS2A 5JR9B 3LVQE 4TZ4C 4GK5E 1MYOA 2V5FA 4UV9B 4F8HA 3L16A 3PZ3A 3GYZA 4CN4A 3CWZB 3TLTA 4UEMA 4JW1A 4I2ZA 4L2YA 4JXTA 2VL8A 1SZ9A 4ZFHA 3CK7A 2WQYA 3G2TA 3RIFA 4GU5A 4EXTA 2X67A 1D1CA 3X2QE 5J0ZA 2VQ2A 5LP0A 3C4WA 1R8IA 3RYIE 3FB2A 4I9CA 2VQFT 2V7MA 3DPDA 4AKLA 2SPCA 4IIJE 3KVBA 2J8SD 4MFRA 2BG9A 3CIAA 2WXIA 2NW7A 4DLQA 1OCOE 3HXEA 3RIBA 4GOUA 1QZ2A 3HI2A 4CXWA 4UWGA 4J8EA 3UT4A 4OYJA 3OPCA 4FC8A 3KSQA 2LO6A 2VQET 5CA0E 2LRLA 3S7DA 3UM3A 4IT4A 4I6EA 4BX8A 3DEPA 2X3MA 2XQ9A 4X65T 5LP6E 2LJLA 4HFBA 2X6KA 4GA2A 3S7FA 4HFDA 3S7JA 2A72A 5HYAA 4MHCA 1SE7A 1IQRA 4N78D 3D9IA 2Q9QB 3C4XA 5JQGE 5L3GB 3QNKA 3SWHA 3Q79A 3BQLA 3A5XA 2JABA 1E7PA 3RK6A 1KLXA 2CFUA 5H6RB 5ETWA 1J5ET 4J8SA 5FJYA 1IYGA 3EDVA 3FFLA 1MHQA 1H2UA 4QH4A 3KVAA 1EPUA 4LG6A 3HIZA 2PTFA 2C0LA 2R5SA 3FZMB 3QAQA 3UU5A 3VLFA 3AE3A 3BG0B 3CHSA 3NOGD 1T72A 5AQPB 1U5PA 4KMOA 1UX5A 3FU5A 4HOUA 1H0AA 2Z6EA 3B7RL 4FJZA 4UQZA 4HOSA 5CRVA 4HLLA 2HN1A 5EIBE 1H7CA 3WAKA 1U3DA 1JCSA 3AEFA 3MYVA 3BQIA 1U3CA 4ANUA 1FEWA 5KJNA 3KSLA 4BT8A 4PJJA 1KT0A 4HKAA 5HQ8A 3ZIMA 4GMRA 2Y8DA 3PVLA 3JAFA 2PM6A 2K5BB 3ISMC 3N9LA 5HEHA 4TX5A 4ZI2C 2MRIA 4YVOA 2HE0A 4C91A 4AKRB 2RFMA 4ANXA 3QJZA 3FUJA 5F8PA 3CVQA 5BXUA 3Q4AB 5LCYA 5B1AE 3HYMB 5E75A 1LVKA 2CHZA 5G05C 1YKHB 5EK2A 3DSVA 4ATZD 1WLXA 3V2XA 4IHJE 1CUNA 4TWFA 3IHVA 4DI3A 3DSTA 3DRAA 1E1HB 2WB2A 2LLYA 2IIUA 5HXRA 4OX9T 4DMWA 4YSYA 2UXDT 3W15B 4RG9A 3TWRA 2NR4A 4AXPA 3AS4A 3HVEA 5KJLA 3RH3A 2XHEA 2AXDS 3UUXA 2VKJA 4N2QA 4O4IE 1W09A 3T1HT 4CCAA 4BETA 5EYLA 2ZM6T 2XASB 3QB2A 1Q2ZA 5J2TE 3ZEFB 3CHQA 3ULQA 2A2FX 3CKBA 5FIOA 3ZC1A 3FUIA 3CK9A 2V7IA 5LOVE 3ULEG 4ERRA 4I43B 2WB5A 1OWMA 5FQ6A 5KNHD 2MTQA 3EHZA 3KBTA 3D9HA 1WCRA 2H89A 3N9MA 2XS1A 2VGXB 3K8PC 2PQRA 3AU5A 3IBEA 4YSXA 3TG5A 4ZI3C 5ABHA 5BT1A 3QOUA 4TNWA 2DBAA 5FYMA 1L5JA 2KBXA 4UVCB 3TLSA 1UK5A 4HB5A 4A55A 4TXRA 3TJPA 4HOQA 3L17A 2E2EA 3PURA 5IWAT 2V6XA 4AKHA 5CEAA 3UULA 3JXIA 4J0UA 3K1SA 4E85A 4HFIA 4QXBB 4PS8A 2CM0A 3HXDA 1E96B 5FT9A 2C0MA 3CX7B 5L3FB 3L3PA 2HM8A 4JB8P 1X79A 1G8XA 4APOA 1UUSA 5FZQA 4TRQA 1TEZA 4O4HE 2W67A 2HYZA 4I1OB 4AM9A 4G11A 3RKVA 4HVBA 2Q9QD 3RAUA 1PAQA 3I3NA 5AQGB 3VR8A 4LF8T 5BNWA 4UQYA 5JH7E 3X1DA 3RSEG 2E5VA 3BUAA 5AQTB 2LSUA 2CCQA 1E8XA 4WWOA 2X9YA 2KSRA 4MBGA 4L23A 5AAOA 4LMJA 4FADA 2B76A 2BS3A 4L9IA 4MKTA 5B3SE 3SNXA 3RYFE 1FT1A 3ABME 3J5PA 3K3QC 4DV0T 3TG4A 2GRNB 5D0OD 4BA9A 4TNVA 4B8CB 4U95D 4LF4T 2WDVA 3MV3B 2E5LT 2MOWA 5F3JA 1MMNA 4UELA 2RPAA 3G2WA 3P1UA 1LVFA 2PM7A 1IXVA 4NQ0A 4U0SA 3PS6A 3NWIA 2OVFA 4LCTA 2BS4A 1IBMT 2FJBA 1DU2A 4DI4A 4CZZB 4E7ZA 3NAWA 2XEHA 2BVLA 2CBIA 1IJ6A 2ZU6B 2VSXE 2AXVA 4KBQA 3AA7B 2MHKA 3T8MA 3C5RA 3MK7C 1Z0PA 4YNDA 4IE4A 3PUSA 2V1DB 2NYJA 3PZDA 3ZXSA 4CI3B 1OEDB 2DCPA 4PS3A 4KP3C 1QBQA 3ENEA 5JRCB 5ANRA 4B8AA 2XQ6A 2EQXA 4WWNA 1BLXB 2WCAA 4H9OC 3ZSTA 5JR9A 2WXQA 1WYCA 5L47A 3WI3A 1UN9A 3TXNA 4JHKA 1OEDA 4J6IA 4KBMB 3GMIA 3P4PA 3ZMZB 2RD0A 1UX4A 5JDQA 3D0TA 1U2VG 1KPSB 1KZOA 1JUQA 3UIPC 2PFVA 2R59A 3RC3A 3Q5WA 3F2EA 3HR0A 5HEUA 3CHOA 1A17A 1SW6A 4JHRA 3LJ3A 3RRUA 4YDYA 3NBXX 1VOMA 3FUDA 3ZT6A 3SI5A 4PK5A 2YHCA 3SOLA 4J8YA 2VYIA 4I17A 2BUGA 2W2UA 2XJ7A 4MLKA 1BI7B 2VSOE 1DVPA 5KXJA 3Q73A 3SY2A 1SHZC 4KHZF 4JI2T 2J4BA 2P9BA 3FU0A 2VASA 5C2TA 4GTPA 3NRYA 4AQFC 4K5AB 3RKGA 4CGVA 3ZC0A 2EILE 5LHGB 2HH7A 3Q5DA 3C3OA 4QWNB 3UQ4A 3AG3E 4EEBA 3FTYA 3ZPOA 2GRLA 1NFIE 4GAAA 2YNQA 3EU9A 3TWSA 5L3EB 2WZIA 3IKOB 3BG1B 2I0MA 2EHOC 3V30A 2RFAA 4Y6WA 4GTOA 4LNUD 4EEDA 3HL6A 3NBNB 5FXWA 3LYAA 5FY1A 1RW2A 2LOPA 3EDUA 1T7SA 5LG3A 3Q9UC 3MV2B 4JA9A 2XQ3A 4ZS2A 5KBAA 2IQCA 2Y3AA 3L22A 4U8YD 3EHNA 4U7YA 5AQNB 3JC6C 4Z8XA 4U96D 5EILA 4HWFA 4IL9A 4ILIA 3AS5A 4KVMA 1TNYA 4EYUA 2WXGA 3KD7A 4JHJA 4P29A 4GYOA 2KWHA 2XZTG 2ZM0A 5JR9C 5AQOB 2EIKE 1KNPA 1HU3A 1UCUA 2CHOA 4ZI3D 1WM5A 4O4JE 4FHKA 5FNVE 4KZCA 2B6CA 3MA5A 4PJLA 1KK7A 4YT0A 3AE9A 2XQAA 4GIWA 4P0BA 4EBAA 1N0RA 3NKZA 4EECA 3IEGA 4NURA 4GTSA 5ARGA 2LKGA 5CCLA 3UUBA 4G8KA 4GZDA 1KFYA 4JA7A 5JJ7A 2I6HA 4YJ2E 2EINE 5CBOA 3AEAA 3B13A 2IF4A 2GW1A 2WWVA 2ACZA 3ASGA 3D9NA 4GTTA 3L9TA 3B7BA 3O4XE 4HXIA 4IE6A 2L6JA 3LY8A 1TJCA 3TWQA 2B1EA 2W0GA 3QB5K 3JQ0A 4ANVA 1IJ5A 5AQQB 3A8YC 1MMDA 4B6XA 1EYHA 5HEJA 1K8KG 3EVYA 5AQBA 3AE1A 2BG9B 4XIFA 1NZNA 2A5EA 4HRLA 3CX6B 1OCRE 1U4QA 3PUQA 3PUXF 2HPJA 4IDOA 1MNDA 5AQIB 2VGYA 4DBRA 3HDXA 2FJAA 4NUVA 3BEEA 2AW6A 4N3CA 5FZSA 4DRXE 2WDQA 4DR6T 4DVDA 4DX2A 3ZYKA 5D0QD 2GRMA 4GK0E 2P58C 4DR4T 2WXFA 2JRKA 5EX3A 3ABLE 5CGMA 5LGTB 1WR6A 4ACKA 1NP7A 2IFUA 2ETBA 2EHOB 4JI0T 1OUVA 2CLYB 1ELKA 3TLVA 3D3MA 1VRBA 4WNKA 5D2MC 1MQSA 5BV1A 1XGWA 4WWPA 3M65A 4YY3T 3FY4A 4J8DA 1S0PA 3MACA 4MRUA 4LFCT 2WXLA 1SUMB 2VKHA 2XRYA 4DV5T 3PNLB 4N5QA 5AJLA 3W9FA 1SZAA 1QYMA 4GA0A 4H7YA 2QYJA 2RG8A 2BG9E 1WG0A 3AG4E 3B7UX 2H7OA 5A6CA 4K03A 3CLJA 5BPPA 2EHOA 5IY5E 3ZHEB 4NACA 2XPKA 1XWMA 3Q49B 4XE0A 4ADZA 4PJNA 5AQMB 3FXEB 3PDYA 4ZXLA 3RRWA 5FL0A 5AN8A 3FH7A 1JNRA 4CN1A 3UTMA 3FTZA 1K1BA 1RZ4A 3UM0A 3CVLA 5J08A 3DPYA 2DHRA 2AXZA 4KZ0A 4HWDA 1IQUA 3T9KA 5LYJE 3ZT7A 4JUYA 3JUIA 1UN8A 3DSSA 3RJVA 4YDEA 2LKHA 2AJAA 4GYSA 3FUKA 2J9QA 3PE4A 3ABVA 2DVWA 3NQPA 3BQOA 2ZISA 1IHGA 5G04C 2IMLA 1N4SA 4JI6T 3NZUA 4PUCA 1V55E 4DO0A 3RYHE 1H19A 1MIYA 2MBGA 2E9XA 3CVVA 4H7XA 4DUIA 2IUBA 5CMWA 1N36T 4YTMA 2JQHA 4H63H 5AYWD 3MZLB 4JC8A 4UI9K 3AE4A 2HO1A 4MALA 1ZBPA 1NA0A 1FMVA 3RGLA 3V31A 4O4LE 5LJNA 5ABEA 2WXNA 5IHYA 2BBHA 4KVOA 2JJ9A 4K5BA 2XS8A 3BK9A 5HCMA 1S35A 3J5QB 4OAUC 4CEMA 2LHRA 2XSAA 4U0ZA 3MKQA 2Q7FA 2CG3A 3FUFA 3ML8A 2W00A 4EZJA 3N9OA 3V5SA 3ML9A 1N4PA 4GMLA 3RU0A 2UXNB 4XKCA 2N9DA 1OXZA 2KWIB 5G04J 4I1AA 2Y4TA 4TWHA 3MKDA 2LXLA 4QXHB 5H6QB 5FL1A 2P9IG 3AVRA 4PK6A 2VGEA 1PC2A 1LKXA 5FMNA 3L54A 3U4TA 3ZMVB 3CSTA 3PZ1A 4GTRA 1PY1A 1SA4A 5KX5E 4TXPA 2CMRA 3UT5E 5LX8A 1T8BA 1N9AA 3FTSA 3UT8A 3VTYA 3VLDA 3MX3A 2D0UA 3S7BA 1Z5SC 4LF9T 2N1GA 3UKRG 5AARA 2JQ9A 2IC6A 4I55E 1YQ4A 2WBLA 2QY7A 3C64A 3IXEA 3SF4A 3C51A 4PNIA 3VRAA 5EZYE 5HWXA 1OY3D 2I1KA 3CVPA 3WXXA 2GGFA 3S4UA 4DV2T 4JI7T 4B3MT 2H6HA 2M67A 3O48A 2W63A 2IO3C 2AXUA 5DBKA 2WXMA 3IBPA 4FJOA 4FP7A 3I4GA 3M3ZB 3KS2A 4XI0A 4KI0F 3ZW3A 2VSYA 3FWVA 2WMOA 4TUUA 2QYUA 3PREA 3IF8B 4OFZA 3OXLA 3TAXA 4DR7T 2X6JA 4X1YE 1WR0A 4CXXA 3AA6B 1W0BA 4U7EB 2CE7A 2XEVA 4UIGA 1M7KA 1LRZA 1NA3A 2IC9A 3AA0B 2H6GA 3V79K 5LMNT 3UIOC 2V7KA 3HXCA 4UVAB 4HBDA 3CK8A 1N0QA 5KJKA 1N95A 4TXQA 2NTYA 1Y6IA 3BQKA 3I0QA 5IYZE 4U2ZA 3OYZA 5F5WA 2XAJB 3PUAA 2DLRA 1FPPA 5BXOA 3C98B 4HN9A 5J90A 2C0SA 3PTRB 3RLFF 3Q78A 3TWWA 2WM9A 5M4YA 3AEDA 4FJYA 5FQ8A 4DNDA 2GRPB 5LG4A 3UU3A 2IOLA 1IBKT 2W66A 3TWTA 3CK6A 4I4TE 3SBTB 4DJAA 2WQHA 4EZHA 4Z90A 3CQCB 3O1IA 2UU9T 1SA5A 4XEIG 3ZYLA 3CQXC 4H9QC 2Y1LE 2I2OA 4X5TA 3AEGA 3AXJB 5HAXA 5EKQD 4UV8B 5CRUA 5AENA 3LJNA 4GYRA 3B5MA 2ILRA 4P09A 2K24A 1LF8A 4ME2A 3FULA 4A98A 2YDQA 3RRCA 4ABNA 5E0OA 2WXKA 2LAIA 3N9NA 5AQVB 5JJ6A 1Z8UA 2R05A 2WS3A 1D0YA 2LSGA 2VURA 1FVFA 5L4EA 4YDWA 3ZYQA 3F6QA 4QFVA 1YW0A 3CVWA 3NOCD 2Y0BG 5FINA 2WSSV 2YU1A 5CA1E 4QQIA 1UOHA 2ONDA 3OJAA 4M7CA 4BSXA 3ZN0B 2RP4A 3JCKC 2KMFA 1TNBA 3UQ3A 1H6KA 5AJDA 3RHWA 2OEWA 5C3JA 5FXXA 3FU3A 4LMKA 2UUAT 5FQ7A 2V6YA 3TKLB 3P8CD 3FEXA 3SFXA 4EBAG 4ZHBA 3EIQC 2HHHT 1G3NB 3EHMA 5IUXA 3UXGA 2E2AA 3DXMG 2XQ4A 2H7VC 5JDGA 4WBNE 3MGBA 1N94A 3FU6A 3FTXA 2KNDA 1E8WA 4CN6A 4LF7T 1E90A 4WNGA 1KNZA 1QNFA 3UUXB 2LRKA 1YKEB 3HKDE 4ZZCA 1HH8A 1BD8A 1QUUA 3UU8A 4K0KT 3RO3A 2X0HA 3TWXA 5CJ5A 3ASDA 2DWZA 1IBLT 3LS8A 3CHMA 5LOZA 3HXFA 4GYWA 5HXEA 3RYCE 3OBVE 3ZEFA 2ODUA 1BR0A 5AQRB 3ULYA 4L7TA 1WRDA 4IL4A 2DYSE 4FI5A 4HORA 2F8XK 3U78A 1OWOA 1MMAA 2BDEA 2YU2A 4GMJA 3D9PA 2LSYA 3QC9A 4EZ4A 2BG9C 4DLOA 3LY9A 4G8LA 2KCLA 3RO2A 3T1YT 3RF1A 2A3DA 2X0YA 1E8ZA 5FY7A 3B57A 5BR8T 4XBFB 3ONKA 4IDPA 1XZYA 5CMYA 3LEWA 4L5GA 3Q9NC 4CDRA 1D8EA 4RLYA 2C2LA 4AJWA 2QYWA 2M6IA 4MS6A 1NEKA 4FU3A 3PH0C 4CGWA 3FZKB 3J7Yq 4C48B 3UI2A 4GKKT 2UY1B 4ILCA 4IYPA 1N11A 3FZFB 4BX9A 2CLYC 1HNWT 2CEAA 4IREA 1UJJA 4LEUA 3AG2E 1D9SA 1I94T 5HEGA 4YTPA 3CX8B 4H63V 4IDQA 4CT4A 4Q25A 1HNZT 3V5UA 2DYRE 2JQKA 5AQKB 5C2YA 2MYOA 2BBJA 3CPZA 2CHWA 3EHRA 3G2VA 3JYSA 4ACLA 2LUHA 1JWFA 2WDRA 1OWPA 1XNQT 1MNEA 4E6HA 2NC9A 4IRUA 5BUZA 1G73A 1S64A 2QC9A 3LK42 5EN5D 2VSNA 5ARFA 4AVXA 1HS6A 2BZBA 4BAYB 4OHFA 2N2NA 3CVNA 4HWIB 5L3BB 5ENPD 1QQEA 5J2UE 5A7DB 5CERB 3ZMTB 3KAEA 5BMVE 2GRQB 3U66A 4UWLA 4KUMB 2KT9A 4BEPA 1TR4A 4JI5T 2BVMA 3UX4A 2WPVA 4KXKB 4D10C 3GN5A 2PNNA 3HVEB 3G06A 2KXPC 3KEAA 3FP3A 2FI7A 1DC2A 4UI9J 1HF8A 3UQ7A 3AEEA 2GK9A 2JIWA 4JPSA 3N2OA 2XGMA 3AAAB 4YJ3E 4KYOB 2DI4A 5ADXL 4B0ZA 3RQWA 1Y01A 4AEZC 5AQUB 1TJFA 4URKA 2KCVA 4RQIA 2MPKA 3WAJA 1AWCB 4A1GA 4BESA 2YQ8A 4E7SA 4DPRA 3ONLC 2Y69E 3UMVA 2KINB 2QA7A 4AY5A 2D0TA 4DX7D 4GZ6A 4JEHB 3RRMB 4OVUA 4YLHA 4BFRA 3PE3A 2HPLA 2XQ5A 3AE7A 3DTOA 4PJMA 3PUVF 5LMUT 3OXFA 5CB4E 4YTNA 4QXCB 2J1DG 4OVVA 3LPZA 3E34A 3KV5A 3EU5A 3T5VA 2UUCT 2J62A 1K1AA 3NZQA 4JL0A 2NP9A 1OCZE 4UWFA 3RIAA 4UUCA 2L9QA 4AKGA 1YMPA 3PZ4A 3V2OA 5LJMA 3SS1A 1MX4A 3QK6A 2WY2A 3I4RB 4B93B 2BKGA 4LFBT 2V5DA 3VLEA 1N34T 3UM1A 5KWDA 3H3AA 1HTJF 1M62A 2V26A 1N4QA 4F7AA 2DNXA 2W4XA 3URZA 4EB6E 2XGSA 1HFAA 5JREA 2VTBA 2YOEA 4AI6A 1ZHCA 3R84B 4BWRA 2EIJE 3VU7H 3NRXA 3ESKA 4HQDA 2G0UA 4V3IA 4Q69A 3T8OA 2GROB 2OCCE 1FIOA 3P2BA 3B95A 2WAUA 4X1KE 3HA4A 3C98A 2UY1A 4DR5T 3VKGA 1JCRA 4I43A 5T4YA 2K9AA 4AXHA 2GRRB 3ETVA 2R2LA 2VJ8A 3GW4A 1Z3XA 3UKUG 5G05J 3ZNGA 3FTVA 3ZJ1A 5JA4D 3DWLG 2FJDA 3PEVB 3EI0A 4LFAT 1SQMA 3ONLA 2QGSA 2I9CA 2XHEB 5LFAA 3TLUA 3AAEB 2QZAA 2CFZA 4G26A 2X6HA 4I9EA 4JZYA 3RRNB 1ZU2A 4M1PA 2LNIA 2X9WA 4B3TT 3C50A 3MXZA 2WWUA 5LHIB 4DV4T 5ABFB 3D9OA 4UR9A 4GTMA 3P4QA 1JWGA 4BJNA 2BEDA 3TL5A 1MX6A 2KZ7B 4G63A 3E33A 2E0IA 2OV9A 4QX8B 4EYYR 2X68A 4JI1T 1HR0T 4JLEA 2XCBA 3PUGA 3N5LA 3I1AA 4A63B 4HRNA 2V5CA 4ZOLE 3PUKA 2I1JA 2W61A 1H6OA 2VKDA 1NWMX 1BR1A 2YN6A 4HEAA 1EZ3A 4NXMT 3K9IA 5ENOD 4UF0A 1TYQG 4CDNA 3KV6A 2WXHA 3UTKA 3CKCA 5FQ4A 4O1PA 2KC7A 2LEHA 3NVOA 3AB3B 4K0UA 4ZHQE 3Q7AA 4IE5A 3JADA 4YDOA 2IONA 3LJCA 2FBWA 5LNKA 2KATA 4BERA 3L09A 1E2AA 1HG5A 1W0AA 3RKOA 3RX6A 4A3VA 4PFPA 3VHLA 4HOTA 1A5EA 2XSBA 4J2CA 5LGNB 4LNGA 3TLWA 2CXDA 5JDNA 3O1JA 2R03A 3APFA 2XZDG 4AKIA 1DNPA 2CG2A 5JMND 5ENQD 4O1OA 2KCKA 3K3OA 4ANWA 4OAVB 3CIRA 4DK5A 3MKQB 3MA9A 4V1Av 1YYHA 3P7IA 2D9DA 2X0LB 4NPPA 1TNOA 3RI5A 1ELRA 3AE8A 5G2NA 3MEKA 4XZ4A 3CV0A 5AFUL 3KBUA 1HCIA 4ZZBA 4Z68A 5JHBA 2X51A 1BPOA 5FTPA 2QVAA 4UWKA 5AQ9A 1HXIA 5E76A 2L0TB 4P0AA 2XQYA 3G2SA 1WAO1 3DSWA 2JQQA 4G1TA 3QB5A 3F31A 4U72A 3GN5B 2R02A 1H6PA 4X1IE 4JBWF 4ZS3A 5H7PA 4GA1A 3SD5A 2NTXA 3PE0A 1UGOA 2A9UA 3L82A 4ZI2D 1TNUA 3AS8A 1O3XA 1VCTA 4B89A 2UXXB 3OTOT 1GQEA 3FUHA 3ZGQA 3C3QA 4JI3T 1YXRA 4PH4B 4HTEA 2BF0X 3QARA 4IDNA 3LBXA 4DX6D 3P50A 5ENRD 2XTLA 4QHOA 2MYSA 3RPUA 3MJWA 4ZI7E 2LOSA 3AJIA 2ETAA 2F0YA 3LVRE 4EHMA 3UUMA 3APDA 2V4LA 1XDPA 3CEQA 3R9MA 4A3TA 2CWYA 2FJEA 4XZCA 3ZMSB 1TNZA 2P9SG 4C90A 4BSZB 2K3WA 4HFVA 5LBQB 4DUYT 4HFHA 3ZKJA 2AE9A 2WU5A 4ILHB 3UFEA 1OWLA 4A56A 5FZRA 3TWUA 2P9NG 3EUHA 5L3DB 5ABFA 4CT0A 2FF4A 3ZT5A 5T8IA 2D2SA 2MAWA 3ASOE 5DQVA 3L6AA 1JPLA 3UFGA 4HI8A 2ZLYA 1N33T 4I0UA 4X20E 4YXDA 3KV4A 4I50E 2WVIA 3VTXA 2F8YA 2J07A 4DUZT 3JAEA 4Q94A 3ASHA 5FVLA 1UG3A 5CCMA 3LG7A 2XUEA 5ANLA 4IN3B 4F53A 1EF1C 2IO2C 2JMHA 5HXCA 2YKSA 3HRAA 2OV8A 3UT7A 3APCA 1OWNA 2B0OE 3RQUA 3FH5A 3DEOA 2KLQA 2EHOD 3FUMA 2V7JA 1O5MA 3AXJA 1B89A 1MIVA 1HX8A 2UXBT 3LSVA 3R7RA 3I9YA 4ILAA 2A5UA 2MOZA 2VKOA 4OYSA 4JVSA 3E08A 4GKJT 5AQ7A 2OEVA 2IEJA 4GPMA 3E37A 2J47A 4PAGA 4JI8T 3D9MA 4L2LA 5HRYA 3GZ1A 5AQJB 4A97A 1Y64B 2H3RA 2WU2A 3QC1A 2YEVC 2FUPA 3GZSA 4FULA 4N39A 1N32T 1BI8B 1FJGT 3I0OA 2XQ7A 3EUVA 1WFDA 2LXMA 3JUEA 1TN8A 3MJXA 5JDMA 4MLPA 3N9PA 2XZEA 4O6FA 2CWOA 3AAIA 4N2SA 4HRMB 1L0VA 3Q47B 2YK0A 3ZN1B 2PJQA 4X62T 1H2TC 2LM9A 1MX2A 3AE2A 2XEEA 4WZXA 2Q9QA 2KM4A 1HO8A 2LM2A 3OXGA 4EZKA 2BKNA 2J4GA 1EDUA 1UJKA 5JJTA 1ZOYA 4DV7T 3U64A 4WBOA 2E9XC 2CPTA 2K48A 3KEZA 4AOFA 1NAFA 4GZ5A 4G2AA 2XM2A 4DMVA 2QFCA 3HKBE 2C5JA 2ZGGA 3ZXPA 3SQVA 3CKDA 4L1BA 2IOSA 5LA6E 5A23A 2NW9A 1JCQA 2ETCA 1W3BA 1HNXT 4OK0A 4GZ3A 1Y8MA 4J7WA 4DR3T 2XPIA 3ZU7B 3T8KA 3UINC 4CRWA 2XGOA 4GTQA 3AU4A 4HGAA 3FBLA 2P2CP 2H88A 2XY8B 3CVRA 2WXOA 4PK4A 5J1GA 4R7LA 4QH1A 3DXKG 2NOXA 4CQIA 2C5KT 1MJ0A 3KINB 4I2WA 1UW4B 3ONXA 2M63A 1E8YA 1LD8A 5ITZF 3EIJA 2XM1A 1LTXA 3ZLIA 1XMQT 1N54A 4FA6A 3ZUVB 5HCJA 4HE8A 5JDFA 2KXPB 4DIDB 1YA0A 2UWJG 2NXPA 4UQXA 4WNDA 3DBSA 4EQFA 3PUWF 4C9BB 4HI9A 2L3LA 3ZRHA 4K0RA 1E7VA 2L6BA 2YDSA 4B3RT 5FP3A 3AAAC 3FDHA 3FZLB 4EV6A 1OEDE 3CSFA 4FLBA 1D1AA 4EAHA 1UURA 1DCQA 3LDQB 2YINA 3EAMA 4W9RA 3ASNE 2KZTA 4G2VA 5DQWA 2AVPA 2X6IA 4HS2A 1DCEA 4M3OA 2WXRA 3ZCJA 3SRZA 4APFA 4BY6A 4A5XA 3Q75A 3IEEA 3L8RA 4GCNA 5HEOA 3R6NA 3L39A 3LY7A 2XAHB 1JNZA 4Y6CA 1J1JA 4FHJA 4H9SE 2PG8A 2WP9A 4JEUA 2XAQB 3O1HA 1OT8A 4LF6T 2YHEA 4LNBA 3UU4A 4PW8A 3KFWX 3P4RA 3O9XA 4LSZE 4TV3A 3LXUX 1WDYA 5DIZA 4G25A 3TGOA 5FXVA 1AP7A 3IV0A 3C3RA 4CI1B 4NRHB 4RSYA 3ZFWA 1V54E 4AQGA 4WNEA 3SGHA 4LF5T 4YHJA 2UXCT 4C0MA 4G23A 1HS7A 1ZB1A 3SBSA 3FHEA 4BTBA 3WG7E 3E30A 3PUZF 2WMNA 2X6FA 3IHRA 3KDSE 3PV0F 4HFGA 4WW0A 3FBZA 4F3VA 1HG2A 2VB6A 4B3ST 2OOEA 2WXJA 4O2BE 5JDLA 3FHNA 2BTDA 1N52A 3AG1E 2CXLA 2E9XB 4O60A 3F57A 2JLBA 4JEHA 2H6FA 1I6ZA 2FEZA 2LT3A 3CMLA 3DSUA 4X8QA 2DCFA 5JHAA 4CI2B 3N9QA 3U3WA 3PU8A 4NXNT 5BW8C 3HKCE 5AQHB 3H3MA 4TWDA 2X9HA 3NZPA 4ATGA 4ANJA 1NENA 4U0UA 4HFCA 3SFEA 3ZN3A 4C0EA 5FVKA 2CRBA 2J09A 4XX5A 3OVUA 2V7LA 5CFBA 3HHMA 1CHUA 4COFA 2LSIA 4U3CA 3N2KE 4NUUA 3TXMA 2IW5B 4JYAT 4X64T 2VK9A 1P5QA 3OTNA 3ZCIA 2VVSA 2FO7A 3QWVA 4ILGA 5AIJA 5CBNA 4U8VD 2X66A 4ISTA 1KEYA 2Y48B 3L08A 5LCWC 3B7TA 3D9JA 3PJAJ 5EX0A 3CGHA 3UU6A 3J9X1 4AIUA 4EZLA 1O1SA 2DZOA 5M72A 2V4HC 3ZHEA 3GWHA 1HE8A 4RG6A 3AE6A 3VR9A 1ZV4X 3Q9DA 4YHHT 4LRZA 1V9DA 4CDMA 4DX1A 3E0ZA 5EDSA 4H9PC 3MZKB 4HNAD 1MIWA 1VCSA 4GTVA 4CZ2D 4TV8E 1TN7A 1X81A 3K3NA 4U33A 1MZCA 5JTGA 3Q2MA 3QNUA 2V0PA 3FZHB 3IA3A 2OA5A 3ZYMA 1T98A 2XAFB 4AP2A 3E22E 3G2UA 3IHYA 2ZXWE 3Q5MA 2BKKB 2IHR1 2KZTB 4BTAA 3C4ZA 2CBJA 3D9KA 1YD8G 2FBNA 2ZIRA 2NSZA 4IULA 3JCFA 4EIWA 2WXPA 3AVSA 4AQFA 5KNGA 4XAXB 1S70B 2JEKA 2Y4UA 2X9XA 3DSXA 3QWPA 4YSZA 1X9BA 5AQLB 4ISSA 2JMKA 1KNRA 2J08A 2RKKA 2DWKA 4N3BA 4DV3T 4ILUA 5ENSD 3LK3B 5DJQC 5DABA 3C72A 3FXDB 3LK2B 5FWQA 3HXBA 4QKNA 1J5WA 2NW8A 1H2VC 2J4DA 1HX1B 3KV9A 3UM2A 1ELWA 2V8SV 1KZPA 3N2GE 5LB7B 5FKYA 3ZMUB 4DV6T 4CYMD 4ILBA 3Q15A 3QUJA 4GZCA 1S94A 3NZSA 4WNFA 2XPYA 5BV0A 3QKYA 1X5BA 3LFMA 2DWGA 4U31A 1N4RA 3JQ1A 2ZMAA 2IU1A 2IJGX 5C8YE 4U04A 3OKQA 5KDMC 2QRXA 3CVUA 2CHNA 2ZM2A 1SVXA 4GPKA 2L9BA 3MCXA 4IGUA 3JC6D 2L0IA 3AEBA 4EGWA 2WZHA 2XQ8A 4H9RC 3ETUA 2LSKA 1GW6A 3UUNA 4X66T 4GCOA 4YVQC 2M6BA 2Y6XA 3ONJA 4F1SA 4GYYA 2VGXA 5JDHA 3I9WA 2EIME 3D9LA 5T3RA 1OXJA 5HXHA 2AWIA 3E4BA 2F4VT 4AIFA 1AJ3A 2P9LG 3ANWA 3JXJA 4U63A 3N71A 4XKBA 3U9WA 5G55A 3FUNA 3Q5XA 5LHHB 3SFZA 4L9PA 2A4ZA 2VL0A 2J49A 1Z6TA 2P9UG 2WQ7A 1W9RA 4DR2T 2XPZA 1Z3YA 1IKND 5HS0A 3LCAA 4CXYA 4JD2G 2I59A 2DL1A 3W9GA 2LSJA 5AQSB 1O1RA 1WYBA 5TAOA 4O2AE 1YQ3A 2DIWA 2V8SE 2W62A 5L3CB 5JRCA 2CA5A 3FTUA 2L8KA 1XNRT 2PQNA 2NWBA 5LBMA 3UPVA 5B1BE 1K3ZD 1IAPA 3CVYA 4WYVA 3L13A 4U07A 1FVHA 3ZPJA 3QK0A 4U2YA 2WQ6A 4UVBB 5A1LA 3FUEA 5EK3A 1ZEEA 1D0XA 3I5PA 4DBQA 2VTBB 4TUMA 4A1SA 1D0ZA 1ZKEA 1D1BA 2R17C 3ABKE 4Q96A 2PL2A 2ODVA 3NF1A 2E9XD 1LD7A 3RC8A 4OYKA 2IDOB 3Q5EA 2IY0C 3GA8A 4PDXA 3R9AB 4F6RD 2FULA 3ZVVA 3SHFA 4ZEYA 2RA1A 4U74A 1BR4A 3GZ2A 3VRBA 2ZM8A 4NIQA 3P4WA 1NI1A 2X38A 2E8IA 3RIUC 3TWVA 3T5XA 4DV1T 3EDTB 2BKOA 2LE8A 3DP7A 3DJBA 3HG0D 3QOFA 4JI4T 3CQGB 3ESLA 2LHNA 3EHQA 4Z91A 4HWHA 3QWWA 2P9KG 4TV9E 3ZSSA 4JEUB 3SO8A 2P9PG 2XAGB 1HZ4A 2VWAA 1FMWA 3SFDA 4KMCA 1BU9A 2LAHA 4FLHA 2FO1E 4ASKA 2PZIA 1OWAA 3EABA 4AY6A 5LCWJ 2PBIA 1NL4A 3QDNA 5JVDE 2CXFA 4BJMA 1KT1A 1FT2A 3PUYF 3AE5A 2ES0A 2V6YB 1OEDC 1IHBA 3E32A 3ASFA 2XCCA 1WY6A 4EPZA 3A7MA 4EOZB 4JV5T 4BT9A 3B7SA 1B7TA 1FCHA 4GB9A 4HLEA 3EJNA 1S63A 2XQ0A 4NIKA 2ACXA 2H6IA 4N3AA 3LDZA 2OVBA 3PJAA 3OAWA 3LBXB 1ZP0A 2V5QC 4I1MA 4IDZA 4QH5A 5CECB 1VDYA 4AISA 5ENNA 3OYXA 3PUJA 2CHXA 3CVXA 2YDRA 3O4ZA 3PZ2A
chains in the Genus database with same CATH topology
5LXTE 4I6JA 4F6RC 4I6GA 1XNFA 3PDNA 1BR2A 4L0RA 3VKHA 4J8FA 4LUNU 4LERA 4WUYA 3CHPA 3H37A 3HKEE 4IE7A 3S2AA 2Q9QC 3PRZA 4PFOA 4U8HA 4IE0A 4KT6B 5HXSA 3ZJ2A 5FXZA 3PEUB 1MMGA 5CHEE 5C1DA 3PNTB 2C5IT 4UI9C 3LKUA 4QX7B 2XRZA 4XI9A 3FEYA 4YFSA 3AA1B 5FY0A 2JPFA 4O8SA 1INZA 5KCMA 2LSVA 4UWHA 4B94A 5GONE 5LGUB 5HWYA 4UXNB 3SZ7A 3MKRA 1IZNB 4UF0B 3CHRA 3CR3A 4H9NC 3PU3A 4TUYE 4RVBA 4N5CA 3R7QA 3FH8A 2HR2A 4PS7A 3U3IA 5HI7A 2D5UA 4MBQA 1US7B 5KJMA 5KMGP 5L2LA 1E7UA 3FTWA 2IAKA 1QSDA 3ANWB 4AV7A 4TN7B 4G24A 1SA0E 5EK4A 5JR9B 3LVQE 4TZ4C 4GK5E 2V5FA 4UV9B 3L16A 3GYZA 3CWZB 4UEMA 4I2ZA 4JW1A 4L2YA 4JXTA 2VL8A 1SZ9A 3CK7A 3G2TA 4GU5A 4EXTA 2X67A 1D1CA 2VQ2A 5LP0A 3C4WA 3RYIE 3FB2A 4I9CA 2V7MA 3DPDA 4AKLA 2SPCA 4IIJE 3KVBA 4MFRA 3CIAA 2WXIA 2NW7A 4DLQA 3RIBA 4GOUA 1QZ2A 3HI2A 4CXWA 4UWGA 4J8EA 3UT4A 4OYJA 4FC8A 2LO6A 5CA0E 3S7DA 4BX8A 4I6EA 2X3MA 5LP6E 2LJLA 2X6KA 4GA2A 3S7FA 3S7JA 2A72A 5HYAA 4MHCA 1IQRA 4N78D 3D9IA 2Q9QB 3C4XA 5JQGE 5L3GB 3QNKA 3SWHA 3BQLA 3A5XA 3RK6A 1KLXA 2CFUA 5H6RB 5ETWA 4J8SA 5FJYA 1IYGA 3EDVA 3FFLA 1MHQA 1H2UA 3KVAA 1EPUA 3HIZA 2C0LA 2R5SA 3QAQA 3VLFA 3BG0B 3CHSA 1U5PA 4KMOA 1UX5A 3FU5A 4HOUA 1H0AA 2Z6EA 3B7RL 4FJZA 4UQZA 4HOSA 1H7CA 3WAKA 1U3DA 3MYVA 3BQIA 1U3CA 4ANUA 1FEWA 5KJNA 4BT8A 4PJJA 1KT0A 4HKAA 5HQ8A 3ZIMA 2Y8DA 3PVLA 2PM6A 2K5BB 3N9LA 4TX5A 4ZI2C 2MRIA 4YVOA 4C91A 4AKRB 4ANXA 3QJZA 3FUJA 5F8PA 3CVQA 3Q4AB 5LCYA 3HYMB 5E75A 1LVKA 2CHZA 5G05C 1YKHB 5EK2A 1WLXA 4IHJE 1CUNA 3IHVA 4DI3A 1E1HB 2WB2A 5HXRA 4DMWA 3W15B 4RG9A 4AXPA 3AS4A 3HVEA 5KJLA 3RH3A 2XHEA 3UUXA 2VKJA 4N2QA 4O4IE 4CCAA 3QB2A 2XASB 5J2TE 3ZEFB 3CHQA 3ULQA 2A2FX 3CKBA 3ZC1A 3FUIA 3CK9A 2V7IA 5LOVE 4ERRA 4I43B 1OWMA 5FQ6A 2MTQA 3KBTA 3AU5A 3N9MA 2VGXB 3K8PC 2PQRA 3IBEA 3TG5A 4ZI3C 5BT1A 3QOUA 2DBAA 5FYMA 1L5JA 4UVCB 4A55A 3TJPA 4HOQA 3L17A 2E2EA 3PURA 4AKHA 3UULA 4J0UA 4E85A 4QXBB 4PS8A 2CM0A 1E96B 5FT9A 2C0MA 3CX7B 5L3FB 3L3PA 2HM8A 1X79A 1G8XA 4APOA 5FZQA 4TRQA 1TEZA 4O4HE 2HYZA 4I1OB 4AM9A 4G11A 3RKVA 4HVBA 2Q9QD 1PAQA 3I3NA 5BNWA 4UQYA 5JH7E 2LSUA 2CCQA 1E8XA 4WWOA 2X9YA 4L23A 4FADA 4L9IA 4MKTA 3SNXA 3RYFE 3K3QC 3TG4A 5D0OD 4BA9A 4B8CB 3MV3B 2MOWA 4UELA 1MMNA 5F3JA 3P1UA 3G2WA 1LVFA 2PM7A 4NQ0A 4U0SA 3PS6A 2OVFA 4LCTA 4DI4A 4CZZB 4E7ZA 2BVLA 1IJ6A 2ZU6B 2VSXE 2AXVA 4KBQA 3AA7B 2MHKA 3T8MA 3MK7C 1Z0PA 4YNDA 4IE4A 3PUSA 2V1DB 3PZDA 3ZXSA 4CI3B 4PS3A 2DCPA 4KP3C 3ENEA 5JRCB 5ANRA 4B8AA 2EQXA 4WWNA 4H9OC 5JR9A 2WXQA 1WYCA 3WI3A 1UN9A 3TXNA 4JHKA 4J6IA 4KBMB 3GMIA 2RD0A 3ZMZB 1UX4A 5JDQA 3D0TA 1JUQA 2PFVA 2R59A 3RC3A 3Q5WA 3F2EA 3HR0A 3CHOA 1A17A 4JHRA 3LJ3A 3RRUA 3NBXX 1VOMA 3FUDA 3SI5A 4PK5A 2YHCA 3SOLA 2VYIA 4I17A 2BUGA 4MLKA 2VSOE 1DVPA 1SHZC 2J4BA 2P9BA 3FU0A 2VASA 3NRYA 4AQFC 4CGVA 3ZC0A 5LHGB 2HH7A 4QWNB 3FTYA 3ZPOA 2GRLA 4GAAA 2YNQA 5L3EB 3IKOB 3BG1B 2EHOC 4Y6WA 3HL6A 5FXWA 3LYAA 5FY1A 2LOPA 3EDUA 3MV2B 4JA9A 4ZS2A 2IQCA 2Y3AA 3L22A 3EHNA 3JC6C 4Z8XA 4ILIA 3AS5A 4KVMA 4EYUA 2WXGA 3KD7A 4JHJA 4P29A 4GYOA 2KWHA 2ZM0A 5JR9C 1HU3A 1UCUA 4ZI3D 1WM5A 4O4JE 4FHKA 5FNVE 4KZCA 3MA5A 4PJLA 1KK7A 4GIWA 4P0BA 4EBAA 4EECA 3IEGA 4NURA 5ARGA 5CCLA 4GZDA 4JA7A 5JJ7A 2I6HA 4YJ2E 2IF4A 3B13A 2GW1A 3D9NA 3ASGA 4HXIA 3O4XE 4IE6A 2L6JA 3LY8A 1TJCA 2B1EA 2W0GA 3JQ0A 4ANVA 1IJ5A 1MMDA 4B6XA 1EYHA 3EVYA 4XIFA 1NZNA 3CX6B 1U4QA 3PUQA 2HPJA 1MNDA 2VGYA 4DBRA 3HDXA 4NUVA 3BEEA 2AW6A 4N3CA 5FZSA 4DVDA 3ZYKA 5D0QD 2GRMA 4GK0E 2P58C 2WXFA 2JRKA 5EX3A 5LGTB 1WR6A 4ACKA 1NP7A 2IFUA 2EHOB 1OUVA 2CLYB 1ELKA 3D3MA 1VRBA 4WNKA 5BV1A 1MQSA 1XGWA 4WWPA 3M65A 3FY4A 4J8DA 1S0PA 3MACA 4MRUA 2WXLA 2VKHA 2XRYA 5AJLA 3PNLB 1SZAA 4GA0A 4H7YA 2RG8A 3B7UX 2H7OA 5A6CA 4K03A 3CLJA 5BPPA 2EHOA 3ZHEB 4NACA 4XE0A 3Q49B 4ADZA 4PJNA 3FXEB 3PDYA 3RRWA 3FH7A 3FTZA 3CVLA 5J08A 2DHRA 2AXZA 4KZ0A 1IQUA 5LYJE 4JUYA 3JUIA 1UN8A 3RJVA 4GYSA 3FUKA 2J9QA 3PE4A 3NQPA 1IHGA 5G04C 3NZUA 4PUCA 4DO0A 3RYHE 1H19A 1MIYA 2MBGA 2E9XA 3CVVA 4H7XA 5CMWA 4H63H 5AYWD 3MZLB 4JC8A 4UI9K 2HO1A 4MALA 1ZBPA 1NA0A 1FMVA 4O4LE 5LJNA 2WXNA 5IHYA 4KVOA 2JJ9A 3BK9A 1S35A 4CEMA 2LHRA 4U0ZA 3MKQA 2Q7FA 2CG3A 3FUFA 3ML8A 2W00A 4EZJA 3N9OA 3V5SA 3ML9A 4GMLA 3RU0A 2UXNB 4XKCA 2N9DA 1OXZA 2KWIB 5G04J 4I1AA 2Y4TA 3MKDA 4QXHB 5H6QB 3AVRA 4PK6A 1PC2A 1LKXA 5FMNA 3L54A 3U4TA 3ZMVB 3CSTA 1PY1A 5KX5E 2CMRA 3UT5E 5LX8A 3FTSA 3UT8A 3VTYA 3VLDA 3MX3A 2D0UA 3S7BA 2N1GA 2IC6A 4I55E 2WBLA 2QY7A 3C64A 3SF4A 3C51A 4PNIA 5EZYE 5HWXA 2I1KA 3CVPA 3WXXA 2GGFA 3S4UA 3O48A 2M67A 2W63A 2AXUA 5DBKA 2WXMA 3IBPA 4FJOA 4FP7A 3I4GA 3KS2A 4XI0A 3ZW3A 2VSYA 3FWVA 2WMOA 4TUUA 3PREA 3IF8B 4OFZA 3OXLA 3TAXA 2X6JA 4X1YE 4CXXA 3AA6B 2CE7A 2XEVA 4UIGA 1LRZA 1NA3A 2IC9A 3AA0B 2V7KA 4UVAB 3CK8A 5KJKA 1Y6IA 2NTYA 3BQKA 3I0QA 5IYZE 3OYZA 2XAJB 3PUAA 2DLRA 3C98B 4HN9A 5J90A 2C0SA 3PTRB 2WM9A 5M4YA 4FJYA 5FQ8A 4DNDA 5LG4A 2IOLA 3SBTB 4I4TE 4DJAA 2WQHA 4EZHA 3CQCB 3O1IA 3ZYLA 3CQXC 4H9QC 2I2OA 5EKQD 5HAXA 4UV8B 5AENA 4GYRA 2ILRA 4P09A 2K24A 1LF8A 4ME2A 3FULA 3RRCA 4ABNA 5E0OA 2WXKA 2LAIA 3N9NA 5JJ6A 1D0YA 2LSGA 1FVFA 3ZYQA 4QFVA 1YW0A 3CVWA 2WSSV 2YU1A 5CA1E 2ONDA 3OJAA 4BSXA 3ZN0B 2RP4A 3JCKC 2KMFA 3UQ3A 1H6KA 5AJDA 5FXXA 3FU3A 5FQ7A 3TKLB 3P8CD 3FEXA 4EBAG 3EIQC 3EHMA 2H7VC 5JDGA 4WBNE 3MGBA 3FU6A 3FTXA 2KNDA 1E8WA 1E90A 4WNGA 1KNZA 1QNFA 3UUXB 1YKEB 3HKDE 1HH8A 1QUUA 3RO3A 3ASDA 3LS8A 3CHMA 5LOZA 4GYWA 5HXEA 3RYCE 3OBVE 3ZEFA 2ODUA 1BR0A 4L7TA 1WRDA 4FI5A 4HORA 3U78A 1OWOA 1MMAA 2BDEA 2YU2A 4GMJA 3D9PA 2LSYA 3QC9A 4EZ4A 4DLOA 3LY9A 2KCLA 3RO2A 2A3DA 1E8ZA 5FY7A 3B57A 4XBFB 3ONKA 5CMYA 3LEWA 4L5GA 4CDRA 4AJWA 2C2LA 4MS6A 4FU3A 3PH0C 4CGWA 3J7Yq 2UY1B 4IYPA 4BX9A 2CLYC 2CEAA 1UJJA 4LEUA 3CX8B 4H63V 4CT4A 3V5UA 5C2YA 3CPZA 2CHWA 3G2VA 3JYSA 4ACLA 1JWFA 1OWPA 1MNEA 4E6HA 2NC9A 4IRUA 5BUZA 1G73A 3LK42 5ARFA 2VSNA 4AVXA 1HS6A 2BZBA 4BAYB 4OHFA 2N2NA 3CVNA 5L3BB 1QQEA 5J2UE 5A7DB 3ZMTB 3KAEA 5BMVE 3U66A 4UWLA 4KUMB 2KT9A 2BVMA 3UX4A 2WPVA 4KXKB 4D10C 3GN5A 3HVEB 3FP3A 2FI7A 4UI9J 1HF8A 2GK9A 4JPSA 3N2OA 2XGMA 3AAAB 4YJ3E 4KYOB 2DI4A 5ADXL 4B0ZA 4AEZC 1TJFA 4URKA 2KCVA 3WAJA 4A1GA 2YQ8A 4E7SA 4DPRA 3UMVA 2KINB 2QA7A 4AY5A 2D0TA 4GZ6A 4JEHB 3RRMB 4OVUA 4YLHA 4BFRA 3PE3A 2HPLA 3DTOA 4PJMA 3OXFA 5CB4E 4QXCB 2J1DG 4OVVA 3LPZA 3KV5A 3T5VA 3NZQA 4JL0A 2NP9A 4UWFA 2L9QA 4AKGA 5LJMA 3SS1A 3QK6A 3I4RB 3VLEA 3H3AA 1HTJF 2V26A 4F7AA 2DNXA 3URZA 4EB6E 2XGSA 1HFAA 5JREA 2VTBA 4AI6A 1ZHCA 3R84B 4BWRA 3VU7H 3NRXA 3ESKA 4V3IA 2G0UA 4Q69A 3T8OA 3P2BA 1FIOA 2WAUA 4X1KE 3HA4A 3C98A 2UY1A 3VKGA 4I43A 5T4YA 2K9AA 4AXHA 3ETVA 2VJ8A 3GW4A 1Z3XA 5G05J 3FTVA 3ZJ1A 3PEVB 1SQMA 3ONLA 2QGSA 2I9CA 2XHEB 5LFAA 3AAEB 2CFZA 4G26A 2X6HA 4I9EA 4JZYA 3RRNB 1ZU2A 4M1PA 2LNIA 2X9WA 3C50A 3MXZA 2WWUA 5LHIB 3D9OA 1JWGA 3TL5A 4BJNA 2KZ7B 4G63A 2E0IA 4QX8B 4EYYR 2X68A 4JLEA 2XCBA 3PUGA 3N5LA 3I1AA 4ZOLE 3PUKA 2I1JA 2W61A 2VKDA 1NWMX 1BR1A 4HEAA 1EZ3A 3K9IA 4UF0A 4CDNA 3KV6A 2WXHA 3UTKA 3CKCA 5FQ4A 2KC7A 2LEHA 3AB3B 4K0UA 4ZHQE 4IE5A 2IONA 3LJCA 5LNKA 2KATA 3L09A 1HG5A 3RKOA 3RX6A 4HOTA 4A3VA 4PFPA 3VHLA 4J2CA 5LGNB 2CXDA 5JDNA 3O1JA 3APFA 4AKIA 1DNPA 2CG2A 2KCKA 3K3OA 4ANWA 4DK5A 3MKQB 3MA9A 4V1Av 3P7IA 2X0LB 1ELRA 5G2NA 3MEKA 4XZ4A 3CV0A 5AFUL 3KBUA 1HCIA 5JHBA 2X51A 1BPOA 5FTPA 4UWKA 1HXIA 5E76A 2L0TB 4P0AA 2XQYA 3G2SA 1WAO1 2JQQA 4G1TA 3F31A 4U72A 3GN5B 4X1IE 4ZS3A 4GA1A 3SD5A 2NTXA 3PE0A 4ZI2D 3AS8A 1O3XA 4B89A 2UXXB 3FUHA 3ZGQA 4PH4B 4HTEA 3QARA 2BF0X 3LBXA 2XTLA 4QHOA 2MYSA 3RPUA 3MJWA 4ZI7E 2LOSA 3LVRE 3UUMA 3APDA 2V4LA 3CEQA 4A3TA 2CWYA 4XZCA 3ZMSB 4C90A 4HFVA 5LBQB 4ILHB 3UFEA 1OWLA 4A56A 5FZRA 3EUHA 5L3DB 4CT0A 2FF4A 5T8IA 2D2SA 5DQVA 3L6AA 1JPLA 2ZLYA 4X20E 3KV4A 4I50E 2WVIA 3VTXA 2J07A 4Q94A 3ASHA 1UG3A 5CCMA 3LG7A 2XUEA 5ANLA 4IN3B 4F53A 1EF1C 2JMHA 5HXCA 3UT7A 2OV8A 3APCA 1OWNA 3FH5A 2KLQA 2EHOD 3FUMA 2V7JA 1B89A 1MIVA 1HX8A 3R7RA 3I9YA 2A5UA 2MOZA 2VKOA 4OYSA 4JVSA 3E08A 4PAGA 3D9MA 4L2LA 3GZ1A 1Y64B 2H3RA 3QC1A 2YEVC 3GZSA 4FULA 4N39A 3I0OA 3MJXA 5JDMA 4MLPA 3N9PA 4O6FA 2CWOA 3AAIA 4N2SA 3Q47B 2YK0A 3ZN1B 2PJQA 1H2TC 2LM9A 2Q9QA 2KM4A 1HO8A 3OXGA 4EZKA 1EDUA 1UJKA 5JJTA 3U64A 4WBOA 2E9XC 2K48A 3KEZA 4AOFA 1NAFA 4GZ5A 4G2AA 4DMVA 2QFCA 3HKBE 2C5JA 3CKDA 4L1BA 2IOSA 5LA6E 5A23A 2NW9A 1W3BA 4OK0A 4GZ3A 1Y8MA 2XPIA 4CRWA 2XGOA 3AU4A 4HGAA 3FBLA 3CVRA 2WXOA 4PK4A 5J1GA 4R7LA 2NOXA 4CQIA 2C5KT 4I2WA 3KINB 1UW4B 3ONXA 2M63A 1E8YA 3EIJA 3ZLIA 1N54A 4FA6A 5JDFA 4HE8A 1YA0A 2KXPB 4UQXA 4WAFA 2UWJG 2NXPA 4WNDA 4EQFA 3DBSA 4C9BB 2L3LA 3ZRHA 4K0RA 1E7VA 5FP3A 3FDHA 3CSFA 4FLBA 1D1AA 4EAHA 2YINA 4W9RA 2KZTA 4G2VA 5DQWA 2AVPA 2X6IA 4HS2A 4M3OA 2WXRA 3ZCJA 3SRZA 4APFA 4BY6A 3IEEA 4GCNA 3R6NA 4Y6CA 3LY7A 2XAHB 4FHJA 4H9SE 2PG8A 4JEUA 2XAQB 3O1HA 2YHEA 4PW8A 3KFWX 3O9XA 4TV3A 3LXUX 5DIZA 4G25A 3TGOA 5FXVA 3IV0A 4CI1B 4NRHB 4RSYA 3ZFWA 4AQGA 4WNEA 3SGHA 4YHJA 4C0MA 4G23A 1HS7A 3SBSA 3FHEA 4BTBA 2WMNA 2X6FA 3IHRA 3KDSE 4HFGA 4WW0A 3FBZA 4F3VA 1HG2A 2VB6A 2OOEA 2WXJA 4O2BE 5JDLA 3FHNA 2BTDA 1N52A 2CXLA 2E9XB 3F57A 2JLBA 4JEHA 2FEZA 2LT3A 3CMLA 2DCFA 5JHAA 4CI2B 3N9QA 3U3WA 3PU8A 5BW8C 3HKCE 2X9HA 3NZPA 4ATGA 4ANJA 4U0UA 3ZN3A 4C0EA 2J09A 4XX5A 2V7LA 3HHMA 2LSIA 3N2KE 4NUUA 3TXMA 2IW5B 1P5QA 2VK9A 3OTNA 3ZCIA 2FO7A 3QWVA 4ILGA 5AIJA 2X66A 4ISTA 2Y48B 3L08A 5LCWC 3B7TA 3D9JA 5EX0A 3CGHA 4EZLA 3J9X1 5M72A 3ZHEA 3GWHA 1HE8A 4RG6A 1ZV4X 3Q9DA 4LRZA 1V9DA 4CDMA 3E0ZA 5EDSA 4H9PC 3MZKB 1MIWA 4TV8E 3K3NA 3Q2MA 2V0PA 2OA5A 3ZYMA 1T98A 2XAFB 4AP2A 3E22E 3G2UA 3IHYA 3Q5MA 2KZTB 4BTAA 3C4ZA 3D9KA 1YD8G 2FBNA 2NSZA 4IULA 4EIWA 2WXPA 3AVSA 4AQFA 4XAXB 2JEKA 2Y4UA 2X9XA 3QWPA 4ISSA 2JMKA 2J08A 2DWKA 4N3BA 4ILUA 3LK3B 5DJQC 5DABA 3FXDB 3LK2B 5FWQA 4QKNA 2NW8A 1H2VC 2J4DA 3KV9A 1ELWA 3N2GE 3ZMUB 3Q15A 3QUJA 4GZCA 1S94A 3NZSA 4WNFA 2XPYA 5BV0A 3QKYA 1X5BA 3LFMA 2DWGA 3JQ1A 2ZMAA 2IU1A 2IJGX 5C8YE 4U04A 3OKQA 5KDMC 3CVUA 2ZM2A 4GPKA 2L9BA 3MCXA 4IGUA 3JC6D 2L0IA 4H9RC 3ETUA 2LSKA 1GW6A 3UUNA 4GCOA 4YVQC 2Y6XA 4F1SA 4GYYA 2VGXA 5JDHA 3I9WA 3D9LA 5T3RA 5HXHA 2AWIA 3E4BA 4AIFA 1AJ3A 3ANWA 4U63A 3N71A 4XKBA 3U9WA 5G55A 3FUNA 3Q5XA 5LHHB 3SFZA 2A4ZA 2J49A 1Z6TA 2WQ7A 2XPZA 1Z3YA 3LCAA 4CXYA 2I59A 2LSJA 1WYBA 5TAOA 4O2AE 2DIWA 2V8SE 2W62A 5L3CB 5JRCA 2CA5A 3FTUA 2L8KA 2PQNA 2NWBA 5LBMA 3UPVA 1IAPA 3CVYA 3L13A 4U07A 1FVHA 3ZPJA 3QK0A 2WQ6A 4UVBB 5A1LA 3FUEA 5EK3A 1ZEEA 1D0XA 3I5PA 4DBQA 2VTBB 4A1SA 1D0ZA 1ZKEA 1D1BA 2R17C 4Q96A 3NF1A 2PL2A 2ODVA 2E9XD 3RC8A 4OYKA 3GA8A 4PDXA 3R9AB 2FULA 3ZVVA 3SHFA 2RA1A 4U74A 1BR4A 3GZ2A 2ZM8A 2X38A 2E8IA 3T5XA 3EDTB 2LE8A 3DP7A 3DJBA 3CQGB 3ESLA 2LHNA 3QWWA 4TV9E 4JEUB 2XAGB 1HZ4A 2VWAA 1FMWA 4KMCA 2LAHA 4FLHA 4ASKA 2PZIA 1OWAA 4AY6A 5LCWJ 2PBIA 3QDNA 5JVDE 2CXFA 4BJMA 1KT1A 2ES0A 3ASFA 2XCCA 1WY6A 4EPZA 4EOZB 4BT9A 3B7SA 1B7TA 1FCHA 4GB9A 4HLEA 3EJNA 2XQ0A 2ACXA 4N3AA 3LDZA 2OVBA 3OAWA 3LBXB 4I1MA 4IDZA 1VDYA 5ENNA 3OYXA 3PUJA 2CHXA 3CVXA 3O4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9O A;  3D9M A;  1JWG A;  1SZA A;  2KM4 A;  4FLB A;  4FU3 A;  5J08 A;  1EDU A;  1UJK A;  2L0T B;  3ONL A;  3G2V A;  2DIW A;  3ZYL A;  2V8S E;  2BF0 X;  3D9P A;  2MOW A;  2DCP A;  3D9I A;  3G2S A;  4GZC A;  1JWF A;  3ZYM A;  2QY7 A;  3D9L A;  5CMW A;  1JUQ A;  4HFG A;  3G2U A;  3G2W A;  3ZYQ A;  1X5B A;  1ELK A;  1HG2 A;  3LDZ A;  3CLJ A;  1H0A A;  4JXT A;  1PY1 A;  1SZ9 A;  1JPL A;  4AVX A;  4Q96 A;  1HG5 A;  1UJJ A;  4NAC A;  3D9N A;  1INZ A;  3G2T A;  1XGW A;  1HX8 A;  2LO6 A;  3D9K A;  1HF8 A;  1MHQ A;  3RRU A;  3D9J A;  3ONK A;  5CMY A;  1VDY A;  2L0I A;  1LF8 A;  5LOZ A;  3ZYK A;  5LP0 A;  4Q94 A;  1HFA A;  4GZD A;  1EYH A;  1DVP A; 
#chains in the Genus database with same CATH topology
 2F37 A;  2DZN A;  5LXT E;  5ABG A;  4HWC A;  4I6J A;  1D8D A;  4F6R C;  4I6G A;  5CED B;  3AEC A;  4WAF A;  2VVN A;  1XNF A;  2XEN A;  3PDN A;  1BR2 A;  4L0R A;  3VKH A;  4LML A;  4J8F A;  5AQA A;  4LUN U;  1XDO A;  3NB2 A;  4LER A;  5AQF B;  4K5C A;  4WUY A;  2HN2 A;  3CHP A;  3BU8 A;  5EYP F;  3H37 A;  3HKE E;  1OCC E;  4IE7 A;  3RIU A;  3S2A A;  2UUB T;  2Q9Q C;  2ZGD A;  4PFO A;  3PRZ A;  4U8H A;  4IE0 A;  3Q7F A;  4KT6 B;  5HXS A;  4AQY T;  3ZJ2 A;  5FXZ A;  3PEU B;  1MMG A;  5CHE E;  5C1D A;  3PNT B;  2C5I T;  3P4S A;  2OLT A;  4UI9 C;  3LKU A;  1QLB A;  4QX7 B;  2XRZ A;  4F1P A;  4P1N A;  4U7I A;  4XI9 A;  5D66 A;  3FEY A;  1O1T A;  4YFS A;  3AA1 B;  4DX5 D;  5FY0 A;  2JPF A;  4O8S A;  1INZ A;  5KCM A;  5HKP A;  2LSV A;  2BKP A;  4UWH A;  4B94 A;  5GON E;  5LGU B;  5HWY A;  4UXN B;  3SZ7 A;  3MKR A;  1TN6 A;  1IZN B;  4UF0 B;  3CHR A;  4KHP T;  3CR3 A;  4H9N C;  3PU3 A;  4TUY E;  3ZKR A;  4RVB A;  4N5C A;  2R6G F;  4KX6 A;  3R7Q A;  3SFY A;  5ENT D;  3FH8 A;  2HR2 A;  4PS7 A;  3U3I A;  5L4H A;  4HFE A;  5HI7 A;  2D5U A;  4MBQ A;  4DR1 T;  1US7 B;  5KJM A;  5KMG P;  1XMO T;  5L2L A;  1KF6 A;  1YCS B;  1E7U A;  3FTW A;  2IAK A;  1QSD A;  3ANW B;  4AV7 A;  4TN7 B;  4G24 A;  1SA0 E;  5EK4 A;  5EID A;  2BS2 A;  5JR9 B;  3LVQ E;  4TZ4 C;  4GK5 E;  1MYO A;  2V5F A;  4UV9 B;  4F8H A;  3L16 A;  3PZ3 A;  3GYZ A;  4CN4 A;  3CWZ B;  3TLT A;  4UEM A;  4JW1 A;  4I2Z A;  4L2Y A;  4JXT A;  2VL8 A;  1SZ9 A;  4ZFH A;  3CK7 A;  2WQY A;  3G2T A;  3RIF A;  4GU5 A;  4EXT A;  2X67 A;  1D1C A;  3X2Q E;  5J0Z A;  2VQ2 A;  5LP0 A;  3C4W A;  1R8I A;  3RYI E;  3FB2 A;  4I9C A;  2VQF T;  2V7M A;  3DPD A;  4AKL A;  2SPC A;  4IIJ E;  3KVB A;  2J8S D;  4MFR A;  2BG9 A;  3CIA A;  2WXI A;  2NW7 A;  4DLQ A;  1OCO E;  3HXE A;  3RIB A;  4GOU A;  1QZ2 A;  3HI2 A;  4CXW A;  4UWG A;  4J8E A;  3UT4 A;  4OYJ A;  3OPC A;  4FC8 A;  3KSQ A;  2LO6 A;  2VQE T;  5CA0 E;  2LRL A;  3S7D A;  3UM3 A;  4IT4 A;  4I6E A;  4BX8 A;  3DEP A;  2X3M A;  2XQ9 A;  4X65 T;  5LP6 E;  2LJL A;  4HFB A;  2X6K A;  4GA2 A;  3S7F A;  4HFD A;  3S7J A;  2A72 A;  5HYA A;  4MHC A;  1SE7 A;  1IQR A;  4N78 D;  3D9I A;  2Q9Q B;  3C4X A;  5JQG E;  5L3G B;  3QNK A;  3SWH A;  3Q79 A;  3BQL A;  3A5X A;  2JAB A;  1E7P A;  3RK6 A;  1KLX A;  2CFU A;  5H6R B;  5ETW A;  1J5E T;  4J8S A;  5FJY A;  1IYG A;  3EDV A;  3FFL A;  1MHQ A;  1H2U A;  4QH4 A;  3KVA A;  1EPU A;  4LG6 A;  3HIZ A;  2PTF A;  2C0L A;  2R5S A;  3FZM B;  3QAQ A;  3UU5 A;  3VLF A;  3AE3 A;  3BG0 B;  3CHS A;  3NOG D;  1T72 A;  5AQP B;  1U5P A;  4KMO A;  1UX5 A;  3FU5 A;  4HOU A;  1H0A A;  2Z6E A;  3B7R L;  4FJZ A;  4UQZ A;  4HOS A;  5CRV A;  4HLL A;  2HN1 A;  5EIB E;  1H7C A;  3WAK A;  1U3D A;  1JCS A;  3AEF A;  3MYV A;  3BQI A;  1U3C A;  4ANU A;  1FEW A;  5KJN A;  3KSL A;  4BT8 A;  4PJJ A;  1KT0 A;  4HKA A;  5HQ8 A;  3ZIM A;  4GMR A;  2Y8D A;  3PVL A;  3JAF A;  2PM6 A;  2K5B B;  3ISM C;  3N9L A;  5HEH A;  4TX5 A;  4ZI2 C;  2MRI A;  4YVO A;  2HE0 A;  4C91 A;  4AKR B;  2RFM A;  4ANX A;  3QJZ A;  3FUJ A;  5F8P A;  3CVQ A;  5BXU A;  3Q4A B;  5LCY A;  5B1A E;  3HYM B;  5E75 A;  1LVK A;  2CHZ A;  5G05 C;  1YKH B;  5EK2 A;  3DSV A;  4ATZ D;  1WLX A;  3V2X A;  4IHJ E;  1CUN A;  4TWF A;  3IHV A;  4DI3 A;  3DST A;  3DRA A;  1E1H B;  2WB2 A;  2LLY A;  2IIU A;  5HXR A;  4OX9 T;  4DMW A;  4YSY A;  2UXD T;  3W15 B;  4RG9 A;  3TWR A;  2NR4 A;  4AXP A;  3AS4 A;  3HVE A;  5KJL A;  3RH3 A;  2XHE A;  2AXD S;  3UUX A;  2VKJ A;  4N2Q A;  4O4I E;  1W09 A;  3T1H T;  4CCA A;  4BET A;  5EYL A;  2ZM6 T;  2XAS B;  3QB2 A;  1Q2Z A;  5J2T E;  3ZEF B;  3CHQ A;  3ULQ A;  2A2F X;  3CKB A;  5FIO A;  3ZC1 A;  3FUI A;  3CK9 A;  2V7I A;  5LOV E;  3ULE G;  4ERR A;  4I43 B;  2WB5 A;  1OWM A;  5FQ6 A;  5KNH D;  2MTQ A;  3EHZ A;  3KBT A;  3D9H A;  1WCR A;  2H89 A;  3N9M A;  2XS1 A;  2VGX B;  3K8P C;  2PQR A;  3AU5 A;  3IBE A;  4YSX A;  3TG5 A;  4ZI3 C;  5ABH A;  5BT1 A;  3QOU A;  4TNW A;  2DBA A;  5FYM A;  1L5J A;  2KBX A;  4UVC B;  3TLS A;  1UK5 A;  4HB5 A;  4A55 A;  4TXR A;  3TJP A;  4HOQ A;  3L17 A;  2E2E A;  3PUR A;  5IWA T;  2V6X A;  4AKH A;  5CEA A;  3UUL A;  3JXI A;  4J0U A;  3K1S A;  4E85 A;  4HFI A;  4QXB B;  4PS8 A;  2CM0 A;  3HXD A;  1E96 B;  5FT9 A;  2C0M A;  3CX7 B;  5L3F B;  3L3P A;  2HM8 A;  4JB8 P;  1X79 A;  1G8X A;  4APO A;  1UUS A;  5FZQ A;  4TRQ A;  1TEZ A;  4O4H E;  2W67 A;  2HYZ A;  4I1O B;  4AM9 A;  4G11 A;  3RKV A;  4HVB A;  2Q9Q D;  3RAU A;  1PAQ A;  3I3N A;  5AQG B;  3VR8 A;  4LF8 T;  5BNW A;  4UQY A;  5JH7 E;  3X1D A;  3RSE G;  2E5V A;  3BUA A;  5AQT B;  2LSU A;  2CCQ A;  1E8X A;  4WWO A;  2X9Y A;  2KSR A;  4MBG A;  4L23 A;  5AAO A;  4LMJ A;  4FAD A;  2B76 A;  2BS3 A;  4L9I A;  4MKT A;  5B3S E;  3SNX A;  3RYF E;  1FT1 A;  3ABM E;  3J5P A;  3K3Q C;  4DV0 T;  3TG4 A;  2GRN B;  5D0O D;  4BA9 A;  4TNV A;  4B8C B;  4U95 D;  4LF4 T;  2WDV A;  3MV3 B;  2E5L T;  2MOW A;  5F3J A;  1MMN A;  4UEL A;  2RPA A;  3G2W A;  3P1U A;  1LVF A;  2PM7 A;  1IXV A;  4NQ0 A;  4U0S A;  3PS6 A;  3NWI A;  2OVF A;  4LCT A;  2BS4 A;  1IBM T;  2FJB A;  1DU2 A;  4DI4 A;  4CZZ B;  4E7Z A;  3NAW A;  2XEH A;  2BVL A;  2CBI A;  1IJ6 A;  2ZU6 B;  2VSX E;  2AXV A;  4KBQ A;  3AA7 B;  2MHK A;  3T8M A;  3C5R A;  3MK7 C;  1Z0P A;  4YND A;  4IE4 A;  3PUS A;  2V1D B;  2NYJ A;  3PZD A;  3ZXS A;  4CI3 B;  1OED B;  2DCP A;  4PS3 A;  4KP3 C;  1QBQ A;  3ENE A;  5JRC B;  5ANR A;  4B8A A;  2XQ6 A;  2EQX A;  4WWN A;  1BLX B;  2WCA A;  4H9O C;  3ZST A;  5JR9 A;  2WXQ A;  1WYC A;  5L47 A;  3WI3 A;  1UN9 A;  3TXN A;  4JHK A;  1OED A;  4J6I A;  4KBM B;  3GMI A;  3P4P A;  3ZMZ B;  2RD0 A;  1UX4 A;  5JDQ A;  3D0T A;  1U2V G;  1KPS B;  1KZO A;  1JUQ A;  3UIP C;  2PFV A;  2R59 A;  3RC3 A;  3Q5W A;  3F2E A;  3HR0 A;  5HEU A;  3CHO A;  1A17 A;  1SW6 A;  4JHR A;  3LJ3 A;  3RRU A;  4YDY A;  3NBX X;  1VOM A;  3FUD A;  3ZT6 A;  3SI5 A;  4PK5 A;  2YHC A;  3SOL A;  4J8Y A;  2VYI A;  4I17 A;  2BUG A;  2W2U A;  2XJ7 A;  4MLK A;  1BI7 B;  2VSO E;  1DVP A;  5KXJ A;  3Q73 A;  3SY2 A;  1SHZ C;  4KHZ F;  4JI2 T;  2J4B A;  2P9B A;  3FU0 A;  2VAS A;  5C2T A;  4GTP A;  3NRY A;  4AQF C;  4K5A B;  3RKG A;  4CGV A;  3ZC0 A;  2EIL E;  5LHG B;  2HH7 A;  3Q5D A;  3C3O A;  4QWN B;  3UQ4 A;  3AG3 E;  4EEB A;  3FTY A;  3ZPO A;  2GRL A;  1NFI E;  4GAA A;  2YNQ A;  3EU9 A;  3TWS A;  5L3E B;  2WZI A;  3IKO B;  3BG1 B;  2I0M A;  2EHO C;  3V30 A;  2RFA A;  4Y6W A;  4GTO A;  4LNU D;  4EED A;  3HL6 A;  3NBN B;  5FXW A;  3LYA A;  5FY1 A;  1RW2 A;  2LOP A;  3EDU A;  1T7S A;  5LG3 A;  3Q9U C;  3MV2 B;  4JA9 A;  2XQ3 A;  4ZS2 A;  5KBA A;  2IQC A;  2Y3A A;  3L22 A;  4U8Y D;  3EHN A;  4U7Y A;  5AQN B;  3JC6 C;  4Z8X A;  4U96 D;  5EIL A;  4HWF A;  4IL9 A;  4ILI A;  3AS5 A;  4KVM A;  1TNY A;  4EYU A;  2WXG A;  3KD7 A;  4JHJ A;  4P29 A;  4GYO A;  2KWH A;  2XZT G;  2ZM0 A;  5JR9 C;  5AQO B;  2EIK E;  1KNP A;  1HU3 A;  1UCU A;  2CHO A;  4ZI3 D;  1WM5 A;  4O4J E;  4FHK A;  5FNV E;  4KZC A;  2B6C A;  3MA5 A;  4PJL A;  1KK7 A;  4YT0 A;  3AE9 A;  2XQA A;  4GIW A;  4P0B A;  4EBA A;  1N0R A;  3NKZ A;  4EEC A;  3IEG A;  4NUR A;  4GTS A;  5ARG A;  2LKG A;  5CCL A;  3UUB A;  4G8K A;  4GZD A;  1KFY A;  4JA7 A;  5JJ7 A;  2I6H A;  4YJ2 E;  2EIN E;  5CBO A;  3AEA A;  3B13 A;  2IF4 A;  2GW1 A;  2WWV A;  2ACZ A;  3ASG A;  3D9N A;  4GTT A;  3L9T A;  3B7B A;  3O4X E;  4HXI A;  4IE6 A;  2L6J A;  3LY8 A;  1TJC A;  3TWQ A;  2B1E A;  2W0G A;  3QB5 K;  3JQ0 A;  4ANV A;  1IJ5 A;  5AQQ B;  3A8Y C;  1MMD A;  4B6X A;  1EYH A;  5HEJ A;  1K8K G;  3EVY A;  5AQB A;  3AE1 A;  2BG9 B;  4XIF A;  1NZN A;  2A5E A;  4HRL A;  3CX6 B;  1OCR E;  1U4Q A;  3PUQ A;  3PUX F;  2HPJ A;  4IDO A;  1MND A;  5AQI B;  2VGY A;  4DBR A;  3HDX A;  2FJA A;  4NUV A;  3BEE A;  2AW6 A;  4N3C A;  5FZS A;  4DRX E;  2WDQ A;  4DR6 T;  4DVD A;  4DX2 A;  3ZYK A;  5D0Q D;  2GRM A;  4GK0 E;  2P58 C;  4DR4 T;  2WXF A;  2JRK A;  5EX3 A;  3ABL E;  5CGM A;  5LGT B;  1WR6 A;  4ACK A;  1NP7 A;  2IFU A;  2ETB A;  2EHO B;  4JI0 T;  1OUV A;  2CLY B;  1ELK A;  3TLV A;  3D3M A;  1VRB A;  4WNK A;  5D2M C;  1MQS A;  5BV1 A;  1XGW A;  4WWP A;  3M65 A;  4YY3 T;  3FY4 A;  4J8D A;  1S0P A;  3MAC A;  4MRU A;  4LFC T;  2WXL A;  1SUM B;  2VKH A;  2XRY A;  4DV5 T;  3PNL B;  4N5Q A;  5AJL A;  3W9F A;  1SZA A;  1QYM A;  4GA0 A;  4H7Y A;  2QYJ A;  2RG8 A;  2BG9 E;  1WG0 A;  3AG4 E;  3B7U X;  2H7O A;  5A6C A;  4K03 A;  3CLJ A;  5BPP A;  2EHO A;  5IY5 E;  3ZHE B;  4NAC A;  2XPK A;  1XWM A;  3Q49 B;  4XE0 A;  4ADZ A;  4PJN A;  5AQM B;  3FXE B;  3PDY A;  4ZXL A;  3RRW A;  5FL0 A;  5AN8 A;  3FH7 A;  1JNR A;  4CN1 A;  3UTM A;  3FTZ A;  1K1B A;  1RZ4 A;  3UM0 A;  3CVL A;  5J08 A;  3DPY A;  2DHR A;  2AXZ A;  4KZ0 A;  4HWD A;  1IQU A;  3T9K A;  5LYJ E;  3ZT7 A;  4JUY A;  3JUI A;  1UN8 A;  3DSS A;  3RJV A;  4YDE A;  2LKH A;  2AJA A;  4GYS A;  3FUK A;  2J9Q A;  3PE4 A;  3ABV A;  2DVW A;  3NQP A;  3BQO A;  2ZIS A;  1IHG A;  5G04 C;  2IML A;  1N4S A;  4JI6 T;  3NZU A;  4PUC A;  1V55 E;  4DO0 A;  3RYH E;  1H19 A;  1MIY A;  2MBG A;  2E9X A;  3CVV A;  4H7X A;  4DUI A;  2IUB A;  5CMW A;  1N36 T;  4YTM A;  2JQH A;  4H63 H;  5AYW D;  3MZL B;  4JC8 A;  4UI9 K;  3AE4 A;  2HO1 A;  4MAL A;  1ZBP A;  1NA0 A;  1FMV A;  3RGL A;  3V31 A;  4O4L E;  5LJN A;  5ABE A;  2WXN A;  5IHY A;  2BBH A;  4KVO A;  2JJ9 A;  4K5B A;  2XS8 A;  3BK9 A;  5HCM A;  1S35 A;  3J5Q B;  4OAU C;  4CEM A;  2LHR A;  2XSA A;  4U0Z A;  3MKQ A;  2Q7F A;  2CG3 A;  3FUF A;  3ML8 A;  2W00 A;  4EZJ A;  3N9O A;  3V5S A;  3ML9 A;  1N4P A;  4GML A;  3RU0 A;  2UXN B;  4XKC A;  2N9D A;  1OXZ A;  2KWI B;  5G04 J;  4I1A A;  2Y4T A;  4TWH A;  3MKD A;  2LXL A;  4QXH B;  5H6Q B;  5FL1 A;  2P9I G;  3AVR A;  4PK6 A;  2VGE A;  1PC2 A;  1LKX A;  5FMN A;  3L54 A;  3U4T A;  3ZMV B;  3CST A;  3PZ1 A;  4GTR A;  1PY1 A;  1SA4 A;  5KX5 E;  4TXP A;  2CMR A;  3UT5 E;  5LX8 A;  1T8B A;  1N9A A;  3FTS A;  3UT8 A;  3VTY A;  3VLD A;  3MX3 A;  2D0U A;  3S7B A;  1Z5S C;  4LF9 T;  2N1G A;  3UKR G;  5AAR A;  2JQ9 A;  2IC6 A;  4I55 E;  1YQ4 A;  2WBL A;  2QY7 A;  3C64 A;  3IXE A;  3SF4 A;  3C51 A;  4PNI A;  3VRA A;  5EZY E;  5HWX A;  1OY3 D;  2I1K A;  3CVP A;  3WXX A;  2GGF A;  3S4U A;  4DV2 T;  4JI7 T;  4B3M T;  2H6H A;  2M67 A;  3O48 A;  2W63 A;  2IO3 C;  2AXU A;  5DBK A;  2WXM A;  3IBP A;  4FJO A;  4FP7 A;  3I4G A;  3M3Z B;  3KS2 A;  4XI0 A;  4KI0 F;  3ZW3 A;  2VSY A;  3FWV A;  2WMO A;  4TUU A;  2QYU A;  3PRE A;  3IF8 B;  4OFZ A;  3OXL A;  3TAX A;  4DR7 T;  2X6J A;  4X1Y E;  1WR0 A;  4CXX A;  3AA6 B;  1W0B A;  4U7E B;  2CE7 A;  2XEV A;  4UIG A;  1M7K A;  1LRZ A;  1NA3 A;  2IC9 A;  3AA0 B;  2H6G A;  3V79 K;  5LMN T;  3UIO C;  2V7K A;  3HXC A;  4UVA B;  4HBD A;  3CK8 A;  1N0Q A;  5KJK A;  1N95 A;  4TXQ A;  2NTY A;  1Y6I A;  3BQK A;  3I0Q A;  5IYZ E;  4U2Z A;  3OYZ A;  5F5W A;  2XAJ B;  3PUA A;  2DLR A;  1FPP A;  5BXO A;  3C98 B;  4HN9 A;  5J90 A;  2C0S A;  3PTR B;  3RLF F;  3Q78 A;  3TWW A;  2WM9 A;  5M4Y A;  3AED A;  4FJY A;  5FQ8 A;  4DND A;  2GRP B;  5LG4 A;  3UU3 A;  2IOL A;  1IBK T;  2W66 A;  3TWT A;  3CK6 A;  4I4T E;  3SBT B;  4DJA A;  2WQH A;  4EZH A;  4Z90 A;  3CQC B;  3O1I A;  2UU9 T;  1SA5 A;  4XEI G;  3ZYL A;  3CQX C;  4H9Q C;  2Y1L E;  2I2O A;  4X5T A;  3AEG A;  3AXJ B;  5HAX A;  5EKQ D;  4UV8 B;  5CRU A;  5AEN A;  3LJN A;  4GYR A;  3B5M A;  2ILR A;  4P09 A;  2K24 A;  1LF8 A;  4ME2 A;  3FUL A;  4A98 A;  2YDQ A;  3RRC A;  4ABN A;  5E0O A;  2WXK A;  2LAI A;  3N9N A;  5AQV B;  5JJ6 A;  1Z8U A;  2R05 A;  2WS3 A;  1D0Y A;  2LSG A;  2VUR A;  1FVF A;  5L4E A;  4YDW A;  3ZYQ A;  3F6Q A;  4QFV A;  1YW0 A;  3CVW A;  3NOC D;  2Y0B G;  5FIN A;  2WSS V;  2YU1 A;  5CA1 E;  4QQI A;  1UOH A;  2OND A;  3OJA A;  4M7C A;  4BSX A;  3ZN0 B;  2RP4 A;  3JCK C;  2KMF A;  1TNB A;  3UQ3 A;  1H6K A;  5AJD A;  3RHW A;  2OEW A;  5C3J A;  5FXX A;  3FU3 A;  4LMK A;  2UUA T;  5FQ7 A;  2V6Y A;  3TKL B;  3P8C D;  3FEX A;  3SFX A;  4EBA G;  4ZHB A;  3EIQ C;  2HHH T;  1G3N B;  3EHM A;  5IUX A;  3UXG A;  2E2A A;  3DXM G;  2XQ4 A;  2H7V C;  5JDG A;  4WBN E;  3MGB A;  1N94 A;  3FU6 A;  3FTX A;  2KND A;  1E8W A;  4CN6 A;  4LF7 T;  1E90 A;  4WNG A;  1KNZ A;  1QNF A;  3UUX B;  2LRK A;  1YKE B;  3HKD E;  4ZZC A;  1HH8 A;  1BD8 A;  1QUU A;  3UU8 A;  4K0K T;  3RO3 A;  2X0H A;  3TWX A;  5CJ5 A;  3ASD A;  2DWZ A;  1IBL T;  3LS8 A;  3CHM A;  5LOZ A;  3HXF A;  4GYW A;  5HXE A;  3RYC E;  3OBV E;  3ZEF A;  2ODU A;  1BR0 A;  5AQR B;  3ULY A;  4L7T A;  1WRD A;  4IL4 A;  2DYS E;  4FI5 A;  4HOR A;  2F8X K;  3U78 A;  1OWO A;  1MMA A;  2BDE A;  2YU2 A;  4GMJ A;  3D9P A;  2LSY A;  3QC9 A;  4EZ4 A;  2BG9 C;  4DLO A;  3LY9 A;  4G8L A;  2KCL A;  3RO2 A;  3T1Y T;  3RF1 A;  2A3D A;  2X0Y A;  1E8Z A;  5FY7 A;  3B57 A;  5BR8 T;  4XBF B;  3ONK A;  4IDP A;  1XZY A;  5CMY A;  3LEW A;  4L5G A;  3Q9N C;  4CDR A;  1D8E A;  4RLY A;  2C2L A;  4AJW A;  2QYW A;  2M6I A;  4MS6 A;  1NEK A;  4FU3 A;  3PH0 C;  4CGW A;  3FZK B;  3J7Y q;  4C48 B;  3UI2 A;  4GKK T;  2UY1 B;  4ILC A;  4IYP A;  1N11 A;  3FZF B;  4BX9 A;  2CLY C;  1HNW T;  2CEA A;  4IRE A;  1UJJ A;  4LEU A;  3AG2 E;  1D9S A;  1I94 T;  5HEG A;  4YTP A;  3CX8 B;  4H63 V;  4IDQ A;  4CT4 A;  4Q25 A;  1HNZ T;  3V5U A;  2DYR E;  2JQK A;  5AQK B;  5C2Y A;  2MYO A;  2BBJ A;  3CPZ A;  2CHW A;  3EHR A;  3G2V A;  3JYS A;  4ACL A;  2LUH A;  1JWF A;  2WDR A;  1OWP A;  1XNQ T;  1MNE A;  4E6H A;  2NC9 A;  4IRU A;  5BUZ A;  1G73 A;  1S64 A;  2QC9 A;  3LK4 2;  5EN5 D;  2VSN A;  5ARF A;  4AVX A;  1HS6 A;  2BZB A;  4BAY B;  4OHF A;  2N2N A;  3CVN A;  4HWI B;  5L3B B;  5ENP D;  1QQE A;  5J2U E;  5A7D B;  5CER B;  3ZMT B;  3KAE A;  5BMV E;  2GRQ B;  3U66 A;  4UWL A;  4KUM B;  2KT9 A;  4BEP A;  1TR4 A;  4JI5 T;  2BVM A;  3UX4 A;  2WPV A;  4KXK B;  4D10 C;  3GN5 A;  2PNN A;  3HVE B;  3G06 A;  2KXP C;  3KEA A;  3FP3 A;  2FI7 A;  1DC2 A;  4UI9 J;  1HF8 A;  3UQ7 A;  3AEE A;  2GK9 A;  2JIW A;  4JPS A;  3N2O A;  2XGM A;  3AAA B;  4YJ3 E;  4KYO B;  2DI4 A;  5ADX L;  4B0Z A;  3RQW A;  1Y01 A;  4AEZ C;  5AQU B;  1TJF A;  4URK A;  2KCV A;  4RQI A;  2MPK A;  3WAJ A;  1AWC B;  4A1G A;  4BES A;  2YQ8 A;  4E7S A;  4DPR A;  3ONL C;  2Y69 E;  3UMV A;  2KIN B;  2QA7 A;  4AY5 A;  2D0T A;  4DX7 D;  4GZ6 A;  4JEH B;  3RRM B;  4OVU A;  4YLH A;  4BFR A;  3PE3 A;  2HPL A;  2XQ5 A;  3AE7 A;  3DTO A;  4PJM A;  3PUV F;  5LMU T;  3OXF A;  5CB4 E;  4YTN A;  4QXC B;  2J1D G;  4OVV A;  3LPZ A;  3E34 A;  3KV5 A;  3EU5 A;  3T5V A;  2UUC T;  2J62 A;  1K1A A;  3NZQ A;  4JL0 A;  2NP9 A;  1OCZ E;  4UWF A;  3RIA A;  4UUC A;  2L9Q A;  4AKG A;  1YMP A;  3PZ4 A;  3V2O A;  5LJM A;  3SS1 A;  1MX4 A;  3QK6 A;  2WY2 A;  3I4R B;  4B93 B;  2BKG A;  4LFB T;  2V5D A;  3VLE A;  1N34 T;  3UM1 A;  5KWD A;  3H3A A;  1HTJ F;  1M62 A;  2V26 A;  1N4Q A;  4F7A A;  2DNX A;  2W4X A;  3URZ A;  4EB6 E;  2XGS A;  1HFA A;  5JRE A;  2VTB A;  2YOE A;  4AI6 A;  1ZHC A;  3R84 B;  4BWR A;  2EIJ E;  3VU7 H;  3NRX A;  3ESK A;  4HQD A;  2G0U A;  4V3I A;  4Q69 A;  3T8O A;  2GRO B;  2OCC E;  1FIO A;  3P2B A;  3B95 A;  2WAU A;  4X1K E;  3HA4 A;  3C98 A;  2UY1 A;  4DR5 T;  3VKG A;  1JCR A;  4I43 A;  5T4Y A;  2K9A A;  4AXH A;  2GRR B;  3ETV A;  2R2L A;  2VJ8 A;  3GW4 A;  1Z3X A;  3UKU G;  5G05 J;  3ZNG A;  3FTV A;  3ZJ1 A;  5JA4 D;  3DWL G;  2FJD A;  3PEV B;  3EI0 A;  4LFA T;  1SQM A;  3ONL A;  2QGS A;  2I9C A;  2XHE B;  5LFA A;  3TLU A;  3AAE B;  2QZA A;  2CFZ A;  4G26 A;  2X6H A;  4I9E A;  4JZY A;  3RRN B;  1ZU2 A;  4M1P A;  2LNI A;  2X9W A;  4B3T T;  3C50 A;  3MXZ A;  2WWU A;  5LHI B;  4DV4 T;  5ABF B;  3D9O A;  4UR9 A;  4GTM A;  3P4Q A;  1JWG A;  4BJN A;  2BED A;  3TL5 A;  1MX6 A;  2KZ7 B;  4G63 A;  3E33 A;  2E0I A;  2OV9 A;  4QX8 B;  4EYY R;  2X68 A;  4JI1 T;  1HR0 T;  4JLE A;  2XCB A;  3PUG A;  3N5L A;  3I1A A;  4A63 B;  4HRN A;  2V5C A;  4ZOL E;  3PUK A;  2I1J A;  2W61 A;  1H6O A;  2VKD A;  1NWM X;  1BR1 A;  2YN6 A;  4HEA A;  1EZ3 A;  4NXM T;  3K9I A;  5ENO D;  4UF0 A;  1TYQ G;  4CDN A;  3KV6 A;  2WXH A;  3UTK A;  3CKC A;  5FQ4 A;  4O1P A;  2KC7 A;  2LEH A;  3NVO A;  3AB3 B;  4K0U A;  4ZHQ E;  3Q7A A;  4IE5 A;  3JAD A;  4YDO A;  2ION A;  3LJC A;  2FBW A;  5LNK A;  2KAT A;  4BER A;  3L09 A;  1E2A A;  1HG5 A;  1W0A A;  3RKO A;  3RX6 A;  4A3V A;  4PFP A;  3VHL A;  4HOT A;  1A5E A;  2XSB A;  4J2C A;  5LGN B;  4LNG A;  3TLW A;  2CXD A;  5JDN A;  3O1J A;  2R03 A;  3APF A;  2XZD G;  4AKI A;  1DNP A;  2CG2 A;  5JMN D;  5ENQ D;  4O1O A;  2KCK A;  3K3O A;  4ANW A;  4OAV B;  3CIR A;  4DK5 A;  3MKQ B;  3MA9 A;  4V1A v;  1YYH A;  3P7I A;  2D9D A;  2X0L B;  4NPP A;  1TNO A;  3RI5 A;  1ELR A;  3AE8 A;  5G2N A;  3MEK A;  4XZ4 A;  3CV0 A;  5AFU L;  3KBU A;  1HCI A;  4ZZB A;  4Z68 A;  5JHB A;  2X51 A;  1BPO A;  5FTP A;  2QVA A;  4UWK A;  5AQ9 A;  1HXI A;  5E76 A;  2L0T B;  4P0A A;  2XQY A;  3G2S A;  1WAO 1;  3DSW A;  2JQQ A;  4G1T A;  3QB5 A;  3F31 A;  4U72 A;  3GN5 B;  2R02 A;  1H6P A;  4X1I E;  4JBW F;  4ZS3 A;  5H7P A;  4GA1 A;  3SD5 A;  2NTX A;  3PE0 A;  1UGO A;  2A9U A;  3L82 A;  4ZI2 D;  1TNU A;  3AS8 A;  1O3X A;  1VCT A;  4B89 A;  2UXX B;  3OTO T;  1GQE A;  3FUH A;  3ZGQ A;  3C3Q A;  4JI3 T;  1YXR A;  4PH4 B;  4HTE A;  2BF0 X;  3QAR A;  4IDN A;  3LBX A;  4DX6 D;  3P50 A;  5ENR D;  2XTL A;  4QHO A;  2MYS A;  3RPU A;  3MJW A;  4ZI7 E;  2LOS A;  3AJI A;  2ETA A;  2F0Y A;  3LVR E;  4EHM A;  3UUM A;  3APD A;  2V4L A;  1XDP A;  3CEQ A;  3R9M A;  4A3T A;  2CWY A;  2FJE A;  4XZC A;  3ZMS B;  1TNZ A;  2P9S G;  4C90 A;  4BSZ B;  2K3W A;  4HFV A;  5LBQ B;  4DUY T;  4HFH A;  3ZKJ A;  2AE9 A;  2WU5 A;  4ILH B;  3UFE A;  1OWL A;  4A56 A;  5FZR A;  3TWU A;  2P9N G;  3EUH A;  5L3D B;  5ABF A;  4CT0 A;  2FF4 A;  3ZT5 A;  5T8I A;  2D2S A;  2MAW A;  3ASO E;  5DQV A;  3L6A A;  1JPL A;  3UFG A;  4HI8 A;  2ZLY A;  1N33 T;  4I0U A;  4X20 E;  4YXD A;  3KV4 A;  4I50 E;  2WVI A;  3VTX A;  2F8Y A;  2J07 A;  4DUZ T;  3JAE A;  4Q94 A;  3ASH A;  5FVL A;  1UG3 A;  5CCM A;  3LG7 A;  2XUE A;  5ANL A;  4IN3 B;  4F53 A;  1EF1 C;  2IO2 C;  2JMH A;  5HXC A;  2YKS A;  3HRA A;  2OV8 A;  3UT7 A;  3APC A;  1OWN A;  2B0O E;  3RQU A;  3FH5 A;  3DEO A;  2KLQ A;  2EHO D;  3FUM A;  2V7J A;  1O5M A;  3AXJ A;  1B89 A;  1MIV A;  1HX8 A;  2UXB T;  3LSV A;  3R7R A;  3I9Y A;  4ILA A;  2A5U A;  2MOZ A;  2VKO A;  4OYS A;  4JVS A;  3E08 A;  4GKJ T;  5AQ7 A;  2OEV A;  2IEJ A;  4GPM A;  3E37 A;  2J47 A;  4PAG A;  4JI8 T;  3D9M A;  4L2L A;  5HRY A;  3GZ1 A;  5AQJ B;  4A97 A;  1Y64 B;  2H3R A;  2WU2 A;  3QC1 A;  2YEV C;  2FUP A;  3GZS A;  4FUL A;  4N39 A;  1N32 T;  1BI8 B;  1FJG T;  3I0O A;  2XQ7 A;  3EUV A;  1WFD A;  2LXM A;  3JUE A;  1TN8 A;  3MJX A;  5JDM A;  4MLP A;  3N9P A;  2XZE A;  4O6F A;  2CWO A;  3AAI A;  4N2S A;  4HRM B;  1L0V A;  3Q47 B;  2YK0 A;  3ZN1 B;  2PJQ A;  4X62 T;  1H2T C;  2LM9 A;  1MX2 A;  3AE2 A;  2XEE A;  4WZX A;  2Q9Q A;  2KM4 A;  1HO8 A;  2LM2 A;  3OXG A;  4EZK A;  2BKN A;  2J4G A;  1EDU A;  1UJK A;  5JJT A;  1ZOY A;  4DV7 T;  3U64 A;  4WBO A;  2E9X C;  2CPT A;  2K48 A;  3KEZ A;  4AOF A;  1NAF A;  4GZ5 A;  4G2A A;  2XM2 A;  4DMV A;  2QFC A;  3HKB E;  2C5J A;  2ZGG A;  3ZXP A;  3SQV A;  3CKD A;  4L1B A;  2IOS A;  5LA6 E;  5A23 A;  2NW9 A;  1JCQ A;  2ETC A;  1W3B A;  1HNX T;  4OK0 A;  4GZ3 A;  1Y8M A;  4J7W A;  4DR3 T;  2XPI A;  3ZU7 B;  3T8K A;  3UIN C;  4CRW A;  2XGO A;  4GTQ A;  3AU4 A;  4HGA A;  3FBL A;  2P2C P;  2H88 A;  2XY8 B;  3CVR A;  2WXO A;  4PK4 A;  5J1G A;  4R7L A;  4QH1 A;  3DXK G;  2NOX A;  4CQI A;  2C5K T;  1MJ0 A;  3KIN B;  4I2W A;  1UW4 B;  3ONX A;  2M63 A;  1E8Y A;  1LD8 A;  5ITZ F;  3EIJ A;  2XM1 A;  1LTX A;  3ZLI A;  1XMQ T;  1N54 A;  4FA6 A;  3ZUV B;  5HCJ A;  4HE8 A;  5JDF A;  2KXP B;  4DID B;  1YA0 A;  2UWJ G;  2NXP A;  4UQX A;  4WND A;  3DBS A;  4EQF A;  3PUW F;  4C9B B;  4HI9 A;  2L3L A;  3ZRH A;  4K0R A;  1E7V A;  2L6B A;  2YDS A;  4B3R T;  5FP3 A;  3AAA C;  3FDH A;  3FZL B;  4EV6 A;  1OED E;  3CSF A;  4FLB A;  1D1A A;  4EAH A;  1UUR A;  1DCQ A;  3LDQ B;  2YIN A;  3EAM A;  4W9R A;  3ASN E;  2KZT A;  4G2V A;  5DQW A;  2AVP A;  2X6I A;  4HS2 A;  1DCE A;  4M3O A;  2WXR A;  3ZCJ A;  3SRZ A;  4APF A;  4BY6 A;  4A5X A;  3Q75 A;  3IEE A;  3L8R A;  4GCN A;  5HEO A;  3R6N A;  3L39 A;  3LY7 A;  2XAH B;  1JNZ A;  4Y6C A;  1J1J A;  4FHJ A;  4H9S E;  2PG8 A;  2WP9 A;  4JEU A;  2XAQ B;  3O1H A;  1OT8 A;  4LF6 T;  2YHE A;  4LNB A;  3UU4 A;  4PW8 A;  3KFW X;  3P4R A;  3O9X A;  4LSZ E;  4TV3 A;  3LXU X;  1WDY A;  5DIZ A;  4G25 A;  3TGO A;  5FXV A;  1AP7 A;  3IV0 A;  3C3R A;  4CI1 B;  4NRH B;  4RSY A;  3ZFW A;  1V54 E;  4AQG A;  4WNE A;  3SGH A;  4LF5 T;  4YHJ A;  2UXC T;  4C0M A;  4G23 A;  1HS7 A;  1ZB1 A;  3SBS A;  3FHE A;  4BTB A;  3WG7 E;  3E30 A;  3PUZ F;  2WMN A;  2X6F A;  3IHR A;  3KDS E;  3PV0 F;  4HFG A;  4WW0 A;  3FBZ A;  4F3V A;  1HG2 A;  2VB6 A;  4B3S T;  2OOE A;  2WXJ A;  4O2B E;  5JDL A;  3FHN A;  2BTD A;  1N52 A;  3AG1 E;  2CXL A;  2E9X B;  4O60 A;  3F57 A;  2JLB A;  4JEH A;  2H6F A;  1I6Z A;  2FEZ A;  2LT3 A;  3CML A;  3DSU A;  4X8Q A;  2DCF A;  5JHA A;  4CI2 B;  3N9Q A;  3U3W A;  3PU8 A;  4NXN T;  5BW8 C;  3HKC E;  5AQH B;  3H3M A;  4TWD A;  2X9H A;  3NZP A;  4ATG A;  4ANJ A;  1NEN A;  4U0U A;  4HFC A;  3SFE A;  3ZN3 A;  4C0E A;  5FVK A;  2CRB A;  2J09 A;  4XX5 A;  3OVU A;  2V7L A;  5CFB A;  3HHM A;  1CHU A;  4COF A;  2LSI A;  4U3C A;  3N2K E;  4NUU A;  3TXM A;  2IW5 B;  4JYA T;  4X64 T;  2VK9 A;  1P5Q A;  3OTN A;  3ZCI A;  2VVS A;  2FO7 A;  3QWV A;  4ILG A;  5AIJ A;  5CBN A;  4U8V D;  2X66 A;  4IST A;  1KEY A;  2Y48 B;  3L08 A;  5LCW C;  3B7T A;  3D9J A;  3PJA J;  5EX0 A;  3CGH A;  3UU6 A;  3J9X 1;  4AIU A;  4EZL A;  1O1S A;  2DZO A;  5M72 A;  2V4H C;  3ZHE A;  3GWH A;  1HE8 A;  4RG6 A;  3AE6 A;  3VR9 A;  1ZV4 X;  3Q9D A;  4YHH T;  4LRZ A;  1V9D A;  4CDM A;  4DX1 A;  3E0Z A;  5EDS A;  4H9P C;  3MZK B;  4HNA D;  1MIW A;  1VCS A;  4GTV A;  4CZ2 D;  4TV8 E;  1TN7 A;  1X81 A;  3K3N A;  4U33 A;  1MZC A;  5JTG A;  3Q2M A;  3QNU A;  2V0P A;  3FZH B;  3IA3 A;  2OA5 A;  3ZYM A;  1T98 A;  2XAF B;  4AP2 A;  3E22 E;  3G2U A;  3IHY A;  2ZXW E;  3Q5M A;  2BKK B;  2IHR 1;  2KZT B;  4BTA A;  3C4Z A;  2CBJ A;  3D9K A;  1YD8 G;  2FBN A;  2ZIR A;  2NSZ A;  4IUL A;  3JCF A;  4EIW A;  2WXP A;  3AVS A;  4AQF A;  5KNG A;  4XAX B;  1S70 B;  2JEK A;  2Y4U A;  2X9X A;  3DSX A;  3QWP A;  4YSZ A;  1X9B A;  5AQL B;  4ISS A;  2JMK A;  1KNR A;  2J08 A;  2RKK A;  2DWK A;  4N3B A;  4DV3 T;  4ILU A;  5ENS D;  3LK3 B;  5DJQ C;  5DAB A;  3C72 A;  3FXD B;  3LK2 B;  5FWQ A;  3HXB A;  4QKN A;  1J5W A;  2NW8 A;  1H2V C;  2J4D A;  1HX1 B;  3KV9 A;  3UM2 A;  1ELW A;  2V8S V;  1KZP A;  3N2G E;  5LB7 B;  5FKY A;  3ZMU B;  4DV6 T;  4CYM D;  4ILB A;  3Q15 A;  3QUJ A;  4GZC A;  1S94 A;  3NZS A;  4WNF A;  2XPY A;  5BV0 A;  3QKY A;  1X5B A;  3LFM A;  2DWG A;  4U31 A;  1N4R A;  3JQ1 A;  2ZMA A;  2IU1 A;  2IJG X;  5C8Y E;  4U04 A;  3OKQ A;  5KDM C;  2QRX A;  3CVU A;  2CHN A;  2ZM2 A;  1SVX A;  4GPK A;  2L9B A;  3MCX A;  4IGU A;  3JC6 D;  2L0I A;  3AEB A;  4EGW A;  2WZH A;  2XQ8 A;  4H9R C;  3ETU A;  2LSK A;  1GW6 A;  3UUN A;  4X66 T;  4GCO A;  4YVQ C;  2M6B A;  2Y6X A;  3ONJ A;  4F1S A;  4GYY A;  2VGX A;  5JDH A;  3I9W A;  2EIM E;  3D9L A;  5T3R A;  1OXJ A;  5HXH A;  2AWI A;  3E4B A;  2F4V T;  4AIF A;  1AJ3 A;  2P9L G;  3ANW A;  3JXJ A;  4U63 A;  3N71 A;  4XKB A;  3U9W A;  5G55 A;  3FUN A;  3Q5X A;  5LHH B;  3SFZ A;  4L9P A;  2A4Z A;  2VL0 A;  2J49 A;  1Z6T A;  2P9U G;  2WQ7 A;  1W9R A;  4DR2 T;  2XPZ A;  1Z3Y A;  1IKN D;  5HS0 A;  3LCA A;  4CXY A;  4JD2 G;  2I59 A;  2DL1 A;  3W9G A;  2LSJ A;  5AQS B;  1O1R A;  1WYB A;  5TAO A;  4O2A E;  1YQ3 A;  2DIW A;  2V8S E;  2W62 A;  5L3C B;  5JRC A;  2CA5 A;  3FTU A;  2L8K A;  1XNR T;  2PQN A;  2NWB A;  5LBM A;  3UPV A;  5B1B E;  1K3Z D;  1IAP A;  3CVY A;  4WYV A;  3L13 A;  4U07 A;  1FVH A;  3ZPJ A;  3QK0 A;  4U2Y A;  2WQ6 A;  4UVB B;  5A1L A;  3FUE A;  5EK3 A;  1ZEE A;  1D0X A;  3I5P A;  4DBQ A;  2VTB B;  4TUM A;  4A1S A;  1D0Z A;  1ZKE A;  1D1B A;  2R17 C;  3ABK E;  4Q96 A;  2PL2 A;  2ODV A;  3NF1 A;  2E9X D;  1LD7 A;  3RC8 A;  4OYK A;  2IDO B;  3Q5E A;  2IY0 C;  3GA8 A;  4PDX A;  3R9A B;  4F6R D;  2FUL A;  3ZVV A;  3SHF A;  4ZEY A;  2RA1 A;  4U74 A;  1BR4 A;  3GZ2 A;  3VRB A;  2ZM8 A;  4NIQ A;  3P4W A;  1NI1 A;  2X38 A;  2E8I A;  3RIU C;  3TWV A;  3T5X A;  4DV1 T;  3EDT B;  2BKO A;  2LE8 A;  3DP7 A;  3DJB A;  3HG0 D;  3QOF A;  4JI4 T;  3CQG B;  3ESL A;  2LHN A;  3EHQ A;  4Z91 A;  4HWH A;  3QWW A;  2P9K G;  4TV9 E;  3ZSS A;  4JEU B;  3SO8 A;  2P9P G;  2XAG B;  1HZ4 A;  2VWA A;  1FMW A;  3SFD A;  4KMC A;  1BU9 A;  2LAH A;  4FLH A;  2FO1 E;  4ASK A;  2PZI A;  1OWA A;  3EAB A;  4AY6 A;  5LCW J;  2PBI A;  1NL4 A;  3QDN A;  5JVD E;  2CXF A;  4BJM A;  1KT1 A;  1FT2 A;  3PUY F;  3AE5 A;  2ES0 A;  2V6Y B;  1OED C;  1IHB A;  3E32 A;  3ASF A;  2XCC A;  1WY6 A;  4EPZ A;  3A7M A;  4EOZ B;  4JV5 T;  4BT9 A;  3B7S A;  1B7T A;  1FCH A;  4GB9 A;  4HLE A;  3EJN A;  1S63 A;  2XQ0 A;  4NIK A;  2ACX A;  2H6I A;  4N3A A;  3LDZ A;  2OVB A;  3PJA A;  3OAW A;  3LBX B;  1ZP0 A;  2V5Q C;  4I1M A;  4IDZ A;  4QH5 A;  5CEC B;  1VDY A;  4AIS A;  5ENN A;  3OYX A;  3PUJ A;  2CHX A;  3CVX A;  2YDR A;  3O4Z A;  3PZ2 A; 
#chains in the Genus database with same CATH homology
 5LXT E;  4I6J A;  4F6R C;  4I6G A;  1XNF A;  3PDN A;  1BR2 A;  4L0R A;  3VKH A;  4J8F A;  4LUN U;  4LER A;  4WUY A;  3CHP A;  3H37 A;  3HKE E;  4IE7 A;  3S2A A;  2Q9Q C;  3PRZ A;  4PFO A;  4U8H A;  4IE0 A;  4KT6 B;  5HXS A;  3ZJ2 A;  5FXZ A;  3PEU B;  1MMG A;  5CHE E;  5C1D A;  3PNT B;  2C5I T;  4UI9 C;  3LKU A;  4QX7 B;  2XRZ A;  4XI9 A;  3FEY A;  4YFS A;  3AA1 B;  5FY0 A;  2JPF A;  4O8S A;  1INZ A;  5KCM A;  2LSV A;  4UWH A;  4B94 A;  5GON E;  5LGU B;  5HWY A;  4UXN B;  3SZ7 A;  3MKR A;  1IZN B;  4UF0 B;  3CHR A;  3CR3 A;  4H9N C;  3PU3 A;  4TUY E;  4RVB A;  4N5C A;  3R7Q A;  3FH8 A;  2HR2 A;  4PS7 A;  3U3I A;  5HI7 A;  2D5U A;  4MBQ A;  1US7 B;  5KJM A;  5KMG P;  5L2L A;  1E7U A;  3FTW A;  2IAK A;  1QSD A;  3ANW B;  4AV7 A;  4TN7 B;  4G24 A;  1SA0 E;  5EK4 A;  5JR9 B;  3LVQ E;  4TZ4 C;  4GK5 E;  2V5F A;  4UV9 B;  3L16 A;  3GYZ A;  3CWZ B;  4UEM A;  4I2Z A;  4JW1 A;  4L2Y A;  4JXT A;  2VL8 A;  1SZ9 A;  3CK7 A;  3G2T A;  4GU5 A;  4EXT A;  2X67 A;  1D1C A;  2VQ2 A;  5LP0 A;  3C4W A;  3RYI E;  3FB2 A;  4I9C A;  2V7M A;  3DPD A;  4AKL A;  2SPC A;  4IIJ E;  3KVB A;  4MFR A;  3CIA A;  2WXI A;  2NW7 A;  4DLQ A;  3RIB A;  4GOU A;  1QZ2 A;  3HI2 A;  4CXW A;  4UWG A;  4J8E A;  3UT4 A;  4OYJ A;  4FC8 A;  2LO6 A;  5CA0 E;  3S7D A;  4BX8 A;  4I6E A;  2X3M A;  5LP6 E;  2LJL A;  2X6K A;  4GA2 A;  3S7F A;  3S7J A;  2A72 A;  5HYA A;  4MHC A;  1IQR A;  4N78 D;  3D9I A;  2Q9Q B;  3C4X A;  5JQG E;  5L3G B;  3QNK A;  3SWH A;  3BQL A;  3A5X A;  3RK6 A;  1KLX A;  2CFU A;  5H6R B;  5ETW A;  4J8S A;  5FJY A;  1IYG A;  3EDV A;  3FFL A;  1MHQ A;  1H2U A;  3KVA A;  1EPU A;  3HIZ A;  2C0L A;  2R5S A;  3QAQ A;  3VLF A;  3BG0 B;  3CHS A;  1U5P A;  4KMO A;  1UX5 A;  3FU5 A;  4HOU A;  1H0A A;  2Z6E A;  3B7R L;  4FJZ A;  4UQZ A;  4HOS A;  1H7C A;  3WAK A;  1U3D A;  3MYV A;  3BQI A;  1U3C A;  4ANU A;  1FEW A;  5KJN A;  4BT8 A;  4PJJ A;  1KT0 A;  4HKA A;  5HQ8 A;  3ZIM A;  2Y8D A;  3PVL A;  2PM6 A;  2K5B B;  3N9L A;  4TX5 A;  4ZI2 C;  2MRI A;  4YVO A;  4C91 A;  4AKR B;  4ANX A;  3QJZ A;  3FUJ A;  5F8P A;  3CVQ A;  3Q4A B;  5LCY A;  3HYM B;  5E75 A;  1LVK A;  2CHZ A;  5G05 C;  1YKH B;  5EK2 A;  1WLX A;  4IHJ E;  1CUN A;  3IHV A;  4DI3 A;  1E1H B;  2WB2 A;  5HXR A;  4DMW A;  3W15 B;  4RG9 A;  4AXP A;  3AS4 A;  3HVE A;  5KJL A;  3RH3 A;  2XHE A;  3UUX A;  2VKJ A;  4N2Q A;  4O4I E;  4CCA A;  3QB2 A;  2XAS B;  5J2T E;  3ZEF B;  3CHQ A;  3ULQ A;  2A2F X;  3CKB A;  3ZC1 A;  3FUI A;  3CK9 A;  2V7I A;  5LOV E;  4ERR A;  4I43 B;  1OWM A;  5FQ6 A;  2MTQ A;  3KBT A;  3AU5 A;  3N9M A;  2VGX B;  3K8P C;  2PQR A;  3IBE A;  3TG5 A;  4ZI3 C;  5BT1 A;  3QOU A;  2DBA A;  5FYM A;  1L5J A;  4UVC B;  4A55 A;  3TJP A;  4HOQ A;  3L17 A;  2E2E A;  3PUR A;  4AKH A;  3UUL A;  4J0U A;  4E85 A;  4QXB B;  4PS8 A;  2CM0 A;  1E96 B;  5FT9 A;  2C0M A;  3CX7 B;  5L3F B;  3L3P A;  2HM8 A;  1X79 A;  1G8X A;  4APO A;  5FZQ A;  4TRQ A;  1TEZ A;  4O4H E;  2HYZ A;  4I1O B;  4AM9 A;  4G11 A;  3RKV A;  4HVB A;  2Q9Q D;  1PAQ A;  3I3N A;  5BNW A;  4UQY A;  5JH7 E;  2LSU A;  2CCQ A;  1E8X A;  4WWO A;  2X9Y A;  4L23 A;  4FAD A;  4L9I A;  4MKT A;  3SNX A;  3RYF E;  3K3Q C;  3TG4 A;  5D0O D;  4BA9 A;  4B8C B;  3MV3 B;  2MOW A;  4UEL A;  1MMN A;  5F3J A;  3P1U A;  3G2W A;  1LVF A;  2PM7 A;  4NQ0 A;  4U0S A;  3PS6 A;  2OVF A;  4LCT A;  4DI4 A;  4CZZ B;  4E7Z A;  2BVL A;  1IJ6 A;  2ZU6 B;  2VSX E;  2AXV A;  4KBQ A;  3AA7 B;  2MHK A;  3T8M A;  3MK7 C;  1Z0P A;  4YND A;  4IE4 A;  3PUS A;  2V1D B;  3PZD A;  3ZXS A;  4CI3 B;  4PS3 A;  2DCP A;  4KP3 C;  3ENE A;  5JRC B;  5ANR A;  4B8A A;  2EQX A;  4WWN A;  4H9O C;  5JR9 A;  2WXQ A;  1WYC A;  3WI3 A;  1UN9 A;  3TXN A;  4JHK A;  4J6I A;  4KBM B;  3GMI A;  2RD0 A;  3ZMZ B;  1UX4 A;  5JDQ A;  3D0T A;  1JUQ A;  2PFV A;  2R59 A;  3RC3 A;  3Q5W A;  3F2E A;  3HR0 A;  3CHO A;  1A17 A;  4JHR A;  3LJ3 A;  3RRU A;  3NBX X;  1VOM A;  3FUD A;  3SI5 A;  4PK5 A;  2YHC A;  3SOL A;  2VYI A;  4I17 A;  2BUG A;  4MLK A;  2VSO E;  1DVP A;  1SHZ C;  2J4B A;  2P9B A;  3FU0 A;  2VAS A;  3NRY A;  4AQF C;  4CGV A;  3ZC0 A;  5LHG B;  2HH7 A;  4QWN B;  3FTY A;  3ZPO A;  2GRL A;  4GAA A;  2YNQ A;  5L3E B;  3IKO B;  3BG1 B;  2EHO C;  4Y6W A;  3HL6 A;  5FXW A;  3LYA A;  5FY1 A;  2LOP A;  3EDU A;  3MV2 B;  4JA9 A;  4ZS2 A;  2IQC A;  2Y3A A;  3L22 A;  3EHN A;  3JC6 C;  4Z8X A;  4ILI A;  3AS5 A;  4KVM A;  4EYU A;  2WXG A;  3KD7 A;  4JHJ A;  4P29 A;  4GYO A;  2KWH A;  2ZM0 A;  5JR9 C;  1HU3 A;  1UCU A;  4ZI3 D;  1WM5 A;  4O4J E;  4FHK A;  5FNV E;  4KZC A;  3MA5 A;  4PJL A;  1KK7 A;  4GIW A;  4P0B A;  4EBA A;  4EEC A;  3IEG A;  4NUR A;  5ARG A;  5CCL A;  4GZD A;  4JA7 A;  5JJ7 A;  2I6H A;  4YJ2 E;  2IF4 A;  3B13 A;  2GW1 A;  3D9N A;  3ASG A;  4HXI A;  3O4X E;  4IE6 A;  2L6J A;  3LY8 A;  1TJC A;  2B1E A;  2W0G A;  3JQ0 A;  4ANV A;  1IJ5 A;  1MMD A;  4B6X A;  1EYH A;  3EVY A;  4XIF A;  1NZN A;  3CX6 B;  1U4Q A;  3PUQ A;  2HPJ A;  1MND A;  2VGY A;  4DBR A;  3HDX A;  4NUV A;  3BEE A;  2AW6 A;  4N3C A;  5FZS A;  4DVD A;  3ZYK A;  5D0Q D;  2GRM A;  4GK0 E;  2P58 C;  2WXF A;  2JRK A;  5EX3 A;  5LGT B;  1WR6 A;  4ACK A;  1NP7 A;  2IFU A;  2EHO B;  1OUV A;  2CLY B;  1ELK A;  3D3M A;  1VRB A;  4WNK A;  5BV1 A;  1MQS A;  1XGW A;  4WWP A;  3M65 A;  3FY4 A;  4J8D A;  1S0P A;  3MAC A;  4MRU A;  2WXL A;  2VKH A;  2XRY A;  5AJL A;  3PNL B;  1SZA A;  4GA0 A;  4H7Y A;  2RG8 A;  3B7U X;  2H7O A;  5A6C A;  4K03 A;  3CLJ A;  5BPP A;  2EHO A;  3ZHE B;  4NAC A;  4XE0 A;  3Q49 B;  4ADZ A;  4PJN A;  3FXE B;  3PDY A;  3RRW A;  3FH7 A;  3FTZ A;  3CVL A;  5J08 A;  2DHR A;  2AXZ A;  4KZ0 A;  1IQU A;  5LYJ E;  4JUY A;  3JUI A;  1UN8 A;  3RJV A;  4GYS A;  3FUK A;  2J9Q A;  3PE4 A;  3NQP A;  1IHG A;  5G04 C;  3NZU A;  4PUC A;  4DO0 A;  3RYH E;  1H19 A;  1MIY A;  2MBG A;  2E9X A;  3CVV A;  4H7X A;  5CMW A;  4H63 H;  5AYW D;  3MZL B;  4JC8 A;  4UI9 K;  2HO1 A;  4MAL A;  1ZBP A;  1NA0 A;  1FMV A;  4O4L E;  5LJN A;  2WXN A;  5IHY A;  4KVO A;  2JJ9 A;  3BK9 A;  1S35 A;  4CEM A;  2LHR A;  4U0Z A;  3MKQ A;  2Q7F A;  2CG3 A;  3FUF A;  3ML8 A;  2W00 A;  4EZJ A;  3N9O A;  3V5S A;  3ML9 A;  4GML A;  3RU0 A;  2UXN B;  4XKC A;  2N9D A;  1OXZ A;  2KWI B;  5G04 J;  4I1A A;  2Y4T A;  3MKD A;  4QXH B;  5H6Q B;  3AVR A;  4PK6 A;  1PC2 A;  1LKX A;  5FMN A;  3L54 A;  3U4T A;  3ZMV B;  3CST A;  1PY1 A;  5KX5 E;  2CMR A;  3UT5 E;  5LX8 A;  3FTS A;  3UT8 A;  3VTY A;  3VLD A;  3MX3 A;  2D0U A;  3S7B A;  2N1G A;  2IC6 A;  4I55 E;  2WBL A;  2QY7 A;  3C64 A;  3SF4 A;  3C51 A;  4PNI A;  5EZY E;  5HWX A;  2I1K A;  3CVP A;  3WXX A;  2GGF A;  3S4U A;  3O48 A;  2M67 A;  2W63 A;  2AXU A;  5DBK A;  2WXM A;  3IBP A;  4FJO A;  4FP7 A;  3I4G A;  3KS2 A;  4XI0 A;  3ZW3 A;  2VSY A;  3FWV A;  2WMO A;  4TUU A;  3PRE A;  3IF8 B;  4OFZ A;  3OXL A;  3TAX A;  2X6J A;  4X1Y E;  4CXX A;  3AA6 B;  2CE7 A;  2XEV A;  4UIG A;  1LRZ A;  1NA3 A;  2IC9 A;  3AA0 B;  2V7K A;  4UVA B;  3CK8 A;  5KJK A;  1Y6I A;  2NTY A;  3BQK A;  3I0Q A;  5IYZ E;  3OYZ A;  2XAJ B;  3PUA A;  2DLR A;  3C98 B;  4HN9 A;  5J90 A;  2C0S A;  3PTR B;  2WM9 A;  5M4Y A;  4FJY A;  5FQ8 A;  4DND A;  5LG4 A;  2IOL A;  3SBT B;  4I4T E;  4DJA A;  2WQH A;  4EZH A;  3CQC B;  3O1I A;  3ZYL A;  3CQX C;  4H9Q C;  2I2O A;  5EKQ D;  5HAX A;  4UV8 B;  5AEN A;  4GYR A;  2ILR A;  4P09 A;  2K24 A;  1LF8 A;  4ME2 A;  3FUL A;  3RRC A;  4ABN A;  5E0O A;  2WXK A;  2LAI A;  3N9N A;  5JJ6 A;  1D0Y A;  2LSG A;  1FVF A;  3ZYQ A;  4QFV A;  1YW0 A;  3CVW A;  2WSS V;  2YU1 A;  5CA1 E;  2OND A;  3OJA A;  4BSX A;  3ZN0 B;  2RP4 A;  3JCK C;  2KMF A;  3UQ3 A;  1H6K A;  5AJD A;  5FXX A;  3FU3 A;  5FQ7 A;  3TKL B;  3P8C D;  3FEX A;  4EBA G;  3EIQ C;  3EHM A;  2H7V C;  5JDG A;  4WBN E;  3MGB A;  3FU6 A;  3FTX A;  2KND A;  1E8W A;  1E90 A;  4WNG A;  1KNZ A;  1QNF A;  3UUX B;  1YKE B;  3HKD E;  1HH8 A;  1QUU A;  3RO3 A;  3ASD A;  3LS8 A;  3CHM A;  5LOZ A;  4GYW A;  5HXE A;  3RYC E;  3OBV E;  3ZEF A;  2ODU A;  1BR0 A;  4L7T A;  1WRD A;  4FI5 A;  4HOR A;  3U78 A;  1OWO A;  1MMA A;  2BDE A;  2YU2 A;  4GMJ A;  3D9P A;  2LSY A;  3QC9 A;  4EZ4 A;  4DLO A;  3LY9 A;  2KCL A;  3RO2 A;  2A3D A;  1E8Z A;  5FY7 A;  3B57 A;  4XBF B;  3ONK A;  5CMY A;  3LEW A;  4L5G A;  4CDR A;  4AJW A;  2C2L A;  4MS6 A;  4FU3 A;  3PH0 C;  4CGW A;  3J7Y q;  2UY1 B;  4IYP A;  4BX9 A;  2CLY C;  2CEA A;  1UJJ A;  4LEU A;  3CX8 B;  4H63 V;  4CT4 A;  3V5U A;  5C2Y A;  3CPZ A;  2CHW A;  3G2V A;  3JYS A;  4ACL A;  1JWF A;  1OWP A;  1MNE A;  4E6H A;  2NC9 A;  4IRU A;  5BUZ A;  1G73 A;  3LK4 2;  5ARF A;  2VSN A;  4AVX A;  1HS6 A;  2BZB A;  4BAY B;  4OHF A;  2N2N A;  3CVN A;  5L3B B;  1QQE A;  5J2U E;  5A7D B;  3ZMT B;  3KAE A;  5BMV E;  3U66 A;  4UWL A;  4KUM B;  2KT9 A;  2BVM A;  3UX4 A;  2WPV A;  4KXK B;  4D10 C;  3GN5 A;  3HVE B;  3FP3 A;  2FI7 A;  4UI9 J;  1HF8 A;  2GK9 A;  4JPS A;  3N2O A;  2XGM A;  3AAA B;  4YJ3 E;  4KYO B;  2DI4 A;  5ADX L;  4B0Z A;  4AEZ C;  1TJF A;  4URK A;  2KCV A;  3WAJ A;  4A1G A;  2YQ8 A;  4E7S A;  4DPR A;  3UMV A;  2KIN B;  2QA7 A;  4AY5 A;  2D0T A;  4GZ6 A;  4JEH B;  3RRM B;  4OVU A;  4YLH A;  4BFR A;  3PE3 A;  2HPL A;  3DTO A;  4PJM A;  3OXF A;  5CB4 E;  4QXC B;  2J1D G;  4OVV A;  3LPZ A;  3KV5 A;  3T5V A;  3NZQ A;  4JL0 A;  2NP9 A;  4UWF A;  2L9Q A;  4AKG A;  5LJM A;  3SS1 A;  3QK6 A;  3I4R B;  3VLE A;  3H3A A;  1HTJ F;  2V26 A;  4F7A A;  2DNX A;  3URZ A;  4EB6 E;  2XGS A;  1HFA A;  5JRE A;  2VTB A;  4AI6 A;  1ZHC A;  3R84 B;  4BWR A;  3VU7 H;  3NRX A;  3ESK A;  4V3I A;  2G0U A;  4Q69 A;  3T8O A;  3P2B A;  1FIO A;  2WAU A;  4X1K E;  3HA4 A;  3C98 A;  2UY1 A;  3VKG A;  4I43 A;  5T4Y A;  2K9A A;  4AXH A;  3ETV A;  2VJ8 A;  3GW4 A;  1Z3X A;  5G05 J;  3FTV A;  3ZJ1 A;  3PEV B;  1SQM A;  3ONL A;  2QGS A;  2I9C A;  2XHE B;  5LFA A;  3AAE B;  2CFZ A;  4G26 A;  2X6H A;  4I9E A;  4JZY A;  3RRN B;  1ZU2 A;  4M1P A;  2LNI A;  2X9W A;  3C50 A;  3MXZ A;  2WWU A;  5LHI B;  3D9O A;  1JWG A;  3TL5 A;  4BJN A;  2KZ7 B;  4G63 A;  2E0I A;  4QX8 B;  4EYY R;  2X68 A;  4JLE A;  2XCB A;  3PUG A;  3N5L A;  3I1A A;  4ZOL E;  3PUK A;  2I1J A;  2W61 A;  2VKD A;  1NWM X;  1BR1 A;  4HEA A;  1EZ3 A;  3K9I A;  4UF0 A;  4CDN A;  3KV6 A;  2WXH A;  3UTK A;  3CKC A;  5FQ4 A;  2KC7 A;  2LEH A;  3AB3 B;  4K0U A;  4ZHQ E;  4IE5 A;  2ION A;  3LJC A;  5LNK A;  2KAT A;  3L09 A;  1HG5 A;  3RKO A;  3RX6 A;  4HOT A;  4A3V A;  4PFP A;  3VHL A;  4J2C A;  5LGN B;  2CXD A;  5JDN A;  3O1J A;  3APF A;  4AKI A;  1DNP A;  2CG2 A;  2KCK A;  3K3O A;  4ANW A;  4DK5 A;  3MKQ B;  3MA9 A;  4V1A v;  3P7I A;  2X0L B;  1ELR A;  5G2N A;  3MEK A;  4XZ4 A;  3CV0 A;  5AFU L;  3KBU A;  1HCI A;  5JHB A;  2X51 A;  1BPO A;  5FTP A;  4UWK A;  1HXI A;  5E76 A;  2L0T B;  4P0A A;  2XQY A;  3G2S A;  1WAO 1;  2JQQ A;  4G1T A;  3F31 A;  4U72 A;  3GN5 B;  4X1I E;  4ZS3 A;  4GA1 A;  3SD5 A;  2NTX A;  3PE0 A;  4ZI2 D;  3AS8 A;  1O3X A;  4B89 A;  2UXX B;  3FUH A;  3ZGQ A;  4PH4 B;  4HTE A;  3QAR A;  2BF0 X;  3LBX A;  2XTL A;  4QHO A;  2MYS A;  3RPU A;  3MJW A;  4ZI7 E;  2LOS A;  3LVR E;  3UUM A;  3APD A;  2V4L A;  3CEQ A;  4A3T A;  2CWY A;  4XZC A;  3ZMS B;  4C90 A;  4HFV A;  5LBQ B;  4ILH B;  3UFE A;  1OWL A;  4A56 A;  5FZR A;  3EUH A;  5L3D B;  4CT0 A;  2FF4 A;  5T8I A;  2D2S A;  5DQV A;  3L6A A;  1JPL A;  2ZLY A;  4X20 E;  3KV4 A;  4I50 E;  2WVI A;  3VTX A;  2J07 A;  4Q94 A;  3ASH A;  1UG3 A;  5CCM A;  3LG7 A;  2XUE A;  5ANL A;  4IN3 B;  4F53 A;  1EF1 C;  2JMH A;  5HXC A;  3UT7 A;  2OV8 A;  3APC A;  1OWN A;  3FH5 A;  2KLQ A;  2EHO D;  3FUM A;  2V7J A;  1B89 A;  1MIV A;  1HX8 A;  3R7R A;  3I9Y A;  2A5U A;  2MOZ A;  2VKO A;  4OYS A;  4JVS A;  3E08 A;  4PAG A;  3D9M A;  4L2L A;  3GZ1 A;  1Y64 B;  2H3R A;  3QC1 A;  2YEV C;  3GZS A;  4FUL A;  4N39 A;  3I0O A;  3MJX A;  5JDM A;  4MLP A;  3N9P A;  4O6F A;  2CWO A;  3AAI A;  4N2S A;  3Q47 B;  2YK0 A;  3ZN1 B;  2PJQ A;  1H2T C;  2LM9 A;  2Q9Q A;  2KM4 A;  1HO8 A;  3OXG A;  4EZK A;  1EDU A;  1UJK A;  5JJT A;  3U64 A;  4WBO A;  2E9X C;  2K48 A;  3KEZ A;  4AOF A;  1NAF A;  4GZ5 A;  4G2A A;  4DMV A;  2QFC A;  3HKB E;  2C5J A;  3CKD A;  4L1B A;  2IOS A;  5LA6 E;  5A23 A;  2NW9 A;  1W3B A;  4OK0 A;  4GZ3 A;  1Y8M A;  2XPI A;  4CRW A;  2XGO A;  3AU4 A;  4HGA A;  3FBL A;  3CVR A;  2WXO A;  4PK4 A;  5J1G A;  4R7L A;  2NOX A;  4CQI A;  2C5K T;  4I2W A;  3KIN B;  1UW4 B;  3ONX A;  2M63 A;  1E8Y A;  3EIJ A;  3ZLI A;  1N54 A;  4FA6 A;  5JDF A;  4HE8 A;  1YA0 A;  2KXP B;  4UQX A;  4WAF A;  2UWJ G;  2NXP A;  4WND A;  4EQF A;  3DBS A;  4C9B B;  2L3L A;  3ZRH A;  4K0R A;  1E7V A;  5FP3 A;  3FDH A;  3CSF A;  4FLB A;  1D1A A;  4EAH A;  2YIN A;  4W9R A;  2KZT A;  4G2V A;  5DQW A;  2AVP A;  2X6I A;  4HS2 A;  4M3O A;  2WXR A;  3ZCJ A;  3SRZ A;  4APF A;  4BY6 A;  3IEE A;  4GCN A;  3R6N A;  4Y6C A;  3LY7 A;  2XAH B;  4FHJ A;  4H9S E;  2PG8 A;  4JEU A;  2XAQ B;  3O1H A;  2YHE A;  4PW8 A;  3KFW X;  3O9X A;  4TV3 A;  3LXU X;  5DIZ A;  4G25 A;  3TGO A;  5FXV A;  3IV0 A;  4CI1 B;  4NRH B;  4RSY A;  3ZFW A;  4AQG A;  4WNE A;  3SGH A;  4YHJ A;  4C0M A;  4G23 A;  1HS7 A;  3SBS A;  3FHE A;  4BTB A;  2WMN A;  2X6F A;  3IHR A;  3KDS E;  4HFG A;  4WW0 A;  3FBZ A;  4F3V A;  1HG2 A;  2VB6 A;  2OOE A;  2WXJ A;  4O2B E;  5JDL A;  3FHN A;  2BTD A;  1N52 A;  2CXL A;  2E9X B;  3F57 A;  2JLB A;  4JEH A;  2FEZ A;  2LT3 A;  3CML A;  2DCF A;  5JHA A;  4CI2 B;  3N9Q A;  3U3W A;  3PU8 A;  5BW8 C;  3HKC E;  2X9H A;  3NZP A;  4ATG A;  4ANJ A;  4U0U A;  3ZN3 A;  4C0E A;  2J09 A;  4XX5 A;  2V7L A;  3HHM A;  2LSI A;  3N2K E;  4NUU A;  3TXM A;  2IW5 B;  1P5Q A;  2VK9 A;  3OTN A;  3ZCI A;  2FO7 A;  3QWV A;  4ILG A;  5AIJ A;  2X66 A;  4IST A;  2Y48 B;  3L08 A;  5LCW C;  3B7T A;  3D9J A;  5EX0 A;  3CGH A;  4EZL A;  3J9X 1;  5M72 A;  3ZHE A;  3GWH A;  1HE8 A;  4RG6 A;  1ZV4 X;  3Q9D A;  4LRZ A;  1V9D A;  4CDM A;  3E0Z A;  5EDS A;  4H9P C;  3MZK B;  1MIW A;  4TV8 E;  3K3N A;  3Q2M A;  2V0P A;  2OA5 A;  3ZYM A;  1T98 A;  2XAF B;  4AP2 A;  3E22 E;  3G2U A;  3IHY A;  3Q5M A;  2KZT B;  4BTA A;  3C4Z A;  3D9K A;  1YD8 G;  2FBN A;  2NSZ A;  4IUL A;  4EIW A;  2WXP A;  3AVS A;  4AQF A;  4XAX B;  2JEK A;  2Y4U A;  2X9X A;  3QWP A;  4ISS A;  2JMK A;  2J08 A;  2DWK A;  4N3B A;  4ILU A;  3LK3 B;  5DJQ C;  5DAB A;  3FXD B;  3LK2 B;  5FWQ A;  4QKN A;  2NW8 A;  1H2V C;  2J4D A;  3KV9 A;  1ELW A;  3N2G E;  3ZMU B;  3Q15 A;  3QUJ A;  4GZC A;  1S94 A;  3NZS A;  4WNF A;  2XPY A;  5BV0 A;  3QKY A;  1X5B A;  3LFM A;  2DWG A;  3JQ1 A;  2ZMA A;  2IU1 A;  2IJG X;  5C8Y E;  4U04 A;  3OKQ A;  5KDM C;  3CVU A;  2ZM2 A;  4GPK A;  2L9B A;  3MCX A;  4IGU A;  3JC6 D;  2L0I A;  4H9R C;  3ETU A;  2LSK A;  1GW6 A;  3UUN A;  4GCO A;  4YVQ C;  2Y6X A;  4F1S A;  4GYY A;  2VGX A;  5JDH A;  3I9W A;  3D9L A;  5T3R A;  5HXH A;  2AWI A;  3E4B A;  4AIF A;  1AJ3 A;  3ANW A;  4U63 A;  3N71 A;  4XKB A;  3U9W A;  5G55 A;  3FUN A;  3Q5X A;  5LHH B;  3SFZ A;  2A4Z A;  2J49 A;  1Z6T A;  2WQ7 A;  2XPZ A;  1Z3Y A;  3LCA A;  4CXY A;  2I59 A;  2LSJ A;  1WYB A;  5TAO A;  4O2A E;  2DIW A;  2V8S E;  2W62 A;  5L3C B;  5JRC A;  2CA5 A;  3FTU A;  2L8K A;  2PQN A;  2NWB A;  5LBM A;  3UPV A;  1IAP A;  3CVY A;  3L13 A;  4U07 A;  1FVH A;  3ZPJ A;  3QK0 A;  2WQ6 A;  4UVB B;  5A1L A;  3FUE A;  5EK3 A;  1ZEE A;  1D0X A;  3I5P A;  4DBQ A;  2VTB B;  4A1S A;  1D0Z A;  1ZKE A;  1D1B A;  2R17 C;  4Q96 A;  3NF1 A;  2PL2 A;  2ODV A;  2E9X D;  3RC8 A;  4OYK A;  3GA8 A;  4PDX A;  3R9A B;  2FUL A;  3ZVV A;  3SHF A;  2RA1 A;  4U74 A;  1BR4 A;  3GZ2 A;  2ZM8 A;  2X38 A;  2E8I A;  3T5X A;  3EDT B;  2LE8 A;  3DP7 A;  3DJB A;  3CQG B;  3ESL A;  2LHN A;  3QWW A;  4TV9 E;  4JEU B;  2XAG B;  1HZ4 A;  2VWA A;  1FMW A;  4KMC A;  2LAH A;  4FLH A;  4ASK A;  2PZI A;  1OWA A;  4AY6 A;  5LCW J;  2PBI A;  3QDN A;  5JVD E;  2CXF A;  4BJM A;  1KT1 A;  2ES0 A;  3ASF A;  2XCC A;  1WY6 A;  4EPZ A;  4EOZ B;  4BT9 A;  3B7S A;  1B7T A;  1FCH A;  4GB9 A;  4HLE A;  3EJN A;  2XQ0 A;  2ACX A;  4N3A A;  3LDZ A;  2OVB A;  3OAW A;  3LBX B;  4I1M A;  4IDZ A;  1VDY A;  5ENN A;  3OYX A;  3PUJ A;  2CHX A;  3CVX A;  3O4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...