1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
b'GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
1ELKA 1SZAA 1HFAA 5CMWA 5LP0A 1VDYA 3D9NA 3G2SA 1LF8A 1EDUA 2L0TB 4AVXA 1H0AA 1MHQA 4FLBA 1UJJA 1X5BA 2MOWA 3LDZA 3D9OA 4NACA 1JUQA 3D9MA 4Q96A 1UJKA 3D9KA 3CLJA 4Q94A 3ZYLA 3G2TA 3ONLA 1HX8A 5LOZA 2BF0X 1INZA 1HG5A 1JWFA 5CMYA 2V8SE 1JWGA 3ZYMA 2LO6A 3D9PA 3G2UA 3G2VA 2DIWA 3D9IA 2L0IA 3ZYQA 4HFGA 5J08A 1HF8A 3G2WA 1DVPA 3RRUA 3ONKA 4JXTA 1HG2A 1SZ9A 2DCPA 1EYHA 2QY7A 4FU3A 3D9JA 4GZDA 1JPLA 3D9LA 3ZYKA 2KM4A 1PY1A 4GZCA 1XGWA
chains in the Genus database with same CATH superfamily
2LSVA 3MZLB 3CIAA 4MHCA 3KEAA 2J47A 3G2SA 1T7SA 2X51A 3ONLC 1N52A 1MMDA 3PUAA 3RKVA 1UOHA 5FYMA 4I1MA 3BG0B 3LKUA 4GA0A 4NRHB 4BEPA 3C4XA 2FO7A 4JEHB 4L2YA 2F8YA 4ANXA 2LSYA 3NOGD 5G2NA 4LCTA 1S63A 4I55E 2WXKA 4FULA 3FUIA 3FUNA 1XNQT 1IAPA 1H6PA 1WR6A 2V5CA 2NWBA 2X66A 1TNUA 3UKUG 2Y8DA 3AEAA 4BX9A 3URZA 4GB9A 4U0ZA 3ASNE 3PV0F 3HXFA 2CLYB 3RRMB 3UU3A 1MX2A 2ETBA 3AS4A 3SZ7A 5JTGA 3OPCA 3EI0A 4J8DA 4XKCA 2ETAA 4AEZC 5LB7B 4YTPA 3NAWA 4MBGA 3JYSA 3BQKA 4O4HE 5H6RB 3HHMA 3S7FA 2V4HC 5JDNA 4ZZCA 1W9RA 4YSXA 5AENA 4I1AA 5LCWJ 2VWAA 4M7CA 3FUHA 3P4RA 3UUXB 4WBNE 3Q47B 1IZNB 4A3TA 3FTWA 5CEDB 4X65T 2WQYA 1OCCE 3CVYA 2WY2A 3C50A 1N11A 3J9X1 4JHKA 2VQ2A 2I1JA 2MYSA 3VKHA 2KT9A 5HWYA 4WNGA 3I5PA 3TJPA 2WP9A 4BERA 2DHRA 2KMFA 4RLYA 3TAXA 1XZYA 2MPKA 1OEDB 3FZKB 3QNUA 4N2SA 3AE1A 2BEDA 2DVWA 1LVFA 2X38A 4FJZA 4BSZB 3VTYA 4RG9A 2BG9B 5LOZA 2WXMA 4WNEA 2KC7A 3EHZA 5J2UE 4I43B 4DLOA 1YKHB 4N78D 4YVQC 4ANUA 4UVBB 4WWNA 3RX6A 2MTQA 4KMOA 2XS8A 4AIUA 3Q15A 4XEIG 2EIJE 2RP4A 5CFBA 2VSOE 3ZPJA 2VQET 3RYHE 4G11A 4GCOA 3DSUA 1KZOA 1LD7A 2LXLA 3TG4A 1WAO1 3RIBA 3C3OA 3FUJA 2A3DA 3LJ3A 4IGUA 2EIKE 1HS6A 5C3JA 2E5VA 2FJBA 4DR1T 1BI7B 3VLEA 1K3ZD 1NL4A 4QXHB 4KVMA 2X0YA 3DBSA 2X3MA 4W9RA 3LK3B 3QB5K 2W67A 4GTVA 3TLVA 1NFIE 2GGFA 4CXXA 4U95D 4ANWA 5DABA 1E8ZA 3QC1A 3L22A 3N9QA 2V8SV 3Q5DA 3C3RA 3IBEA 1HCIA 2ETCA 3CKDA 4UWLA 3UQ7A 2LHNA 1O5MA 4BTAA 3DSWA 1KK7A 3BK9A 1BD8A 1YKEB 2IIUA 2W62A 2VKOA 1M7KA 4AM9A 4K5BA 1KEYA 1JPLA 4WWPA 4CI2B 5ENOD 2KLQA 2XZDG 2Y6XA 3KV6A 4ILUA 3EUVA 4KZCA 2FEZA 5FJYA 3N9MA 3R6NA 2YU2A 3RQUA 4DV0T 5KJNA 3PUWF 3RIUA 4YDOA 4YTNA 3O4XE 3V2XA 3R9MA 4IDPA 1ZU2A 1BR2A 5IYZE 4C90A 1MIYA 2A2FX 5JJ7A 4JI6T 2FF4A 3TWRA 5HAXA 2FO1E 5KNGA 3ZIMA 1ZV4X 4EIWA 3DXKG 2LM9A 3U9WA 5AQGB 4ANJA 2ZGDA 3H37A 4TUYE 1NZNA 3SO8A 3L39A 1SZAA 1HFAA 3D9NA 3CKBA 3HRAA 4DR5T 2X0LB 3CLJA 3CQXC 3HYMB 4PS3A 4OAUC 5AQQB 5EK3A 2E2AA 1JWFA 1I94T 5AQLB 3IEGA 3B7RL 3ONJA 4JLEA 3MACA 1VCSA 1FJGT 3MZKB 3CIRA 3AE2A 2ODVA 3R84B 4U96D 4O8SA 5HWXA 3ASGA 3SHFA 4JZYA 1W0BA 2R17C 1IQUA 2BKGA 4Z91A 2M6BA 2QYJA 2IOLA 4P0AA 1WFDA 4IT4A 2UXDT 3S4UA 1S0PA 1Z6TA 1L0VA 3APDA 3RJVA 4CCAA 2IO2C 2C5JA 4YHJA 2DWGA 2NXPA 3HR0A 2DZOA 3MXZA 5A23A 2IU1A 5H7PA 2UXCT 3VTXA 5ENSD 2XCBA 4HI8A 1LD8A 3M65A 2ACZA 1SW6A 1ZHCA 3SWHA 2DNXA 3HVEB 3LY7A 5FY0A 1LKXA 2PBIA 4TNWA 4A5XA 2HH7A 4A56A 3ONKA 5HEHA 3UFGA 5ENQD 4N2QA 5LNKA 4DX1A 1HNXT 4AKIA 4HN9A 5ENRD 4NXNT 1BR0A 4EEBA 3FEYA 2ZM2A 4I0UA 5L3GB 1YMPA 2XQ9A 3ESLA 2ZLYA 5ARFA 3AA1B 2FJEA 1OXZA 2DYSE 4O2BE 3AEEA 4LMJA 2XPYA 4LF9T 2OVFA 3DSXA 4HWIB 2QVAA 4JI3T 2Q9QC 4AKRB 1UX4A 4APFA 4H9NC 4I6GA 1K8KG 3QK6A 2HE0A 3CHOA 2IUBA 2LXMA 1D8DA 3K8PC 2YINA 3OTNA 3LDZA 4XBFB 5JJTA 4O4JE 2I9CA 3AXJA 1HNZT 3VR8A 3ULEG 3CHPA 2C5IT 1W0AA 3EHMA 1E90A 5HEJA 2P9UG 5FP3A 5EYLA 3AU4A 2DZNA 5JDHA 3SGHA 5LHGB 3AAIA 4LNUD 4IHJE 2ZM6T 1D0YA 5AQOB 4WNKA 2OV8A 3EHQA 4LF7T 3ZXPA 3TLSA 3ANWA 1GW6A 4WUYA 3UM2A 2BS3A 4ZS3A 2AXDS 4OFZA 1YYHA 3SFZA 4EYYR 4AIFA 5EK4A 3E22E 3FU6A 4C0EA 5J90A 2V4LA 2W63A 4JEUA 4DV1T 4F53A 3VLDA 5L4HA 3F2EA 3PU8A 3PRZA 4PW8A 5LA6E 2WZHA 3L8RA 1VOMA 2LEHA 2YHCA 1QNFA 4ZEYA 4K0RA 1OEDE 2LSIA 1TNOA 3K9IA 3QAQA 5AQBA 4IL4A 3LSVA 4TNVA 2XHEA 5FZQA 2WXLA 3D9MA 2W4XA 5IHYA 5CBNA 3E32A 2WXPA 1G8XA 5FIOA 2YOEA 5HXHA 4HQDA 3RQWA 2XQYA 3ZNGA 4RQIA 3MKRA 2FUPA 3UFEA 4LFBT 3DEOA 1HF8A 2E9XB 3QUJA 3QKYA 2V6XA 2JJ9A 1DNPA 2VSNA 2QY7A 2KINB 4XAXB 4L5GA 5FNVE 2GRLA 3RRWA 4Z68A 1UGOA 3LVQE 5LOVE 3Q79A 4CDMA 4NUUA 3W9FA 3OVUA 1J5ET 3T9KA 5LJNA 4V3IA 3ONLA 3FTZA 5F3JA 1WM5A 2RG8A 2QYUA 3UTMA 2XEHA 3UPVA 2Q7FA 2QA7A 3RIFA 4ZFHA 3AXJB 1TN8A 3PUGA 5BUZA 2C0SA 2KCKA 3KDSE 2DI4A 2OLTA 2W0GA 4GTOA 1QSDA 3E33A 2V0PA 2WXNA 3ZHEA 4GTTA 1R8IA 2BVLA 2P58C 3UT8A 1FPPA 1G73A 2R02A 4GYWA 4JV5T 2F4VT 4PK6A 1H7CA 1ZKEA 4XI9A 3AECA 1Y64B 1IQRA 5E0OA 4MS6A 4Y6WA 2P9BA 5CMYA 5G04C 1NP7A 1FVFA 4ATGA 2X9HA 3FU0A 3ZSSA 3U78A 3NBXX 3CVVA 4D10C 1U3CA 4JXTA 3P4SA 5B1BE 3NQPA 4B8AA 2VL0A 5C8YE 2K48A 4P0BA 3PDYA 5ABHA 5D2MC 4HBDA 4HRMB 3NOCD 2ZISA 3KBUA 4UF0B 2GK9A 4JI2T 1LF8A 2GRMA 2YDQA 4KXKB 4UI9K 2VKJA 3N9LA 1KPSB 4FLHA 3PE3A 2WB5A 4FHJA 4JYAT 3AS5A 3TXMA 4P29A 4U7EB 4QH1A 2AW6A 2WQ7A 3IA3A 2XHEB 3QOUA 3ISMC 1N36T 1UURA 1QZ2A 3EDUA 4IE5A 1SZ9A 4PK4A 2L6JA 5LHHB 3P1UA 1MX4A 3TL5A 4EHMA 5FY7A 1D0ZA 1E7UA 4QQIA 2V5DA 4GYYA 1OWMA 1PC2A 4DX5D 5JR9B 4U33A 2KXPB 2G0UA 2LOPA 1EF1C 4OHFA 4G25A 4B3MT 3UQ4A 4GTQA 4KX6A 1BI8B 4YY3T 1U4QA 2C0LA 3LK2B 3FZFB 2BKKB 4AP2A 1D0XA 4ZXLA 1MIWA 3HXBA 1G3NB 3KSLA 2WXHA 3D9JA 4X1YE 5B1AE 1N4SA 5JDFA 2XZEA 3D9PA 4JI0T 2YEVC 4HFHA 2J8SD 3F6QA 3FTVA 2CBIA 1WDYA 2XQ5A 3JUIA 2IC9A 3ZW3A 3ZT5A 2LAHA 4AKHA 2L8KA 3ZYLA 4UQYA 1WR0A 4ILBA 2WXQA 4CQIA 3SBTB 1FT1A 2HYZA 4XZ4A 3EHNA 4ILIA 3CK7A 4OVUA 2ZMAA 4UVCB 2IC6A 2DCPA 3MV2B 5FTPA 2F8XK 2ZU6B 5JDMA 1M62A 5ADXL 2E2EA 4CI1B 1OXJA 3WAJA 5HEGA 4PJMA 2XSAA 4FA6A 4DV3T 4P1NA 4GMRA 3CK9A 4I6EA 3T8KA 2H7OA 4KYOB 2Q9QD 4UI9J 4HNAD 2M63A 4TV3A 4G8LA 2WMNA 4B93B 3ZSTA 4U2YA 4LF4T 3FUDA 1HS7A 3CKCA 4YTMA 5J0ZA 2MBGA 3QDNA 1K1BA 3M3ZB 1DCEA 1JCSA 2RFAA 4BX8A 2UUBT 3ZJ1A 3ZLIA 3RLFF 2MYOA 2A4ZA 2X6IA 4IYPA 2ZXWE 1JUQA 2L9BA 2NYJA 4XZCA 3P4PA 4CZZB 5KDMC 1INZA 3Q5MA 1UUSA 2LHRA 3UIOC 3UULA 1TJFA 3NRXA 3ASFA 4N5QA 1LVKA 2QYWA 1H2TC 2NTYA 4F7AA 3FHEA 4JI8T 5ABFA 3KVBA 3P2BA 2M67A 2V7IA 3MA9A 4KMCA 3ABKE 3CX6B 5BV0A 3TLWA 4TWHA 5J1GA 4X1IE 1IHGA 3WI3A 3FH7A 2CE7A 3O48A 3T5VA 4BFRA 2W00A 5LG4A 1X79A 3EDTB 4GZ3A 2BS2A 5G05C 2P9LG 3Q7FA 4YT0A 5CRUA 2J1DG 3UM0A 5B3SE 5AQAA 4NIKA 2IOSA 4HB5A 3APFA 5LMUT 3CSTA 3LBXA 4NQ0A 2V1DB 3JC6C 2CPTA 5KBAA 3DJBA 4IDNA 4FLBA 3ENEA 3D9KA 1FCHA 4A1SA 5FVLA 3BQLA 3GN5A 2BS4A 1NA3A 4P09A 4U74A 4JD2G 4E85A 3X2QE 1TYQG 2RKKA 5J08A 3U66A 2AWIA 1W09A 3HI2A 3E4BA 4ATZD 2EQXA 4J0UA 4HRNA 1KT1A 1WG0A 3DXMG 1TNZA 5CB4E 4I6JA 3UI2A 3RO3A 3ZEFA 3VU7H 2GRQB 3S7BA 4NURA 3ABME 3TWWA 1N95A 4DV4T 3RC3A 3HIZA 4U8YD 4H9QC 5FXVA 2VB6A 5LYJE 2UWJG 5AQKB 4HGAA 4IDZA 3SF4A 2HN2A 2VASA 2XS1A 2CFUA 2FI7A 2LSJA 4WBOA 3JXJA 2JPFA 3TWVA 3NVOA 2GRNB 3SFYA 4ISSA 1YD8G 1L5JA 4B6XA 3Q2MA 2XEEA 4HWFA 5LMNT 1HZ4A 4GU5A 2J4BA 3RRNB 3E34A 3AE3A 1U2VG 3IF8B 2VJ8A 3RKGA 1XNFA 3AG3E 1EYHA 3CHRA 1O1TA 2WZIA 3ZN1B 2Q9QA 5T8IA 2EHOA 5T3RA 3SRZA 4DRXE 3EU5A 2VURA 2L6BA 5CCLA 3PTRB 3ZMZB 4KHZF 4NACA 2YHEA 4HXIA 4B3ST 3OYZA 5L3BB 1YQ3A 2J08A 3LBXB 3KFWX 2V8SE 3ZYMA 4N3AA 2DIWA 3IHYA 2OV9A 3B5MA 1UN8A 2I6HA 2DWZA 4F1SA 4I4TE 3GYZA 4KVOA 2BKPA 4U72A 3C98A 4EB6E 3GN5B 1YQ4A 2XAGB 3BUAA 1QBQA 2HN1A 3DSTA 3APCA 3MYVA 2IJGX 3DSVA 1WRDA 2XAQB 4IDQA 5ANRA 4UWFA 5LBMA 3CVXA 2R5SA 4GCNA 2KWHA 1O3XA 3CQGB 1HG5A 3L09A 2Y1LE 4PS8A 4HOSA 4PJLA 5AQFB 1WCRA 3D9IA 4GA1A 4ME2A 3RHWA 4ZZBA 2CLYC 1H2UA 4AKGA 4AY5A 2I59A 1XWMA 2B6CA 4O6FA 4N39A 4L1BA 4HWHA 3RPUA 5JRCA 3PE0A 2WU5A 4OX9T 4JA7A 2C5KT 3HKDE 5HI7A 3QNKA 3J5QB 4LMLA 5FXXA 3Q5EA 2CHXA 3G2VA 2PM6A 4FHKA 3I1AA 4QHOA 4I9EA 1E1HB 2QC9A 3J5PA 2IMLA 5E75A 4CN1A 1FEWA 5LJMA 2WXOA 2V6YA 2XQ3A 4U3CA 4CXWA 4JI4T 3CK8A 3KAEA 2L3LA 2HM8A 1SA4A 4U31A 5C2TA 3J7Yq 1Z8UA 4EEDA 5CMWA 3AE7A 3CVWA 3AVRA 5AQJB 2MOWA 4I1OB 2OEWA 2EHOB 4HS2A 2N9DA 4BA9A 3LXUX 1OEDC 2VYIA 1WYBA 2CBJA 3CX8B 3LJCA 1E8XA 4UVAB 4DVDA 5BNWA 2BG9C 4KBQA 4O4LE 3BU8A 3IKOB 3OXLA 3AA6B 3FHNA 3ZYKA 3AEGA 1KNZA 3DPDA 3ETVA 3Q9DA 3EDVA 5IY5E 4DO0A 1EDUA 1WYCA 1UJJA 1T72A 3UT7A 3LPZA 4I2WA 3TWTA 5LX8A 3R7RA 2C0MA 2YK0A 3E0ZA 4GOUA 4ABNA 1H19A 2B76A 3I0OA 3CVUA 3Q75A 3L17A 3Q4AB 4GMLA 3JQ0A 1J5WA 5FL1A 2Y4TA 5HXSA 4CT4A 5KJLA 4KBMB 1OWLA 3ZRHA 2V5QC 5ENTD 3U64A 4JI7T 3TKLB 3SY2A 4J2CA 1SHZC 1ZP0A 2PJQA 3B7UX 4EQFA 2A5UA 2VKHA 3DP7A 3S2AA 2H6GA 4K03A 1S35A 3KV5A 4LNBA 4KI0F 5ETWA 4O1OA 4DI3A 4BAYB 3EJNA 1IBKT 3TLUA 3UT5E 3C4ZA 5JRCB 3I0QA 3UM1A 2H3RA 2PNNA 4BETA 1TNBA 3PVLA 3JXIA 2CWYA 2ES0A 3E08A 2D9DA 4DIDB 5L3EB 4CDNA 2XGOA 4PK5A 1N9AA 3JC6D 1IJ6A 2UUAT 2PQRA 3PEVB 2P9IG 2QGSA 3SD5A 4OK0A 1MZCA 4K5CA 5M72A 3FEXA 1Y6IA 2VQFT 2IO3C 4C48B 3EVYA 4X66T 4DR4T 2WXIA 4PH4B 2V6YB 4R7LA 5LG3A 4E7ZA 4PFPA 3LCAA 4TWDA 2BBJA 4U7IA 4EBAG 1SUMB 1S64A 4CZ2D 3PJAA 3L08A 1AJ3A 1FVHA 4DJAA 4CYMD 1U5PA 2X0HA 5L3DB 4FU3A 2AXZA 2NW9A 3EAMA 3RYFE 3JAFA 4DR3T 4AOFA 3AAAB 4DMVA 1ELKA 1IBLT 4LFAT 2PTFA 4QFVA 3TGOA 3HG0D 4UV9B 2OEVA 3NWIA 2W2UA 4KP3C 2XM1A 5FQ6A 2V7JA 2YQ8A 3CGHA 4HFEA 4WAFA 1B89A 4G8KA 3N9PA 4GAAA 5DIZA 2Y4UA 4F3VA 1HXIA 2NOXA 3UKRG 3FDHA 1FMVA 3L82A 4AXHA 4AI6A 3PNTB 1O1RA 4FI5A 3CPZA 3MJWA 4EBAA 4HOQA 1VRBA 5CJ5A 4WZXA 3MGBA 3T8OA 1DC2A 3VR9A 3FTYA 2QZAA 2KSRA 2JQQA 4K0UA 1N4PA 1NEKA 4JHJA 3KSQA 3RKOA 4JA9A 1UX5A 3O4ZA 4Y6CA 4AY6A 4ZOLE 2VTBA 4FADA 2F37A 3I3NA 4EZKA 4KT6B 4TV8E 3HKBE 3FWVA 1OY3D 4YSYA 3LEWA 1D1CA 2LRLA 3NB2A 2LOSA 1LRZA 3H3MA 3RF1A 2WU2A 3ZC0A 4O4IE 5ABEA 1ZBPA 3ZFWA 4B3RT 5L3FB 1IBMT 1H0AA 5EKQD 4GYRA 4E7SA 3AA0B 3DWLG 3FTSA 4H7XA 2BG9E 4HTEA 3EU9A 4ZHQE 3MA5A 3ZYQA 3A7MA 4L23A 2EIME 3PEUB 2IQCA 2RFMA 2XRZA 5FQ8A 5LXTE 4FC8A 2AXUA 3L3PA 5HRYA 4BJNA 3AE4A 3HA4A 4DR2T 3N2GE 3CWZB 1Q2ZA 2H7VC 4A3VA 4DR6T 2AVPA 3BQOA 3RYCE 2KZTA 3UINC 3B95A 2H6IA 1UJKA 5JVDE 2R2LA 3LJNA 5BR8T 1E8YA 3L9TA 2YN6A 4MBQA 4X1KE 1DVPA 5LBQB 3ASDA 1OWOA 4A63B 4HI9A 2V7LA 3OXFA 3QWWA 4U63A 3HL6A 5JQGE 2V5FA 3FH5A 4GZDA 1B7TA 4DV7T 3IHRA 1OCRE 4DLQA 2DCFA 1Z0PA 2XZTG 3ONXA 1S70B 4U8HA 2X9YA 2PG8A 1LTXA 5CECB 2BUGA 1U3DA 2Y69E 1E2AA 5F8PA 5EK2A 4Q96A 3AS8A 2PL2A 5F5WA 3ZMUB 3JCFA 2JQ9A 2HO1A 2OVBA 2LLYA 3NZPA 3ANWB 4PJJA 2WDQA 3FB2A 4GPKA 2ILRA 1BU9A 3FUEA 3PZDA 4TWFA 2VSYA 1IJ5A 3P4QA 4IIJE 4I9CA 4RVBA 4UIGA 3MX3A 4DPRA 4X5TA 2VL8A 2YKSA 2ONDA 2J62A 3D0TA 4B94A 4JEUB 3FFLA 4TZ4C 4QH5A 3PNLB 3C51A 3GWHA 3K3QC 4HOTA 4L0RA 4IDOA 4YLHA 3UXGA 4B0ZA 4PS7A 4BY6A 1MMGA 3R7QA 3QC9A 3VRAA 1BLXB 4WNFA 3RRCA 1UW4B 4LMKA 3AU5A 4DX2A 5FKYA 2ACXA 5LCYA 4UI9C 5ABGA 2CHWA 3FZMB 2WCAA 2VGEA 2WXRA 3V2OA 4IN3B 2XM2A 3I4GA 2CG2A 3UU5A 4G2AA 4MLKA 3CVRA 5AAOA 4OYKA 2CHOA 4NXMT 5ANLA 1X9BA 3ZUVB 2XCCA 1VCTA 3OAWA 4QKNA 3PS6A 3SI5A 5JHAA 3EUHA 2EILE 5C1DA 3U3WA 3AG1E 3FU3A 2R59A 2KZTB 4MRUA 1N4QA 3OXGA 1TN6A 3RRUA 2CA5A 4H63H 2CXDA 3W9GA 1HG2A 5HCMA 4YFSA 4GKJT 3FY4A 3ULQA 5T4YA 2V7MA 1NAFA 2LAIA 4AKLA 3D9LA 3I4RB 2E9XC 1SA5A 3UUMA 1VDYA 2FJDA 1RZ4A 1QUUA 2E8IA 4QXBB 3ZN0B 2XRYA 2GRRB 1D9SA 4YDEA 3G2TA 1IXVA 2WPVA 3ZHEB 5LGUB 3ML8A 4B3TT 3ABLE 3N9OA 3G2WA 4XKBA 2QRXA 4X62T 4AQFC 2B0OE 2CG3A 4ZI7E 4UQXA 4YXDA 1UCUA 3Q78A 3F31A 4H7YA 2WDVA 4ILCA 5AQUB 4WWOA 5BT1A 4YDYA 3KV9A 2WDRA 3LDQB 3UU6A 3VKGA 2R6GF 1D1BA 3EIQC 2B1EA 1X5BA 3IHVA 4ZHBA 2FBNA 5KNHD 4COFA 3WXXA 3V5UA 4QX8B 4I50E 1JNZA 3ZCJA 2MHKA 1NENA 4TXPA 5EIDA 1N0QA 1ZEEA 3FTXA 4N5CA 5ARGA 1V55E 4FJOA 4CN6A 1XNRT 4BJMA 3CEQA 4PDXA 5L2LA 3MEKA 2CMRA 4GPMA 4YDWA 5CA1E 5JMND 4DUZT 2XAFB 4DBRA 4LSZE 4C91A 2YNQA 3GMIA 1Y01A 4B89A 4LUNU 3V5SA 1T8BA 2P9SG 3CVPA 4AV7A 3FZHB 2NR4A 1HR0T 3NKZA 3LVRE 5LCWC 3BQIA 3ZXSA 4H9SE 3TXNA 4HFVA 3MCXA 4JVSA 5CA0E 1K1AA 3ZMVB 1UG3A 4EZJA 2KNDA 5CRVA 5DJQC 4JBWF 2WS3A 5HXCA 5KXJA 3AJIA 3NRYA 4HFCA 2VVSA 3C4WA 5KJKA 3ZU7B 3HXDA 5FWQA 3MJXA 3UUXA 5CEAA 1A17A 2D5UA 5CHEE 4CI3B 2CM0A 1JCQA 3RU0A 1Z3YA 1EZ3A 2CXFA 4LEUA 3LG7A 2AXVA 3S7DA 5AQTB 1FMWA 4Z90A 5FMNA 3BEEA 5JR9C 3FBLA 2KXPC 4U7YA 4KHPT 2JQKA 5DQWA 1OWNA 3Q73A 4L7TA 3R9AB 1OT8A 3PZ4A 1N54A 5A1LA 3CSFA 1RW2A 3ZMTB 1TNYA 1BPOA 4DV2T 1IYGA 2OA5A 1FIOA 2H88A 4I43A 4UQZA 4J8YA 4GK5E 4IE6A 2XAHB 2R03A 3SQVA 1IKND 4L9PA 3K3OA 2BBHA 5JDQA 3UUNA 4DV5T 2DL1A 3PZ2A 5KMGP 3MV3B 3OBVE 1ELWA 2PM7A 2XPKA 4OVVA 4EV6A 1HU3A 4DR7T 4TXRA 4DK5A 2V7KA 3IXEA 5JJ6A 3I9WA 4JL0A 4U0SA 3T8MA 3JADA 2DWKA 4CT0A 2WVIA 2YDRA 2LSGA 3GZSA 2WB2A 1ELRA 2KZ7B 3PUSA 3D9OA 4YHHT 2SPCA 4J7WA 5HXEA 4L2LA 5A6CA 2XEVA 5AN8A 3AA7B 2F0YA 2IFUA 3N5LA 4DV6T 3C72A 3K3NA 5AQVB 4WNDA 4UR9A 5HYAA 5ENPD 2UUCT 4ILHB 2XQ7A 2CRBA 1N0RA 2LKGA 3K1SA 4APOA 3PU3A 3TWQA 1H2VC 3PUZF 4XIFA 4HWCA 4RG6A 5AQRB 5LP6E 1PY1A 4N3BA 4JW1A 4EZLA 2LKHA 3UM3A 4DMWA 3FZLB 2XUEA 3PURA 4URKA 5LFAA 5AQHB 2Y3AA 3EABA 2LSUA 1HX8A 5ABFB 1JWGA 1US7B 2J07A 1HO8A 5FZRA 4U04A 3MKQA 3WG7E 3CQCB 2DBAA 3P8CD 4KUMB 4V1Av 1NA0A 2YU1A 4M1PA 5M4YA 1YW0A 3L13A 5A7DB 2IF4A 2IY0C 1CHUA 2X6JA 2J09A 1N33T 4YJ2E 5G55A 5L4EA 2ZM0A 4HLEA 4H9PC 4IL9A 4JUYA 4H63V 2E0IA 4I2ZA 1MNDA 1MMNA 4UWKA 5G05J 3NZQA 5FINA 1HX1B 5GONE 4H9OC 3RO2A 2UXBT 5EILA 3RH3A 4GTRA 1FT2A 5J2TE 3QB2A 4XI0A 1N32T 4G2VA 2ZGGA 2IONA 3ETUA 2HPLA 3PZ3A 2A9UA 1MHQA 2CXLA 3A5XA 3I9YA 2KCLA 4O1PA 4DUIA 3CK6A 2XPZA 1N94A 3ZEFB 2DYRE 5HCJA 5AQIB 3FXEB 1J1JA 3SFDA 3N2KE 3ZPOA 2WXFA 4HWDA 2ODUA 4WYVA 2NSZA 3C64A 4YSZA 2LE8A 2E9XD 4EXTA 2X6FA 5BXUA 1H6KA 3PUXF 4MFRA 4U07A 5KJMA 4GZCA 2JMKA 5EZYE 2GROB 3JQ1A 2X6KA 1YCSB 5JDLA 5AQNB 3ZT6A 4U8VD 1KT0A 4ERRA 3RSEG 1QLBA 1AP7A 4X64T 1I6ZA 2AJAA 3E30A 2VVNA 3PUVF 5HQ8A 5E76A 1N4RA 2KCVA 4LF5T 1CUNA 2N1GA 4J6IA 4EOZB 3D9HA 4G24A 4ACLA 2UY1A 2K5BB 2P9NG 4F6RC 4CRWA 3HVEA 2XENA 4HLLA 2VKDA 2XTLA 3QOFA 4A98A 3MKQB 3UU8A 1KNPA 4G1TA 3KVAA 4UV8B 4AVXA 4CDRA 4ILAA 1MJ0A 1QQEA 3V31A 5ENNA 2Q9QB 3LS8A 4Q69A 5EN5D 2VGXA 3AE9A 3LY8A 4Z8XA 3P50A 1NI1A 3L54A 2RPAA 4OAVB 2XQ6A 4JPSA 4E6HA 4ZI3C 2XPIA 5JHBA 3ZCIA 2PQNA 2MRIA 4HVBA 2NW8A 2WQHA 4PFOA 1SA0E 5LGTB 2A5EA 3FULA 2BDEA 3B7SA 2I2OA 4DX7D 3TG5A 5BW8C 4ISTA 2L0TB 2P2CP 1V54E 4CGWA 3C98B 1DCQA 3FBZA 1TN7A 2IDOB 1D8EA 2KATA 2J4GA 3G2UA 3LK42 1KZPA 2JIWA 3O1JA 4ZI2C 4I17A 1IHBA 2CEAA 4GTPA 3E37A 5EDSA 3PUKA 4H9RC 2IHR1 4EZHA 5AQSB 3L6AA 3UU4A 1QYMA 5BPPA 3N9NA 4IRUA 2H89A 2J49A 3B13A 5AFUL 2M6IA 2XSBA 4EZ4A 4NUVA 4AQGA 3P4WA 1KNRA 1MNEA 1SVXA 4C9BB 5AQ9A 1XMOT 4BT8A 1AWCB 4X8QA 4CEMA 1E8WA 3AAEB 4DX6D 5DQVA 3ZMSB 2FJAA 4GTMA 2D2SA 2CHNA 3GW4A 3GZ2A 5DBKA 3KINB 4K0KT 3AE8A 5LGNB 3SFEA 4LRZA 1Y8MA 2UY1B 2D0TA 1OWAA 4JB8P 4EGWA 4GIWA 3RAUA 3OJAA 3CVNA 1X81A 3MKDA 3CHQA 3PH0C 2LO6A 3RIAA 1E7PA 2XGSA 3T5XA 3KV4A 5FQ4A 1XDOA 4N3CA 1BR4A 3H3AA 1WY6A 1E7VA 2YDSA 2VGXB 3UT4A 5CERB 4UEMA 2XJ7A 4EYUA 1TEZA 5BV1A 4G23A 3ZKJA 5HEOA 2OOEA 2XGMA 1MIVA 2L0IA 4A97A 5TAOA 2BTDA 5FXWA 3UMVA 2BZBA 2RA1A 2BKNA 3BG1B 1UK5A 2E9XA 3T1HT 2H6FA 2CHZA 5JREA 3DSSA 3AEFA 3FP3A 4CN4A 4ANVA 4EECA 5CCMA 5EX3A 3UUBA 4HRLA 1SE7A 4X20E 5BMVE 2C2LA 2WWUA 3AB3B 2DLRA 3VLFA 5KWDA 2EHOC 1TJCA 5FZSA 2MAWA 4RSYA 3DRAA 4BTBA 1BR1A 3SFXA 4BSXA 2X9XA 4AQFA 4LF6T 4B8CB 3RYIE 4ADZA 3Q9NC 1MMAA 3ZVVA 4TN7B 2WMOA 3DEPA 1EPUA 3CX7B 3GA8A 2LM2A 4GYSA 5FT9A 5CBOA 2XQ4A 5IWAT 2NW7A 2R05A 5FY1A 3CHSA 2WBLA 3N2OA 4K5AB 3UTKA 3QARA 3OTOT 5HS0A 4QX7B 2LRKA 2I1KA 4IE7A 3QJZA 4YJ3E 3ESKA 2JQHA 4HFIA 2RD0A 4HOUA 3DTOA 3NZSA 2LUHA 4LF8T 3L16A 3TWUA 5LP0A 4J8FA 3TWXA 2V26A 3CR3A 5AQMB 3T1YT 5L3CB 2OCCE 3FUFA 4U0UA 4HORA 3NZUA 3KEZA 4UUCA 4FP7A 3KBTA 3DPYA 4IULA 2X68A 4UF0A 3ZJ2A 3O1IA 2XY8B 2CWOA 3AEBA 4XX5A 3Q5WA 2D0UA 1P5QA 3PDNA 3QK0A 3CVLA 2JMHA 2VK9A 2WSSV 4IREA 1ZB1A 2XQ0A 3C5RA 3RIUC 4ZS2A 3RK6A 4LNGA 4JHRA 4HFDA 3CV0A 3O1HA 4F8HA 2FBWA 3RGLA 5H6QB 5AJDA 3OYXA 4F1PA 3LY9A 1W3BA 4EPZA 1PAQA 1WLXA 3WAKA 4LERA 4TXQA 1GQEA 2X67A 3AEDA 4Q25A 3SBSA 3G06A 4IE4A 5JR9A 1MYOA 3QWPA 5JH7E 3TWSA 5BXOA 4HE8A 3AG4E 3C3QA 5D0QD 2Y0BG 3S7JA 3MK7C 1OUVA 3CMLA 4YVOA 4GA2A 1T98A 4PUCA 1MX6A 4JC8A 5HKPA 3ML9A 2JRKA 4WW0A 5L47A 2PZIA 4GMJA 4GKKT 4TUMA 3Q49B 3UQ3A 3PUQA 2K24A 1MQSA 2EINE 3AAAC 4GK0E 5IUXA 3QWVA 2VGYA 2Y48B 2IW5B 5LHIB 4G63A 4LG6A 3N71A 4F6RD 3AE5A 3ZGQA 3ZKRA 4MALA 2VTBB 2E5LT 2NP9A 3SOLA 2X9WA 2IAKA 5FXZA 3RC8A 1V9DA 2NTXA 1Z3XA 5EIBE 1NWMX 4OYSA 2UXXB 4DNDA 4TV9E 1JCRA 4KZ0A 4XE0A 3VHLA 2KBXA 4Q94A 2WQ6A 3UIPC 5ITZF 2BF0X 2KWIB 1OCZE 2GRPB 2WAUA 4PAGA 3FUMA 2LSKA 3LYAA 2L9QA 4ZI3D 2QFCA 2ZIRA 3W15B 2BKOA 2A72A 2WM9A 4BT9A 2H6HA 5AARA 1HTJF 4A1GA 3A8YC 2UU9T 3CHMA 2MOZA 4PNIA 3X1DA 1H6OA 4HEAA 2VSXE 3F57A 1KF6A 3PE4A 5D0OD 2WXGA 5EYPF 5C2YA 3ULYA 3NBNB 4L9IA 5AQPB 3UX4A 4AXPA 1Z5SC 4O2AE 4YNDA 3ZN3A 4HFBA 4TRQA 3JAEA 4JI5T 2NC9A 1TR4A 3PREA 1OCOE 4ZI2D 4BWRA 1A5EA 5AQ7A 4QWNB 3SS1A 2I0MA 4HFGA 3AVSA 3HKCE 3IEEA 4G26A 4GYOA 2AE9A 4AQYT 2X6HA 5EX0A 4C0MA 3GZ1A 3HXCA 1JNRA 2UXNB 2GW1A 2ZM8A 3ZC1A 3Q9UC 1KLXA 5AJLA 3EHRA 4ACKA 4OYJA 4QXCB 4DBQA 5D66A 2FULA 2P9PG 1XDPA 5JA4D 3IBPA 2P9KG 4UWGA 4M3OA 4ILGA 2LJLA 1S94A 1N34T 4MLPA 4A55A 2HR2A 3B57A 2BVMA 4GZ5A 2J4DA 3VRBA 4FJYA 2K9AA 3V30A 3U3IA 3PZ1A 1D1AA 3ASOE 3NF1A 5CGMA 3AG2E 2PFVA 4J8EA 2HPJA 3IV0A 4MKTA 5AIJA 2WXJA 4JEHA 3Q5XA 2N2NA 2IEJA 4J8SA 3FUKA 5KCMA 1HH8A 4TX5A 2XQ8A 5G04J 3AE6A 2HHHT 3KD7A 2W66A 3QB5A 1KFYA 4EAHA 3PUYF 1E96B 3JUEA 2W61A 5JDGA 4TUUA 3P7IA 2LNIA 3LFMA 1HNWT 3U4TA 4GTSA 3HKEE 5KX5E 5HEUA 3O9XA 2JABA 4O60A 4UELA 2CCQA 2XASB 3JCKC 3CVQA 4NIQA 4U2ZA 1XMQT 2XQAA 1ZOYA 3ZT7A 2EHOD 3PUJA 2CFZA 3ABVA 1O1SA 4DUYT 4ASKA 5FVKA 3V79K 2J9QA 4QH4A 3SNXA 3TLTA 2KM4A 3B7BA 3FXDB 3KS2A 1HE8A 1SQMA 3ASHA 4DI4A 3PJAJ 4JI1T 1OWPA 3Q7AA 3B7TA 5AYWD 3EIJA 4NPPA 2Z6EA 4PJNA 5HXRA 4CXYA 4HKAA 5FQ7A 3FTUA 3HXEA 2XAJB 2JLBA 1UN9A 4BESA 4CGVA 4AISA 4IE0A 2LT3A 3HDXA 3OKQA 4LFCT 3FU5A 1DU2A 3RI5A 4AJWA 1OEDA 2WWVA 1YXRA 2JEKA 3D3MA 4GZ6A 1YA0A 3FH8A 5FL0A 2K3WA 4UXNB 4UWHA 2BG9A 1XGWA
chains in the Genus database with same CATH topology
2LSVA 3MZLB 3CIAA 4MHCA 3G2SA 2X51A 1N52A 1MMDA 3PUAA 3RKVA 5FYMA 4I1MA 3BG0B 3LKUA 4GA0A 4NRHB 3C4XA 2FO7A 4JEHB 4L2YA 4ANXA 2LSYA 5G2NA 4LCTA 4I55E 2WXKA 4FULA 3FUIA 3FUNA 1IAPA 1WR6A 2NWBA 2X66A 2Y8DA 4BX9A 3URZA 4GB9A 4U0ZA 2CLYB 3RRMB 3AS4A 3SZ7A 4J8DA 4XKCA 4AEZC 3JYSA 3BQKA 4O4HE 5H6RB 3HHMA 3S7FA 5JDNA 5AENA 4I1AA 5LCWJ 2VWAA 3FUHA 3UUXB 4WBNE 3Q47B 1IZNB 4A3TA 3FTWA 3CVYA 3C50A 3J9X1 4JHKA 2VQ2A 2I1JA 2MYSA 3VKHA 2KT9A 5HWYA 4WNGA 3I5PA 3TJPA 2DHRA 2KMFA 3TAXA 4N2SA 2X38A 1LVFA 4FJZA 3VTYA 4RG9A 5LOZA 2WXMA 4WNEA 2KC7A 5J2UE 4I43B 4DLOA 1YKHB 4N78D 4YVQC 4ANUA 4UVBB 4WWNA 3RX6A 2MTQA 4KMOA 3Q15A 2RP4A 2VSOE 3ZPJA 3RYHE 4G11A 4GCOA 3TG4A 1WAO1 3RIBA 3FUJA 2A3DA 3LJ3A 4IGUA 1HS6A 3VLEA 4QXHB 4KVMA 3DBSA 2X3MA 4W9RA 3LK3B 2GGFA 4CXXA 4ANWA 5DABA 1E8ZA 3QC1A 3L22A 3N9QA 3IBEA 1HCIA 3CKDA 4UWLA 2LHNA 4BTAA 1KK7A 3BK9A 1YKEB 2W62A 2VKOA 4AM9A 1JPLA 4WWPA 4CI2B 2KLQA 2Y6XA 3KV6A 4ILUA 4KZCA 5FJYA 2FEZA 3N9MA 3R6NA 2YU2A 5KJNA 3O4XE 1ZU2A 1BR2A 5IYZE 4C90A 1MIYA 2A2FX 5JJ7A 2FF4A 5HAXA 3ZIMA 1ZV4X 4EIWA 2LM9A 3U9WA 4ANJA 3H37A 4TUYE 1NZNA 1SZAA 1HFAA 3D9NA 3CKBA 2X0LB 3CLJA 3CQXC 3HYMB 4PS3A 5EK3A 1JWFA 3IEGA 3B7RL 4JLEA 3MACA 3MZKB 2ODVA 3R84B 4O8SA 5HWXA 3ASGA 3SHFA 4JZYA 2R17C 1IQUA 2IOLA 4P0AA 3S4UA 1S0PA 1Z6TA 3APDA 3RJVA 4CCAA 2C5JA 4YHJA 2DWGA 2NXPA 3HR0A 3MXZA 5A23A 2IU1A 3VTXA 2XCBA 3M65A 1ZHCA 3SWHA 2DNXA 3HVEB 3LY7A 5FY0A 1LKXA 2PBIA 2HH7A 4A56A 3ONKA 4N2QA 5LNKA 4AKIA 4HN9A 1BR0A 3FEYA 2ZM2A 5L3GB 3ESLA 2ZLYA 5ARFA 3AA1B 1OXZA 4O2BE 2XPYA 2OVFA 2Q9QC 4AKRB 1UX4A 4APFA 4H9NC 4I6GA 3QK6A 3CHOA 3K8PC 2YINA 3OTNA 3LDZA 4XBFB 5JJTA 4O4JE 2I9CA 3CHPA 2C5IT 3EHMA 1E90A 5FP3A 3AU4A 5JDHA 3SGHA 5LHGB 3AAIA 4IHJE 1D0YA 4WNKA 2OV8A 3ANWA 1GW6A 4WUYA 4ZS3A 4OFZA 3SFZA 4EYYR 4AIFA 5EK4A 3E22E 3FU6A 4C0EA 5J90A 2V4LA 2W63A 4JEUA 4F53A 3VLDA 3F2EA 3PU8A 3PRZA 4PW8A 5LA6E 1VOMA 2LEHA 2YHCA 1QNFA 4K0RA 2LSIA 3K9IA 3QAQA 2XHEA 5FZQA 2WXLA 3D9MA 5IHYA 2WXPA 1G8XA 5HXHA 2XQYA 3MKRA 3UFEA 1HF8A 2E9XB 3QUJA 3QKYA 2JJ9A 1DNPA 2VSNA 2QY7A 2KINB 2GRLA 4L5GA 4XAXB 5FNVE 3RRWA 3LVQE 5LOVE 4CDMA 4NUUA 5LJNA 4V3IA 3ONLA 3FTZA 5F3JA 1WM5A 2RG8A 3UPVA 2Q7FA 2QA7A 3PUGA 5BUZA 2C0SA 2KCKA 3KDSE 2DI4A 2W0GA 1QSDA 3ZHEA 2V0PA 2WXNA 2BVLA 2P58C 3UT8A 1G73A 4GYWA 4PK6A 1H7CA 1ZKEA 4XI9A 4MS6A 1Y64B 1IQRA 5E0OA 4Y6WA 2P9BA 5CMYA 5G04C 1NP7A 1FVFA 4ATGA 2X9HA 3FU0A 3U78A 3NBXX 3CVVA 4D10C 1U3CA 4JXTA 3NQPA 4B8AA 5C8YE 2K48A 4P0BA 3PDYA 3KBUA 4UF0B 2GK9A 1LF8A 2GRMA 4KXKB 4UI9K 2VKJA 3N9LA 4FLHA 3PE3A 4FHJA 3AS5A 3TXMA 4P29A 2AW6A 2WQ7A 2XHEB 3QOUA 1QZ2A 3EDUA 4IE5A 1SZ9A 4PK4A 2L6JA 5LHHB 3P1UA 3TL5A 5FY7A 1D0ZA 1E7UA 4GYYA 1OWMA 1PC2A 5JR9B 2KXPB 2G0UA 2LOPA 1EF1C 4OHFA 4G25A 1U4QA 2C0LA 3LK2B 4AP2A 1D0XA 1MIWA 2WXHA 3D9JA 4X1YE 5JDFA 3D9PA 2YEVC 3FTVA 3JUIA 2IC9A 3ZW3A 2LAHA 4AKHA 2L8KA 3ZYLA 4UQYA 2WXQA 4CQIA 3SBTB 2HYZA 4XZ4A 3EHNA 4ILIA 3CK7A 4OVUA 2ZMAA 4UVCB 2IC6A 2DCPA 3MV2B 5FTPA 2ZU6B 5JDMA 5ADXL 2E2EA 4CI1B 3WAJA 4PJMA 4FA6A 3CK9A 4I6EA 2H7OA 4KYOB 2Q9QD 4UI9J 2M63A 4TV3A 2WMNA 3FUDA 1HS7A 3CKCA 2MBGA 3QDNA 4BX8A 3ZJ1A 3ZLIA 2A4ZA 2X6IA 4IYPA 1JUQA 2L9BA 4XZCA 4CZZB 5KDMC 1INZA 3Q5MA 2LHRA 3UULA 1TJFA 3NRXA 3ASFA 1LVKA 1H2TC 2NTYA 4F7AA 3FHEA 3KVBA 3P2BA 2M67A 2V7IA 3MA9A 4KMCA 5BV0A 3CX6B 5J1GA 4X1IE 1IHGA 3WI3A 3FH7A 2CE7A 3O48A 3T5VA 4BFRA 2W00A 5LG4A 1X79A 3EDTB 4GZ3A 5G05C 2J1DG 2IOSA 3APFA 3CSTA 3LBXA 4NQ0A 2V1DB 3JC6C 3DJBA 4FLBA 3ENEA 3D9KA 1FCHA 4A1SA 3BQLA 3GN5A 1NA3A 4P09A 4U74A 4E85A 5J08A 3U66A 2AWIA 3HI2A 3E4BA 2EQXA 4J0UA 1KT1A 5CB4E 4I6JA 3RO3A 3ZEFA 3VU7H 3S7BA 4NURA 3RC3A 3HIZA 4H9QC 5FXVA 2VB6A 5LYJE 2UWJG 4HGAA 4IDZA 3SF4A 2VASA 2CFUA 2FI7A 2LSJA 4WBOA 2JPFA 4ISSA 1YD8G 1L5JA 4B6XA 3Q2MA 1HZ4A 4GU5A 2J4BA 3RRNB 3IF8B 2VJ8A 1XNFA 1EYHA 3CHRA 3ZN1B 2Q9QA 5T8IA 2EHOA 5T3RA 3SRZA 5CCLA 3PTRB 3ZMZB 4NACA 2YHEA 4HXIA 3OYZA 5L3BB 2J08A 3LBXB 3KFWX 2V8SE 3ZYMA 4N3AA 2DIWA 3IHYA 1UN8A 2I6HA 4F1SA 4I4TE 3GYZA 4KVOA 4U72A 3C98A 4EB6E 3GN5B 2XAGB 3APCA 3MYVA 2IJGX 1WRDA 2XAQB 5ANRA 4UWFA 5LBMA 3CVXA 2R5SA 4GCNA 2KWHA 1O3XA 3CQGB 1HG5A 3L09A 4PS8A 4HOSA 4PJLA 3D9IA 4GA1A 4ME2A 2CLYC 1H2UA 4AKGA 4AY5A 2I59A 4O6FA 4N39A 4L1BA 3RPUA 5JRCA 3PE0A 4JA7A 2C5KT 3HKDE 5HI7A 3QNKA 5FXXA 2CHXA 3G2VA 2PM6A 4FHKA 3I1AA 4QHOA 4I9EA 1E1HB 5E75A 1FEWA 5LJMA 2WXOA 4CXWA 3CK8A 3KAEA 2L3LA 2HM8A 3J7Yq 5CMWA 3CVWA 3AVRA 2MOWA 4I1OB 2EHOB 4HS2A 2N9DA 4BA9A 3LXUX 2VYIA 1WYBA 3CX8B 3LJCA 1E8XA 4UVAB 4DVDA 5BNWA 4KBQA 4O4LE 3IKOB 3OXLA 3AA6B 3FHNA 3ZYKA 1KNZA 3DPDA 3ETVA 3Q9DA 3EDVA 4DO0A 1EDUA 1WYCA 1UJJA 3UT7A 3LPZA 4I2WA 5LX8A 3R7RA 2C0MA 2YK0A 3E0ZA 4GOUA 4ABNA 1H19A 3I0OA 3CVUA 3L17A 3Q4AB 4GMLA 3JQ0A 2Y4TA 5HXSA 4CT4A 4KBMB 1OWLA 3ZRHA 3U64A 3TKLB 4J2CA 1SHZC 2PJQA 3B7UX 4EQFA 2A5UA 2VKHA 3DP7A 3S2AA 4K03A 1S35A 3KV5A 5ETWA 4DI3A 4BAYB 3EJNA 3UT5E 3C4ZA 5JRCB 3I0QA 2H3RA 3PVLA 2CWYA 2ES0A 3E08A 5L3EB 4CDNA 2XGOA 4PK5A 3JC6D 1IJ6A 2PQRA 3PEVB 3SD5A 2QGSA 4OK0A 5M72A 3FEXA 1Y6IA 3EVYA 2WXIA 4PH4B 4R7LA 4PFPA 4E7ZA 3LCAA 4EBAG 3L08A 1AJ3A 1FVHA 4DJAA 1U5PA 5L3DB 4FU3A 2AXZA 2NW9A 3RYFE 4AOFA 3AAAB 4DMVA 1ELKA 4QFVA 3TGOA 4UV9B 4KP3C 5FQ6A 2V7JA 2YQ8A 3CGHA 4WAFA 1B89A 3N9PA 4GAAA 5DIZA 2Y4UA 4F3VA 1HXIA 2NOXA 3FDHA 1FMVA 4AXHA 4AI6A 3PNTB 4FI5A 3CPZA 3MJWA 4EBAA 4HOQA 1VRBA 3MGBA 3T8OA 3FTYA 2JQQA 4K0UA 4JHJA 3RKOA 4JA9A 1UX5A 3O4ZA 4Y6CA 4AY6A 4ZOLE 2VTBA 4FADA 3I3NA 4EZKA 4KT6B 4TV8E 3HKBE 3FWVA 3LEWA 1D1CA 2LOSA 1LRZA 3ZC0A 4O4IE 1ZBPA 3ZFWA 5L3FB 1H0AA 5EKQD 4GYRA 4E7SA 3AA0B 3FTSA 4H7XA 4HTEA 4ZHQE 3MA5A 3ZYQA 4L23A 3PEUB 2IQCA 2XRZA 5FQ8A 5LXTE 4FC8A 2AXUA 3L3PA 4BJNA 3HA4A 3N2GE 3CWZB 4A3VA 2H7VC 2AVPA 3RYCE 2KZTA 1UJKA 5JVDE 1E8YA 4MBQA 4X1KE 1DVPA 5LBQB 3ASDA 1OWOA 2V7LA 3OXFA 3QWWA 4U63A 3HL6A 5JQGE 2V5FA 3FH5A 4GZDA 1B7TA 3IHRA 4DLQA 2DCFA 1Z0PA 3ONXA 4U8HA 2X9YA 2PG8A 2BUGA 1U3DA 5F8PA 5EK2A 4Q96A 3AS8A 2PL2A 3ZMUB 2HO1A 2OVBA 3NZPA 3ANWB 4PJJA 4GPKA 3FB2A 2ILRA 3FUEA 3PZDA 2VSYA 1IJ5A 4IIJE 4I9CA 4RVBA 4UIGA 3MX3A 4DPRA 2VL8A 2ONDA 3D0TA 4B94A 4JEUB 3FFLA 4TZ4C 3PNLB 3C51A 3GWHA 3K3QC 4HOTA 4L0RA 4YLHA 4B0ZA 4PS7A 4BY6A 1MMGA 3R7QA 3QC9A 4WNFA 3RRCA 1UW4B 3AU5A 5LCYA 2ACXA 4UI9C 2CHWA 2WXRA 4IN3B 3I4GA 2CG2A 4G2AA 4MLKA 3CVRA 4OYKA 5ANLA 2XCCA 3OAWA 4QKNA 3PS6A 3SI5A 5JHAA 3EUHA 3U3WA 5C1DA 3FU3A 2R59A 2KZTB 4MRUA 3OXGA 3RRUA 2CA5A 4H63H 2CXDA 1HG2A 4YFSA 3FY4A 3ULQA 5T4YA 2V7MA 1NAFA 2LAIA 4AKLA 3D9LA 3I4RB 2E9XC 3UUMA 1VDYA 1QUUA 2E8IA 4QXBB 3ZN0B 2XRYA 3G2TA 3ZHEB 2WPVA 5LGUB 3ML8A 3N9OA 3G2WA 4XKBA 4AQFC 2CG3A 4ZI7E 4UQXA 1UCUA 3F31A 4H7YA 4WWOA 5BT1A 3KV9A 3VKGA 1D1BA 3EIQC 2B1EA 1X5BA 3IHVA 2FBNA 3WXXA 3V5UA 4QX8B 4I50E 3ZCJA 2MHKA 3FTXA 1ZEEA 4N5CA 5ARGA 4FJOA 4BJMA 3CEQA 4PDXA 5L2LA 3MEKA 2CMRA 5CA1E 2XAFB 4DBRA 4C91A 2YNQA 3GMIA 4B89A 4LUNU 3V5SA 3CVPA 4AV7A 3LVRE 5LCWC 3BQIA 3ZXSA 4H9SE 3TXNA 4HFVA 3MCXA 4JVSA 5CA0E 3ZMVB 1UG3A 4EZJA 2KNDA 5DJQC 5HXCA 3NRYA 3C4WA 5KJKA 5FWQA 3MJXA 3UUXA 1A17A 2D5UA 5CHEE 4CI3B 2CM0A 3RU0A 1Z3YA 1EZ3A 2CXFA 4LEUA 3LG7A 2AXVA 3S7DA 1FMWA 5FMNA 3BEEA 5JR9C 3FBLA 5DQWA 1OWNA 4L7TA 3R9AB 1N54A 5A1LA 3CSFA 3ZMTB 1BPOA 1IYGA 2OA5A 1FIOA 4I43A 4UQZA 4GK5E 4IE6A 2XAHB 3K3OA 5JDQA 3UUNA 5KMGP 3MV3B 3OBVE 1ELWA 2PM7A 4OVVA 1HU3A 4DK5A 2V7KA 5JJ6A 3I9WA 4JL0A 4U0SA 3T8MA 2DWKA 4CT0A 2WVIA 2LSGA 3GZSA 2WB2A 1ELRA 2KZ7B 3PUSA 3D9OA 2SPCA 5HXEA 4L2LA 5A6CA 2XEVA 3AA7B 2IFUA 3N5LA 3K3NA 4WNDA 5HYAA 4ILHB 4APOA 3PU3A 1H2VC 4XIFA 4RG6A 5LP6E 1PY1A 4N3BA 4JW1A 4EZLA 4DMWA 2XUEA 3PURA 4URKA 5LFAA 2Y3AA 2LSUA 1HX8A 1JWGA 1US7B 2J07A 1HO8A 5FZRA 4U04A 3MKQA 3CQCB 2DBAA 3P8CD 4KUMB 4V1Av 1NA0A 2YU1A 4M1PA 5M4YA 1YW0A 3L13A 5A7DB 2IF4A 2X6JA 2J09A 4YJ2E 5G55A 2ZM0A 4HLEA 4H9PC 4JUYA 4H63V 2E0IA 4I2ZA 1MNDA 1MMNA 4UWKA 5G05J 3NZQA 5GONE 4H9OC 3RO2A 3RH3A 5J2TE 3QB2A 4XI0A 4G2VA 2IONA 3ETUA 2HPLA 1MHQA 2CXLA 3A5XA 3I9YA 2KCLA 2XPZA 3ZEFB 3FXEB 3N2KE 3ZPOA 2WXFA 2ODUA 2NSZA 3C64A 2LE8A 2E9XD 4EXTA 2X6FA 1H6KA 4MFRA 4U07A 5KJMA 4GZCA 2JMKA 5EZYE 3JQ1A 2X6KA 5JDLA 1KT0A 4ERRA 5HQ8A 5E76A 2KCVA 1CUNA 2N1GA 4J6IA 4EOZB 4G24A 4ACLA 2UY1A 2K5BB 4F6RC 4CRWA 3HVEA 2VKDA 2XTLA 3MKQB 4G1TA 3KVAA 4UV8B 4AVXA 4CDRA 1QQEA 5ENNA 2Q9QB 3LS8A 4Q69A 2VGXA 3LY8A 4Z8XA 3L54A 4JPSA 4E6HA 4ZI3C 2XPIA 5JHBA 3ZCIA 2PQNA 2MRIA 4HVBA 2NW8A 2WQHA 4PFOA 1SA0E 5LGTB 3FULA 2BDEA 3B7SA 2I2OA 3TG5A 5BW8C 4ISTA 2L0TB 4CGWA 3C98B 3FBZA 2KATA 3G2UA 3LK42 3O1JA 4ZI2C 4I17A 2CEAA 5EDSA 3PUKA 4H9RC 4EZHA 3L6AA 5BPPA 3N9NA 4IRUA 2J49A 3B13A 5AFUL 4EZ4A 4NUVA 4AQGA 1MNEA 4C9BB 4BT8A 1E8WA 3AAEB 5DQVA 3ZMSB 2D2SA 3GW4A 3GZ2A 5DBKA 3KINB 5LGNB 4LRZA 1Y8MA 2UY1B 2D0TA 1OWAA 4GIWA 3OJAA 3CVNA 3MKDA 3CHQA 3PH0C 2LO6A 2XGSA 3T5XA 3KV4A 5FQ4A 4N3CA 1BR4A 3H3AA 1WY6A 1E7VA 3UT4A 2VGXB 4UEMA 4EYUA 1TEZA 5BV1A 4G23A 2OOEA 2XGMA 1MIVA 2L0IA 5TAOA 2BTDA 5FXWA 3UMVA 2BZBA 2RA1A 3BG1B 2E9XA 2CHZA 5JREA 4ANVA 3FP3A 4EECA 5CCMA 5EX3A 4X20E 5BMVE 2C2LA 2WWUA 3AB3B 2DLRA 3VLFA 2EHOC 1TJCA 5FZSA 4RSYA 4BTBA 1BR1A 4BSXA 2X9XA 4AQFA 4B8CB 3RYIE 4ADZA 1MMAA 3ZVVA 4TN7B 2WMOA 1EPUA 3CX7B 3GA8A 4GYSA 5FT9A 2NW7A 5FY1A 3CHSA 2WBLA 3N2OA 3UTKA 3QARA 4QX7B 2I1KA 3QJZA 4IE7A 4YJ3E 3ESKA 2RD0A 4HOUA 3DTOA 3NZSA 3L16A 5LP0A 4J8FA 2V26A 3CR3A 5L3CB 3FUFA 4U0UA 4HORA 3NZUA 3KEZA 4FP7A 3KBTA 4IULA 2X68A 4UF0A 3ZJ2A 3O1IA 4XX5A 2CWOA 3Q5WA 2D0UA 1P5QA 3PDNA 3QK0A 3CVLA 2JMHA 2VK9A 2WSSV 2XQ0A 3RK6A 4ZS2A 4JHRA 3CV0A 3O1HA 5H6QB 5AJDA 3OYXA 3LY9A 1W3BA 4EPZA 1PAQA 1WLXA 3WAKA 4LERA 2X67A 3SBSA 4IE4A 5JR9A 3QWPA 5JH7E 4HE8A 5D0QD 3S7JA 3MK7C 1OUVA 3CMLA 4YVOA 4GA2A 1T98A 4PUCA 4JC8A 3ML9A 2JRKA 4WW0A 2PZIA 4GMJA 3UQ3A 3Q49B 3PUQA 2K24A 1MQSA 4GK0E 3QWVA 2VGYA 2Y48B 2IW5B 5LHIB 4G63A 3N71A 3ZGQA 4MALA 2VTBB 2NP9A 3SOLA 2X9WA 2IAKA 5FXZA 3RC8A 1V9DA 2NTXA 1Z3XA 1NWMX 4OYSA 2UXXB 4DNDA 4TV9E 4KZ0A 4XE0A 3VHLA 4Q94A 2WQ6A 2BF0X 2KWIB 5KJLA 2WAUA 4PAGA 3FUMA 2LSKA 3LYAA 2L9QA 4ZI3D 2QFCA 3W15B 2A72A 2WM9A 4BT9A 1HTJF 4A1GA 3CHMA 2MOZA 4PNIA 4HEAA 2VSXE 3F57A 3PE4A 5D0OD 5C2YA 2WXGA 4L9IA 3UX4A 4AXPA 4O2AE 4YNDA 3ZN3A 4TRQA 2NC9A 3PREA 4ZI2D 4BWRA 4QWNB 3SS1A 4HFGA 3AVSA 3HKCE 3IEEA 4G26A 4GYOA 2X6HA 5EX0A 4C0MA 3GZ1A 2UXNB 2GW1A 2ZM8A 3ZC1A 1KLXA 5AJLA 4ACKA 4OYJA 4QXCB 4DBQA 2FULA 3IBPA 4UWGA 4M3OA 4ILGA 2LJLA 1S94A 4MLPA 4A55A 2HR2A 3B57A 2BVMA 4GZ5A 2J4DA 4FJYA 2K9AA 3U3IA 1D1AA 3NF1A 2PFVA 4J8EA 2HPJA 3IV0A 4MKTA 5AIJA 2WXJA 4JEHA 3Q5XA 2N2NA 4J8SA 3FUKA 5KCMA 1HH8A 4TX5A 5G04J 3KD7A 4EAHA 1E96B 2W61A 5JDGA 4TUUA 3P7IA 2LNIA 3LFMA 3U4TA 3HKEE 5KX5E 3O9XA 4UELA 2CCQA 2XASB 3JCKC 3CVQA 3PUJA 2EHOD 2CFZA 4ASKA 2J9QA 3SNXA 2KM4A 3FXDB 3KS2A 1HE8A 1SQMA 3ASHA 4DI4A 1OWPA 3B7TA 5AYWD 3EIJA 2Z6EA 4PJNA 5HXRA 4CXYA 4HKAA 5FQ7A 3FTUA 2XAJB 2JLBA 1UN9A 4CGVA 4IE0A 2LT3A 3HDXA 3OKQA 3FU5A 4AJWA 2JEKA 3D3MA 4GZ6A 1YA0A 3FH8A 4UXNB 4CEMA 4UWHA 1XGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELK A;  1SZA A;  1HFA A;  5CMW A;  5LP0 A;  1VDY A;  3D9N A;  3G2S A;  1LF8 A;  1EDU A;  2L0T B;  4AVX A;  1H0A A;  1MHQ A;  4FLB A;  1UJJ A;  1X5B A;  2MOW A;  3LDZ A;  3D9O A;  4NAC A;  1JUQ A;  3D9M A;  4Q96 A;  1UJK A;  3D9K A;  3CLJ A;  4Q94 A;  3ZYL A;  3G2T A;  3ONL A;  1HX8 A;  5LOZ A;  2BF0 X;  1INZ A;  1HG5 A;  1JWF A;  5CMY A;  2V8S E;  1JWG A;  3ZYM A;  2LO6 A;  3D9P A;  3G2U A;  3G2V A;  2DIW A;  3D9I A;  2L0I A;  3ZYQ A;  4HFG A;  5J08 A;  1HF8 A;  3G2W A;  1DVP A;  3RRU A;  3ONK A;  4JXT A;  1HG2 A;  1SZ9 A;  2DCP A;  1EYH A;  2QY7 A;  4FU3 A;  3D9J A;  4GZD A;  1JPL A;  3D9L A;  3ZYK A;  2KM4 A;  1PY1 A;  4GZC A;  1XGW A; 
#chains in the Genus database with same CATH topology
 2LSV A;  3MZL B;  3CIA A;  4MHC A;  3KEA A;  2J47 A;  3G2S A;  1T7S A;  2X51 A;  3ONL C;  1N52 A;  1MMD A;  3PUA A;  3RKV A;  1UOH A;  5FYM A;  4I1M A;  3BG0 B;  3LKU A;  4GA0 A;  4NRH B;  4BEP A;  3C4X A;  2FO7 A;  4JEH B;  4L2Y A;  2F8Y A;  4ANX A;  2LSY A;  3NOG D;  5G2N A;  4LCT A;  1S63 A;  4I55 E;  2WXK A;  4FUL A;  3FUI A;  3FUN A;  1XNQ T;  1IAP A;  1H6P A;  1WR6 A;  2V5C A;  2NWB A;  2X66 A;  1TNU A;  3UKU G;  2Y8D A;  3AEA A;  4BX9 A;  3URZ A;  4GB9 A;  4U0Z A;  3ASN E;  3PV0 F;  3HXF A;  2CLY B;  3RRM B;  3UU3 A;  1MX2 A;  2ETB A;  3AS4 A;  3SZ7 A;  5JTG A;  3OPC A;  3EI0 A;  4J8D A;  4XKC A;  2ETA A;  4AEZ C;  5LB7 B;  4YTP A;  3NAW A;  4MBG A;  3JYS A;  3BQK A;  4O4H E;  5H6R B;  3HHM A;  3S7F A;  2V4H C;  5JDN A;  4ZZC A;  1W9R A;  4YSX A;  5AEN A;  4I1A A;  5LCW J;  2VWA A;  4M7C A;  3FUH A;  3P4R A;  3UUX B;  4WBN E;  3Q47 B;  1IZN B;  4A3T A;  3FTW A;  5CED B;  4X65 T;  2WQY A;  1OCC E;  3CVY A;  2WY2 A;  3C50 A;  1N11 A;  3J9X 1;  4JHK A;  2VQ2 A;  2I1J A;  2MYS A;  3VKH A;  2KT9 A;  5HWY A;  4WNG A;  3I5P A;  3TJP A;  2WP9 A;  4BER A;  2DHR A;  2KMF A;  4RLY A;  3TAX A;  1XZY A;  2MPK A;  1OED B;  3FZK B;  3QNU A;  4N2S A;  3AE1 A;  2BED A;  2DVW A;  1LVF A;  2X38 A;  4FJZ A;  4BSZ B;  3VTY A;  4RG9 A;  2BG9 B;  5LOZ A;  2WXM A;  4WNE A;  2KC7 A;  3EHZ A;  5J2U E;  4I43 B;  4DLO A;  1YKH B;  4N78 D;  4YVQ C;  4ANU A;  4UVB B;  4WWN A;  3RX6 A;  2MTQ A;  4KMO A;  2XS8 A;  4AIU A;  3Q15 A;  4XEI G;  2EIJ E;  2RP4 A;  5CFB A;  2VSO E;  3ZPJ A;  2VQE T;  3RYH E;  4G11 A;  4GCO A;  3DSU A;  1KZO A;  1LD7 A;  2LXL A;  3TG4 A;  1WAO 1;  3RIB A;  3C3O A;  3FUJ A;  2A3D A;  3LJ3 A;  4IGU A;  2EIK E;  1HS6 A;  5C3J A;  2E5V A;  2FJB A;  4DR1 T;  1BI7 B;  3VLE A;  1K3Z D;  1NL4 A;  4QXH B;  4KVM A;  2X0Y A;  3DBS A;  2X3M A;  4W9R A;  3LK3 B;  3QB5 K;  2W67 A;  4GTV A;  3TLV A;  1NFI E;  2GGF A;  4CXX A;  4U95 D;  4ANW A;  5DAB A;  1E8Z A;  3QC1 A;  3L22 A;  3N9Q A;  2V8S V;  3Q5D A;  3C3R A;  3IBE A;  1HCI A;  2ETC A;  3CKD A;  4UWL A;  3UQ7 A;  2LHN A;  1O5M A;  4BTA A;  3DSW A;  1KK7 A;  3BK9 A;  1BD8 A;  1YKE B;  2IIU A;  2W62 A;  2VKO A;  1M7K A;  4AM9 A;  4K5B A;  1KEY A;  1JPL A;  4WWP A;  4CI2 B;  5ENO D;  2KLQ A;  2XZD G;  2Y6X A;  3KV6 A;  4ILU A;  3EUV A;  4KZC A;  2FEZ A;  5FJY A;  3N9M A;  3R6N A;  2YU2 A;  3RQU A;  4DV0 T;  5KJN A;  3PUW F;  3RIU A;  4YDO A;  4YTN A;  3O4X E;  3V2X A;  3R9M A;  4IDP A;  1ZU2 A;  1BR2 A;  5IYZ E;  4C90 A;  1MIY A;  2A2F X;  5JJ7 A;  4JI6 T;  2FF4 A;  3TWR A;  5HAX A;  2FO1 E;  5KNG A;  3ZIM A;  1ZV4 X;  4EIW A;  3DXK G;  2LM9 A;  3U9W A;  5AQG B;  4ANJ A;  2ZGD A;  3H37 A;  4TUY E;  1NZN A;  3SO8 A;  3L39 A;  1SZA A;  1HFA A;  3D9N A;  3CKB A;  3HRA A;  4DR5 T;  2X0L B;  3CLJ A;  3CQX C;  3HYM B;  4PS3 A;  4OAU C;  5AQQ B;  5EK3 A;  2E2A A;  1JWF A;  1I94 T;  5AQL B;  3IEG A;  3B7R L;  3ONJ A;  4JLE A;  3MAC A;  1VCS A;  1FJG T;  3MZK B;  3CIR A;  3AE2 A;  2ODV A;  3R84 B;  4U96 D;  4O8S A;  5HWX A;  3ASG A;  3SHF A;  4JZY A;  1W0B A;  2R17 C;  1IQU A;  2BKG A;  4Z91 A;  2M6B A;  2QYJ A;  2IOL A;  4P0A A;  1WFD A;  4IT4 A;  2UXD T;  3S4U A;  1S0P A;  1Z6T A;  1L0V A;  3APD A;  3RJV A;  4CCA A;  2IO2 C;  2C5J A;  4YHJ A;  2DWG A;  2NXP A;  3HR0 A;  2DZO A;  3MXZ A;  5A23 A;  2IU1 A;  5H7P A;  2UXC T;  3VTX A;  5ENS D;  2XCB A;  4HI8 A;  1LD8 A;  3M65 A;  2ACZ A;  1SW6 A;  1ZHC A;  3SWH A;  2DNX A;  3HVE B;  3LY7 A;  5FY0 A;  1LKX A;  2PBI A;  4TNW A;  4A5X A;  2HH7 A;  4A56 A;  3ONK A;  5HEH A;  3UFG A;  5ENQ D;  4N2Q A;  5LNK A;  4DX1 A;  1HNX T;  4AKI A;  4HN9 A;  5ENR D;  4NXN T;  1BR0 A;  4EEB A;  3FEY A;  2ZM2 A;  4I0U A;  5L3G B;  1YMP A;  2XQ9 A;  3ESL A;  2ZLY A;  5ARF A;  3AA1 B;  2FJE A;  1OXZ A;  2DYS E;  4O2B E;  3AEE A;  4LMJ A;  2XPY A;  4LF9 T;  2OVF A;  3DSX A;  4HWI B;  2QVA A;  4JI3 T;  2Q9Q C;  4AKR B;  1UX4 A;  4APF A;  4H9N C;  4I6G A;  1K8K G;  3QK6 A;  2HE0 A;  3CHO A;  2IUB A;  2LXM A;  1D8D A;  3K8P C;  2YIN A;  3OTN A;  3LDZ A;  4XBF B;  5JJT A;  4O4J E;  2I9C A;  3AXJ A;  1HNZ T;  3VR8 A;  3ULE G;  3CHP A;  2C5I T;  1W0A A;  3EHM A;  1E90 A;  5HEJ A;  2P9U G;  5FP3 A;  5EYL A;  3AU4 A;  2DZN A;  5JDH A;  3SGH A;  5LHG B;  3AAI A;  4LNU D;  4IHJ E;  2ZM6 T;  1D0Y A;  5AQO B;  4WNK A;  2OV8 A;  3EHQ A;  4LF7 T;  3ZXP A;  3TLS A;  3ANW A;  1GW6 A;  4WUY A;  3UM2 A;  2BS3 A;  4ZS3 A;  2AXD S;  4OFZ A;  1YYH A;  3SFZ A;  4EYY R;  4AIF A;  5EK4 A;  3E22 E;  3FU6 A;  4C0E A;  5J90 A;  2V4L A;  2W63 A;  4JEU A;  4DV1 T;  4F53 A;  3VLD A;  5L4H A;  3F2E A;  3PU8 A;  3PRZ A;  4PW8 A;  5LA6 E;  2WZH A;  3L8R A;  1VOM A;  2LEH A;  2YHC A;  1QNF A;  4ZEY A;  4K0R A;  1OED E;  2LSI A;  1TNO A;  3K9I A;  3QAQ A;  5AQB A;  4IL4 A;  3LSV A;  4TNV A;  2XHE A;  5FZQ A;  2WXL A;  3D9M A;  2W4X A;  5IHY A;  5CBN A;  3E32 A;  2WXP A;  1G8X A;  5FIO A;  2YOE A;  5HXH A;  4HQD A;  3RQW A;  2XQY A;  3ZNG A;  4RQI A;  3MKR A;  2FUP A;  3UFE A;  4LFB T;  3DEO A;  1HF8 A;  2E9X B;  3QUJ A;  3QKY A;  2V6X A;  2JJ9 A;  1DNP A;  2VSN A;  2QY7 A;  2KIN B;  4XAX B;  4L5G A;  5FNV E;  2GRL A;  3RRW A;  4Z68 A;  1UGO A;  3LVQ E;  5LOV E;  3Q79 A;  4CDM A;  4NUU A;  3W9F A;  3OVU A;  1J5E T;  3T9K A;  5LJN A;  4V3I A;  3ONL A;  3FTZ A;  5F3J A;  1WM5 A;  2RG8 A;  2QYU A;  3UTM A;  2XEH A;  3UPV A;  2Q7F A;  2QA7 A;  3RIF A;  4ZFH A;  3AXJ B;  1TN8 A;  3PUG A;  5BUZ A;  2C0S A;  2KCK A;  3KDS E;  2DI4 A;  2OLT A;  2W0G A;  4GTO A;  1QSD A;  3E33 A;  2V0P A;  2WXN A;  3ZHE A;  4GTT A;  1R8I A;  2BVL A;  2P58 C;  3UT8 A;  1FPP A;  1G73 A;  2R02 A;  4GYW A;  4JV5 T;  2F4V T;  4PK6 A;  1H7C A;  1ZKE A;  4XI9 A;  3AEC A;  1Y64 B;  1IQR A;  5E0O A;  4MS6 A;  4Y6W A;  2P9B A;  5CMY A;  5G04 C;  1NP7 A;  1FVF A;  4ATG A;  2X9H A;  3FU0 A;  3ZSS A;  3U78 A;  3NBX X;  3CVV A;  4D10 C;  1U3C A;  4JXT A;  3P4S A;  5B1B E;  3NQP A;  4B8A A;  2VL0 A;  5C8Y E;  2K48 A;  4P0B A;  3PDY A;  5ABH A;  5D2M C;  4HBD A;  4HRM B;  3NOC D;  2ZIS A;  3KBU A;  4UF0 B;  2GK9 A;  4JI2 T;  1LF8 A;  2GRM A;  2YDQ A;  4KXK B;  4UI9 K;  2VKJ A;  3N9L A;  1KPS B;  4FLH A;  3PE3 A;  2WB5 A;  4FHJ A;  4JYA T;  3AS5 A;  3TXM A;  4P29 A;  4U7E B;  4QH1 A;  2AW6 A;  2WQ7 A;  3IA3 A;  2XHE B;  3QOU A;  3ISM C;  1N36 T;  1UUR A;  1QZ2 A;  3EDU A;  4IE5 A;  1SZ9 A;  4PK4 A;  2L6J A;  5LHH B;  3P1U A;  1MX4 A;  3TL5 A;  4EHM A;  5FY7 A;  1D0Z A;  1E7U A;  4QQI A;  2V5D A;  4GYY A;  1OWM A;  1PC2 A;  4DX5 D;  5JR9 B;  4U33 A;  2KXP B;  2G0U A;  2LOP A;  1EF1 C;  4OHF A;  4G25 A;  4B3M T;  3UQ4 A;  4GTQ A;  4KX6 A;  1BI8 B;  4YY3 T;  1U4Q A;  2C0L A;  3LK2 B;  3FZF B;  2BKK B;  4AP2 A;  1D0X A;  4ZXL A;  1MIW A;  3HXB A;  1G3N B;  3KSL A;  2WXH A;  3D9J A;  4X1Y E;  5B1A E;  1N4S A;  5JDF A;  2XZE A;  3D9P A;  4JI0 T;  2YEV C;  4HFH A;  2J8S D;  3F6Q A;  3FTV A;  2CBI A;  1WDY A;  2XQ5 A;  3JUI A;  2IC9 A;  3ZW3 A;  3ZT5 A;  2LAH A;  4AKH A;  2L8K A;  3ZYL A;  4UQY A;  1WR0 A;  4ILB A;  2WXQ A;  4CQI A;  3SBT B;  1FT1 A;  2HYZ A;  4XZ4 A;  3EHN A;  4ILI A;  3CK7 A;  4OVU A;  2ZMA A;  4UVC B;  2IC6 A;  2DCP A;  3MV2 B;  5FTP A;  2F8X K;  2ZU6 B;  5JDM A;  1M62 A;  5ADX L;  2E2E A;  4CI1 B;  1OXJ A;  3WAJ A;  5HEG A;  4PJM A;  2XSA A;  4FA6 A;  4DV3 T;  4P1N A;  4GMR A;  3CK9 A;  4I6E A;  3T8K A;  2H7O A;  4KYO B;  2Q9Q D;  4UI9 J;  4HNA D;  2M63 A;  4TV3 A;  4G8L A;  2WMN A;  4B93 B;  3ZST A;  4U2Y A;  4LF4 T;  3FUD A;  1HS7 A;  3CKC A;  4YTM A;  5J0Z A;  2MBG A;  3QDN A;  1K1B A;  3M3Z B;  1DCE A;  1JCS A;  2RFA A;  4BX8 A;  2UUB T;  3ZJ1 A;  3ZLI A;  3RLF F;  2MYO A;  2A4Z A;  2X6I A;  4IYP A;  2ZXW E;  1JUQ A;  2L9B A;  2NYJ A;  4XZC A;  3P4P A;  4CZZ B;  5KDM C;  1INZ A;  3Q5M A;  1UUS A;  2LHR A;  3UIO C;  3UUL A;  1TJF A;  3NRX A;  3ASF A;  4N5Q A;  1LVK A;  2QYW A;  1H2T C;  2NTY A;  4F7A A;  3FHE A;  4JI8 T;  5ABF A;  3KVB A;  3P2B A;  2M67 A;  2V7I A;  3MA9 A;  4KMC A;  3ABK E;  3CX6 B;  5BV0 A;  3TLW A;  4TWH A;  5J1G A;  4X1I E;  1IHG A;  3WI3 A;  3FH7 A;  2CE7 A;  3O48 A;  3T5V A;  4BFR A;  2W00 A;  5LG4 A;  1X79 A;  3EDT B;  4GZ3 A;  2BS2 A;  5G05 C;  2P9L G;  3Q7F A;  4YT0 A;  5CRU A;  2J1D G;  3UM0 A;  5B3S E;  5AQA A;  4NIK A;  2IOS A;  4HB5 A;  3APF A;  5LMU T;  3CST A;  3LBX A;  4NQ0 A;  2V1D B;  3JC6 C;  2CPT A;  5KBA A;  3DJB A;  4IDN A;  4FLB A;  3ENE A;  3D9K A;  1FCH A;  4A1S A;  5FVL A;  3BQL A;  3GN5 A;  2BS4 A;  1NA3 A;  4P09 A;  4U74 A;  4JD2 G;  4E85 A;  3X2Q E;  1TYQ G;  2RKK A;  5J08 A;  3U66 A;  2AWI A;  1W09 A;  3HI2 A;  3E4B A;  4ATZ D;  2EQX A;  4J0U A;  4HRN A;  1KT1 A;  1WG0 A;  3DXM G;  1TNZ A;  5CB4 E;  4I6J A;  3UI2 A;  3RO3 A;  3ZEF A;  3VU7 H;  2GRQ B;  3S7B A;  4NUR A;  3ABM E;  3TWW A;  1N95 A;  4DV4 T;  3RC3 A;  3HIZ A;  4U8Y D;  4H9Q C;  5FXV A;  2VB6 A;  5LYJ E;  2UWJ G;  5AQK B;  4HGA A;  4IDZ A;  3SF4 A;  2HN2 A;  2VAS A;  2XS1 A;  2CFU A;  2FI7 A;  2LSJ A;  4WBO A;  3JXJ A;  2JPF A;  3TWV A;  3NVO A;  2GRN B;  3SFY A;  4ISS A;  1YD8 G;  1L5J A;  4B6X A;  3Q2M A;  2XEE A;  4HWF A;  5LMN T;  1HZ4 A;  4GU5 A;  2J4B A;  3RRN B;  3E34 A;  3AE3 A;  1U2V G;  3IF8 B;  2VJ8 A;  3RKG A;  1XNF A;  3AG3 E;  1EYH A;  3CHR A;  1O1T A;  2WZI A;  3ZN1 B;  2Q9Q A;  5T8I A;  2EHO A;  5T3R A;  3SRZ A;  4DRX E;  3EU5 A;  2VUR A;  2L6B A;  5CCL A;  3PTR B;  3ZMZ B;  4KHZ F;  4NAC A;  2YHE A;  4HXI A;  4B3S T;  3OYZ A;  5L3B B;  1YQ3 A;  2J08 A;  3LBX B;  3KFW X;  2V8S E;  3ZYM A;  4N3A A;  2DIW A;  3IHY A;  2OV9 A;  3B5M A;  1UN8 A;  2I6H A;  2DWZ A;  4F1S A;  4I4T E;  3GYZ A;  4KVO A;  2BKP A;  4U72 A;  3C98 A;  4EB6 E;  3GN5 B;  1YQ4 A;  2XAG B;  3BUA A;  1QBQ A;  2HN1 A;  3DST A;  3APC A;  3MYV A;  2IJG X;  3DSV A;  1WRD A;  2XAQ B;  4IDQ A;  5ANR A;  4UWF A;  5LBM A;  3CVX A;  2R5S A;  4GCN A;  2KWH A;  1O3X A;  3CQG B;  1HG5 A;  3L09 A;  2Y1L E;  4PS8 A;  4HOS A;  4PJL A;  5AQF B;  1WCR A;  3D9I A;  4GA1 A;  4ME2 A;  3RHW A;  4ZZB A;  2CLY C;  1H2U A;  4AKG A;  4AY5 A;  2I59 A;  1XWM A;  2B6C A;  4O6F A;  4N39 A;  4L1B A;  4HWH A;  3RPU A;  5JRC A;  3PE0 A;  2WU5 A;  4OX9 T;  4JA7 A;  2C5K T;  3HKD E;  5HI7 A;  3QNK A;  3J5Q B;  4LML A;  5FXX A;  3Q5E A;  2CHX A;  3G2V A;  2PM6 A;  4FHK A;  3I1A A;  4QHO A;  4I9E A;  1E1H B;  2QC9 A;  3J5P A;  2IML A;  5E75 A;  4CN1 A;  1FEW A;  5LJM A;  2WXO A;  2V6Y A;  2XQ3 A;  4U3C A;  4CXW A;  4JI4 T;  3CK8 A;  3KAE A;  2L3L A;  2HM8 A;  1SA4 A;  4U31 A;  5C2T A;  3J7Y q;  1Z8U A;  4EED A;  5CMW A;  3AE7 A;  3CVW A;  3AVR A;  5AQJ B;  2MOW A;  4I1O B;  2OEW A;  2EHO B;  4HS2 A;  2N9D A;  4BA9 A;  3LXU X;  1OED C;  2VYI A;  1WYB A;  2CBJ A;  3CX8 B;  3LJC A;  1E8X A;  4UVA B;  4DVD A;  5BNW A;  2BG9 C;  4KBQ A;  4O4L E;  3BU8 A;  3IKO B;  3OXL A;  3AA6 B;  3FHN A;  3ZYK A;  3AEG A;  1KNZ A;  3DPD A;  3ETV A;  3Q9D A;  3EDV A;  5IY5 E;  4DO0 A;  1EDU A;  1WYC A;  1UJJ A;  1T72 A;  3UT7 A;  3LPZ A;  4I2W A;  3TWT A;  5LX8 A;  3R7R A;  2C0M A;  2YK0 A;  3E0Z A;  4GOU A;  4ABN A;  1H19 A;  2B76 A;  3I0O A;  3CVU A;  3Q75 A;  3L17 A;  3Q4A B;  4GML A;  3JQ0 A;  1J5W A;  5FL1 A;  2Y4T A;  5HXS A;  4CT4 A;  5KJL A;  4KBM B;  1OWL A;  3ZRH A;  2V5Q C;  5ENT D;  3U64 A;  4JI7 T;  3TKL B;  3SY2 A;  4J2C A;  1SHZ C;  1ZP0 A;  2PJQ A;  3B7U X;  4EQF A;  2A5U A;  2VKH A;  3DP7 A;  3S2A A;  2H6G A;  4K03 A;  1S35 A;  3KV5 A;  4LNB A;  4KI0 F;  5ETW A;  4O1O A;  4DI3 A;  4BAY B;  3EJN A;  1IBK T;  3TLU A;  3UT5 E;  3C4Z A;  5JRC B;  3I0Q A;  3UM1 A;  2H3R A;  2PNN A;  4BET A;  1TNB A;  3PVL A;  3JXI A;  2CWY A;  2ES0 A;  3E08 A;  2D9D A;  4DID B;  5L3E B;  4CDN A;  2XGO A;  4PK5 A;  1N9A A;  3JC6 D;  1IJ6 A;  2UUA T;  2PQR A;  3PEV B;  2P9I G;  2QGS A;  3SD5 A;  4OK0 A;  1MZC A;  4K5C A;  5M72 A;  3FEX A;  1Y6I A;  2VQF T;  2IO3 C;  4C48 B;  3EVY A;  4X66 T;  4DR4 T;  2WXI A;  4PH4 B;  2V6Y B;  4R7L A;  5LG3 A;  4E7Z A;  4PFP A;  3LCA A;  4TWD A;  2BBJ A;  4U7I A;  4EBA G;  1SUM B;  1S64 A;  4CZ2 D;  3PJA A;  3L08 A;  1AJ3 A;  1FVH A;  4DJA A;  4CYM D;  1U5P A;  2X0H A;  5L3D B;  4FU3 A;  2AXZ A;  2NW9 A;  3EAM A;  3RYF E;  3JAF A;  4DR3 T;  4AOF A;  3AAA B;  4DMV A;  1ELK A;  1IBL T;  4LFA T;  2PTF A;  4QFV A;  3TGO A;  3HG0 D;  4UV9 B;  2OEV A;  3NWI A;  2W2U A;  4KP3 C;  2XM1 A;  5FQ6 A;  2V7J A;  2YQ8 A;  3CGH A;  4HFE A;  4WAF A;  1B89 A;  4G8K A;  3N9P A;  4GAA A;  5DIZ A;  2Y4U A;  4F3V A;  1HXI A;  2NOX A;  3UKR G;  3FDH A;  1FMV A;  3L82 A;  4AXH A;  4AI6 A;  3PNT B;  1O1R A;  4FI5 A;  3CPZ A;  3MJW A;  4EBA A;  4HOQ A;  1VRB A;  5CJ5 A;  4WZX A;  3MGB A;  3T8O A;  1DC2 A;  3VR9 A;  3FTY A;  2QZA A;  2KSR A;  2JQQ A;  4K0U A;  1N4P A;  1NEK A;  4JHJ A;  3KSQ A;  3RKO A;  4JA9 A;  1UX5 A;  3O4Z A;  4Y6C A;  4AY6 A;  4ZOL E;  2VTB A;  4FAD A;  2F37 A;  3I3N A;  4EZK A;  4KT6 B;  4TV8 E;  3HKB E;  3FWV A;  1OY3 D;  4YSY A;  3LEW A;  1D1C A;  2LRL A;  3NB2 A;  2LOS A;  1LRZ A;  3H3M A;  3RF1 A;  2WU2 A;  3ZC0 A;  4O4I E;  5ABE A;  1ZBP A;  3ZFW A;  4B3R T;  5L3F B;  1IBM T;  1H0A A;  5EKQ D;  4GYR A;  4E7S A;  3AA0 B;  3DWL G;  3FTS A;  4H7X A;  2BG9 E;  4HTE A;  3EU9 A;  4ZHQ E;  3MA5 A;  3ZYQ A;  3A7M A;  4L23 A;  2EIM E;  3PEU B;  2IQC A;  2RFM A;  2XRZ A;  5FQ8 A;  5LXT E;  4FC8 A;  2AXU A;  3L3P A;  5HRY A;  4BJN A;  3AE4 A;  3HA4 A;  4DR2 T;  3N2G E;  3CWZ B;  1Q2Z A;  2H7V C;  4A3V A;  4DR6 T;  2AVP A;  3BQO A;  3RYC E;  2KZT A;  3UIN C;  3B95 A;  2H6I A;  1UJK A;  5JVD E;  2R2L A;  3LJN A;  5BR8 T;  1E8Y A;  3L9T A;  2YN6 A;  4MBQ A;  4X1K E;  1DVP A;  5LBQ B;  3ASD A;  1OWO A;  4A63 B;  4HI9 A;  2V7L A;  3OXF A;  3QWW A;  4U63 A;  3HL6 A;  5JQG E;  2V5F A;  3FH5 A;  4GZD A;  1B7T A;  4DV7 T;  3IHR A;  1OCR E;  4DLQ A;  2DCF A;  1Z0P A;  2XZT G;  3ONX A;  1S70 B;  4U8H A;  2X9Y A;  2PG8 A;  1LTX A;  5CEC B;  2BUG A;  1U3D A;  2Y69 E;  1E2A A;  5F8P A;  5EK2 A;  4Q96 A;  3AS8 A;  2PL2 A;  5F5W A;  3ZMU B;  3JCF A;  2JQ9 A;  2HO1 A;  2OVB A;  2LLY A;  3NZP A;  3ANW B;  4PJJ A;  2WDQ A;  3FB2 A;  4GPK A;  2ILR A;  1BU9 A;  3FUE A;  3PZD A;  4TWF A;  2VSY A;  1IJ5 A;  3P4Q A;  4IIJ E;  4I9C A;  4RVB A;  4UIG A;  3MX3 A;  4DPR A;  4X5T A;  2VL8 A;  2YKS A;  2OND A;  2J62 A;  3D0T A;  4B94 A;  4JEU B;  3FFL A;  4TZ4 C;  4QH5 A;  3PNL B;  3C51 A;  3GWH A;  3K3Q C;  4HOT A;  4L0R A;  4IDO A;  4YLH A;  3UXG A;  4B0Z A;  4PS7 A;  4BY6 A;  1MMG A;  3R7Q A;  3QC9 A;  3VRA A;  1BLX B;  4WNF A;  3RRC A;  1UW4 B;  4LMK A;  3AU5 A;  4DX2 A;  5FKY A;  2ACX A;  5LCY A;  4UI9 C;  5ABG A;  2CHW A;  3FZM B;  2WCA A;  2VGE A;  2WXR A;  3V2O A;  4IN3 B;  2XM2 A;  3I4G A;  2CG2 A;  3UU5 A;  4G2A A;  4MLK A;  3CVR A;  5AAO A;  4OYK A;  2CHO A;  4NXM T;  5ANL A;  1X9B A;  3ZUV B;  2XCC A;  1VCT A;  3OAW A;  4QKN A;  3PS6 A;  3SI5 A;  5JHA A;  3EUH A;  2EIL E;  5C1D A;  3U3W A;  3AG1 E;  3FU3 A;  2R59 A;  2KZT B;  4MRU A;  1N4Q A;  3OXG A;  1TN6 A;  3RRU A;  2CA5 A;  4H63 H;  2CXD A;  3W9G A;  1HG2 A;  5HCM A;  4YFS A;  4GKJ T;  3FY4 A;  3ULQ A;  5T4Y A;  2V7M A;  1NAF A;  2LAI A;  4AKL A;  3D9L A;  3I4R B;  2E9X C;  1SA5 A;  3UUM A;  1VDY A;  2FJD A;  1RZ4 A;  1QUU A;  2E8I A;  4QXB B;  3ZN0 B;  2XRY A;  2GRR B;  1D9S A;  4YDE A;  3G2T A;  1IXV A;  2WPV A;  3ZHE B;  5LGU B;  3ML8 A;  4B3T T;  3ABL E;  3N9O A;  3G2W A;  4XKB A;  2QRX A;  4X62 T;  4AQF C;  2B0O E;  2CG3 A;  4ZI7 E;  4UQX A;  4YXD A;  1UCU A;  3Q78 A;  3F31 A;  4H7Y A;  2WDV A;  4ILC A;  5AQU B;  4WWO A;  5BT1 A;  4YDY A;  3KV9 A;  2WDR A;  3LDQ B;  3UU6 A;  3VKG A;  2R6G F;  1D1B A;  3EIQ C;  2B1E A;  1X5B A;  3IHV A;  4ZHB A;  2FBN A;  5KNH D;  4COF A;  3WXX A;  3V5U A;  4QX8 B;  4I50 E;  1JNZ A;  3ZCJ A;  2MHK A;  1NEN A;  4TXP A;  5EID A;  1N0Q A;  1ZEE A;  3FTX A;  4N5C A;  5ARG A;  1V55 E;  4FJO A;  4CN6 A;  1XNR T;  4BJM A;  3CEQ A;  4PDX A;  5L2L A;  3MEK A;  2CMR A;  4GPM A;  4YDW A;  5CA1 E;  5JMN D;  4DUZ T;  2XAF B;  4DBR A;  4LSZ E;  4C91 A;  2YNQ A;  3GMI A;  1Y01 A;  4B89 A;  4LUN U;  3V5S A;  1T8B A;  2P9S G;  3CVP A;  4AV7 A;  3FZH B;  2NR4 A;  1HR0 T;  3NKZ A;  3LVR E;  5LCW C;  3BQI A;  3ZXS A;  4H9S E;  3TXN A;  4HFV A;  3MCX A;  4JVS A;  5CA0 E;  1K1A A;  3ZMV B;  1UG3 A;  4EZJ A;  2KND A;  5CRV A;  5DJQ C;  4JBW F;  2WS3 A;  5HXC A;  5KXJ A;  3AJI A;  3NRY A;  4HFC A;  2VVS A;  3C4W A;  5KJK A;  3ZU7 B;  3HXD A;  5FWQ A;  3MJX A;  3UUX A;  5CEA A;  1A17 A;  2D5U A;  5CHE E;  4CI3 B;  2CM0 A;  1JCQ A;  3RU0 A;  1Z3Y A;  1EZ3 A;  2CXF A;  4LEU A;  3LG7 A;  2AXV A;  3S7D A;  5AQT B;  1FMW A;  4Z90 A;  5FMN A;  3BEE A;  5JR9 C;  3FBL A;  2KXP C;  4U7Y A;  4KHP T;  2JQK A;  5DQW A;  1OWN A;  3Q73 A;  4L7T A;  3R9A B;  1OT8 A;  3PZ4 A;  1N54 A;  5A1L A;  3CSF A;  1RW2 A;  3ZMT B;  1TNY A;  1BPO A;  4DV2 T;  1IYG A;  2OA5 A;  1FIO A;  2H88 A;  4I43 A;  4UQZ A;  4J8Y A;  4GK5 E;  4IE6 A;  2XAH B;  2R03 A;  3SQV A;  1IKN D;  4L9P A;  3K3O A;  2BBH A;  5JDQ A;  3UUN A;  4DV5 T;  2DL1 A;  3PZ2 A;  5KMG P;  3MV3 B;  3OBV E;  1ELW A;  2PM7 A;  2XPK A;  4OVV A;  4EV6 A;  1HU3 A;  4DR7 T;  4TXR A;  4DK5 A;  2V7K A;  3IXE A;  5JJ6 A;  3I9W A;  4JL0 A;  4U0S A;  3T8M A;  3JAD A;  2DWK A;  4CT0 A;  2WVI A;  2YDR A;  2LSG A;  3GZS A;  2WB2 A;  1ELR A;  2KZ7 B;  3PUS A;  3D9O A;  4YHH T;  2SPC A;  4J7W A;  5HXE A;  4L2L A;  5A6C A;  2XEV A;  5AN8 A;  3AA7 B;  2F0Y A;  2IFU A;  3N5L A;  4DV6 T;  3C72 A;  3K3N A;  5AQV B;  4WND A;  4UR9 A;  5HYA A;  5ENP D;  2UUC T;  4ILH B;  2XQ7 A;  2CRB A;  1N0R A;  2LKG A;  3K1S A;  4APO A;  3PU3 A;  3TWQ A;  1H2V C;  3PUZ F;  4XIF A;  4HWC A;  4RG6 A;  5AQR B;  5LP6 E;  1PY1 A;  4N3B A;  4JW1 A;  4EZL A;  2LKH A;  3UM3 A;  4DMW A;  3FZL B;  2XUE A;  3PUR A;  4URK A;  5LFA A;  5AQH B;  2Y3A A;  3EAB A;  2LSU A;  1HX8 A;  5ABF B;  1JWG A;  1US7 B;  2J07 A;  1HO8 A;  5FZR A;  4U04 A;  3MKQ A;  3WG7 E;  3CQC B;  2DBA A;  3P8C D;  4KUM B;  4V1A v;  1NA0 A;  2YU1 A;  4M1P A;  5M4Y A;  1YW0 A;  3L13 A;  5A7D B;  2IF4 A;  2IY0 C;  1CHU A;  2X6J A;  2J09 A;  1N33 T;  4YJ2 E;  5G55 A;  5L4E A;  2ZM0 A;  4HLE A;  4H9P C;  4IL9 A;  4JUY A;  4H63 V;  2E0I A;  4I2Z A;  1MND A;  1MMN A;  4UWK A;  5G05 J;  3NZQ A;  5FIN A;  1HX1 B;  5GON E;  4H9O C;  3RO2 A;  2UXB T;  5EIL A;  3RH3 A;  4GTR A;  1FT2 A;  5J2T E;  3QB2 A;  4XI0 A;  1N32 T;  4G2V A;  2ZGG A;  2ION A;  3ETU A;  2HPL A;  3PZ3 A;  2A9U A;  1MHQ A;  2CXL A;  3A5X A;  3I9Y A;  2KCL A;  4O1P A;  4DUI A;  3CK6 A;  2XPZ A;  1N94 A;  3ZEF B;  2DYR E;  5HCJ A;  5AQI B;  3FXE B;  1J1J A;  3SFD A;  3N2K E;  3ZPO A;  2WXF A;  4HWD A;  2ODU A;  4WYV A;  2NSZ A;  3C64 A;  4YSZ A;  2LE8 A;  2E9X D;  4EXT A;  2X6F A;  5BXU A;  1H6K A;  3PUX F;  4MFR A;  4U07 A;  5KJM A;  4GZC A;  2JMK A;  5EZY E;  2GRO B;  3JQ1 A;  2X6K A;  1YCS B;  5JDL A;  5AQN B;  3ZT6 A;  4U8V D;  1KT0 A;  4ERR A;  3RSE G;  1QLB A;  1AP7 A;  4X64 T;  1I6Z A;  2AJA A;  3E30 A;  2VVN A;  3PUV F;  5HQ8 A;  5E76 A;  1N4R A;  2KCV A;  4LF5 T;  1CUN A;  2N1G A;  4J6I A;  4EOZ B;  3D9H A;  4G24 A;  4ACL A;  2UY1 A;  2K5B B;  2P9N G;  4F6R C;  4CRW A;  3HVE A;  2XEN A;  4HLL A;  2VKD A;  2XTL A;  3QOF A;  4A98 A;  3MKQ B;  3UU8 A;  1KNP A;  4G1T A;  3KVA A;  4UV8 B;  4AVX A;  4CDR A;  4ILA A;  1MJ0 A;  1QQE A;  3V31 A;  5ENN A;  2Q9Q B;  3LS8 A;  4Q69 A;  5EN5 D;  2VGX A;  3AE9 A;  3LY8 A;  4Z8X A;  3P50 A;  1NI1 A;  3L54 A;  2RPA A;  4OAV B;  2XQ6 A;  4JPS A;  4E6H A;  4ZI3 C;  2XPI A;  5JHB A;  3ZCI A;  2PQN A;  2MRI A;  4HVB A;  2NW8 A;  2WQH A;  4PFO A;  1SA0 E;  5LGT B;  2A5E A;  3FUL A;  2BDE A;  3B7S A;  2I2O A;  4DX7 D;  3TG5 A;  5BW8 C;  4IST A;  2L0T B;  2P2C P;  1V54 E;  4CGW A;  3C98 B;  1DCQ A;  3FBZ A;  1TN7 A;  2IDO B;  1D8E A;  2KAT A;  2J4G A;  3G2U A;  3LK4 2;  1KZP A;  2JIW A;  3O1J A;  4ZI2 C;  4I17 A;  1IHB A;  2CEA A;  4GTP A;  3E37 A;  5EDS A;  3PUK A;  4H9R C;  2IHR 1;  4EZH A;  5AQS B;  3L6A A;  3UU4 A;  1QYM A;  5BPP A;  3N9N A;  4IRU A;  2H89 A;  2J49 A;  3B13 A;  5AFU L;  2M6I A;  2XSB A;  4EZ4 A;  4NUV A;  4AQG A;  3P4W A;  1KNR A;  1MNE A;  1SVX A;  4C9B B;  5AQ9 A;  1XMO T;  4BT8 A;  1AWC B;  4X8Q A;  4CEM A;  1E8W A;  3AAE B;  4DX6 D;  5DQV A;  3ZMS B;  2FJA A;  4GTM A;  2D2S A;  2CHN A;  3GW4 A;  3GZ2 A;  5DBK A;  3KIN B;  4K0K T;  3AE8 A;  5LGN B;  3SFE A;  4LRZ A;  1Y8M A;  2UY1 B;  2D0T A;  1OWA A;  4JB8 P;  4EGW A;  4GIW A;  3RAU A;  3OJA A;  3CVN A;  1X81 A;  3MKD A;  3CHQ A;  3PH0 C;  2LO6 A;  3RIA A;  1E7P A;  2XGS A;  3T5X A;  3KV4 A;  5FQ4 A;  1XDO A;  4N3C A;  1BR4 A;  3H3A A;  1WY6 A;  1E7V A;  2YDS A;  2VGX B;  3UT4 A;  5CER B;  4UEM A;  2XJ7 A;  4EYU A;  1TEZ A;  5BV1 A;  4G23 A;  3ZKJ A;  5HEO A;  2OOE A;  2XGM A;  1MIV A;  2L0I A;  4A97 A;  5TAO A;  2BTD A;  5FXW A;  3UMV A;  2BZB A;  2RA1 A;  2BKN A;  3BG1 B;  1UK5 A;  2E9X A;  3T1H T;  2H6F A;  2CHZ A;  5JRE A;  3DSS A;  3AEF A;  3FP3 A;  4CN4 A;  4ANV A;  4EEC A;  5CCM A;  5EX3 A;  3UUB A;  4HRL A;  1SE7 A;  4X20 E;  5BMV E;  2C2L A;  2WWU A;  3AB3 B;  2DLR A;  3VLF A;  5KWD A;  2EHO C;  1TJC A;  5FZS A;  2MAW A;  4RSY A;  3DRA A;  4BTB A;  1BR1 A;  3SFX A;  4BSX A;  2X9X A;  4AQF A;  4LF6 T;  4B8C B;  3RYI E;  4ADZ A;  3Q9N C;  1MMA A;  3ZVV A;  4TN7 B;  2WMO A;  3DEP A;  1EPU A;  3CX7 B;  3GA8 A;  2LM2 A;  4GYS A;  5FT9 A;  5CBO A;  2XQ4 A;  5IWA T;  2NW7 A;  2R05 A;  5FY1 A;  3CHS A;  2WBL A;  3N2O A;  4K5A B;  3UTK A;  3QAR A;  3OTO T;  5HS0 A;  4QX7 B;  2LRK A;  2I1K A;  4IE7 A;  3QJZ A;  4YJ3 E;  3ESK A;  2JQH A;  4HFI A;  2RD0 A;  4HOU A;  3DTO A;  3NZS A;  2LUH A;  4LF8 T;  3L16 A;  3TWU A;  5LP0 A;  4J8F A;  3TWX A;  2V26 A;  3CR3 A;  5AQM B;  3T1Y T;  5L3C B;  2OCC E;  3FUF A;  4U0U A;  4HOR A;  3NZU A;  3KEZ A;  4UUC A;  4FP7 A;  3KBT A;  3DPY A;  4IUL A;  2X68 A;  4UF0 A;  3ZJ2 A;  3O1I A;  2XY8 B;  2CWO A;  3AEB A;  4XX5 A;  3Q5W A;  2D0U A;  1P5Q A;  3PDN A;  3QK0 A;  3CVL A;  2JMH A;  2VK9 A;  2WSS V;  4IRE A;  1ZB1 A;  2XQ0 A;  3C5R A;  3RIU C;  4ZS2 A;  3RK6 A;  4LNG A;  4JHR A;  4HFD A;  3CV0 A;  3O1H A;  4F8H A;  2FBW A;  3RGL A;  5H6Q B;  5AJD A;  3OYX A;  4F1P A;  3LY9 A;  1W3B A;  4EPZ A;  1PAQ A;  1WLX A;  3WAK A;  4LER A;  4TXQ A;  1GQE A;  2X67 A;  3AED A;  4Q25 A;  3SBS A;  3G06 A;  4IE4 A;  5JR9 A;  1MYO A;  3QWP A;  5JH7 E;  3TWS A;  5BXO A;  4HE8 A;  3AG4 E;  3C3Q A;  5D0Q D;  2Y0B G;  3S7J A;  3MK7 C;  1OUV A;  3CML A;  4YVO A;  4GA2 A;  1T98 A;  4PUC A;  1MX6 A;  4JC8 A;  5HKP A;  3ML9 A;  2JRK A;  4WW0 A;  5L47 A;  2PZI A;  4GMJ A;  4GKK T;  4TUM A;  3Q49 B;  3UQ3 A;  3PUQ A;  2K24 A;  1MQS A;  2EIN E;  3AAA C;  4GK0 E;  5IUX A;  3QWV A;  2VGY A;  2Y48 B;  2IW5 B;  5LHI B;  4G63 A;  4LG6 A;  3N71 A;  4F6R D;  3AE5 A;  3ZGQ A;  3ZKR A;  4MAL A;  2VTB B;  2E5L T;  2NP9 A;  3SOL A;  2X9W A;  2IAK A;  5FXZ A;  3RC8 A;  1V9D A;  2NTX A;  1Z3X A;  5EIB E;  1NWM X;  4OYS A;  2UXX B;  4DND A;  4TV9 E;  1JCR A;  4KZ0 A;  4XE0 A;  3VHL A;  2KBX A;  4Q94 A;  2WQ6 A;  3UIP C;  5ITZ F;  2BF0 X;  2KWI B;  1OCZ E;  2GRP B;  2WAU A;  4PAG A;  3FUM A;  2LSK A;  3LYA A;  2L9Q A;  4ZI3 D;  2QFC A;  2ZIR A;  3W15 B;  2BKO A;  2A72 A;  2WM9 A;  4BT9 A;  2H6H A;  5AAR A;  1HTJ F;  4A1G A;  3A8Y C;  2UU9 T;  3CHM A;  2MOZ A;  4PNI A;  3X1D A;  1H6O A;  4HEA A;  2VSX E;  3F57 A;  1KF6 A;  3PE4 A;  5D0O D;  2WXG A;  5EYP F;  5C2Y A;  3ULY A;  3NBN B;  4L9I A;  5AQP B;  3UX4 A;  4AXP A;  1Z5S C;  4O2A E;  4YND A;  3ZN3 A;  4HFB A;  4TRQ A;  3JAE A;  4JI5 T;  2NC9 A;  1TR4 A;  3PRE A;  1OCO E;  4ZI2 D;  4BWR A;  1A5E A;  5AQ7 A;  4QWN B;  3SS1 A;  2I0M A;  4HFG A;  3AVS A;  3HKC E;  3IEE A;  4G26 A;  4GYO A;  2AE9 A;  4AQY T;  2X6H A;  5EX0 A;  4C0M A;  3GZ1 A;  3HXC A;  1JNR A;  2UXN B;  2GW1 A;  2ZM8 A;  3ZC1 A;  3Q9U C;  1KLX A;  5AJL A;  3EHR A;  4ACK A;  4OYJ A;  4QXC B;  4DBQ A;  5D66 A;  2FUL A;  2P9P G;  1XDP A;  5JA4 D;  3IBP A;  2P9K G;  4UWG A;  4M3O A;  4ILG A;  2LJL A;  1S94 A;  1N34 T;  4MLP A;  4A55 A;  2HR2 A;  3B57 A;  2BVM A;  4GZ5 A;  2J4D A;  3VRB A;  4FJY A;  2K9A A;  3V30 A;  3U3I A;  3PZ1 A;  1D1A A;  3ASO E;  3NF1 A;  5CGM A;  3AG2 E;  2PFV A;  4J8E A;  2HPJ A;  3IV0 A;  4MKT A;  5AIJ A;  2WXJ A;  4JEH A;  3Q5X A;  2N2N A;  2IEJ A;  4J8S A;  3FUK A;  5KCM A;  1HH8 A;  4TX5 A;  2XQ8 A;  5G04 J;  3AE6 A;  2HHH T;  3KD7 A;  2W66 A;  3QB5 A;  1KFY A;  4EAH A;  3PUY F;  1E96 B;  3JUE A;  2W61 A;  5JDG A;  4TUU A;  3P7I A;  2LNI A;  3LFM A;  1HNW T;  3U4T A;  4GTS A;  3HKE E;  5KX5 E;  5HEU A;  3O9X A;  2JAB A;  4O60 A;  4UEL A;  2CCQ A;  2XAS B;  3JCK C;  3CVQ A;  4NIQ A;  4U2Z A;  1XMQ T;  2XQA A;  1ZOY A;  3ZT7 A;  2EHO D;  3PUJ A;  2CFZ A;  3ABV A;  1O1S A;  4DUY T;  4ASK A;  5FVK A;  3V79 K;  2J9Q A;  4QH4 A;  3SNX A;  3TLT A;  2KM4 A;  3B7B A;  3FXD B;  3KS2 A;  1HE8 A;  1SQM A;  3ASH A;  4DI4 A;  3PJA J;  4JI1 T;  1OWP A;  3Q7A A;  3B7T A;  5AYW D;  3EIJ A;  4NPP A;  2Z6E A;  4PJN A;  5HXR A;  4CXY A;  4HKA A;  5FQ7 A;  3FTU A;  3HXE A;  2XAJ B;  2JLB A;  1UN9 A;  4BES A;  4CGV A;  4AIS A;  4IE0 A;  2LT3 A;  3HDX A;  3OKQ A;  4LFC T;  3FU5 A;  1DU2 A;  3RI5 A;  4AJW A;  1OED A;  2WWV A;  1YXR A;  2JEK A;  3D3M A;  4GZ6 A;  1YA0 A;  3FH8 A;  5FL0 A;  2K3W A;  4UXN B;  4UWH A;  2BG9 A;  1XGW A; 
#chains in the Genus database with same CATH homology
 2LSV A;  3MZL B;  3CIA A;  4MHC A;  3G2S A;  2X51 A;  1N52 A;  1MMD A;  3PUA A;  3RKV A;  5FYM A;  4I1M A;  3BG0 B;  3LKU A;  4GA0 A;  4NRH B;  3C4X A;  2FO7 A;  4JEH B;  4L2Y A;  4ANX A;  2LSY A;  5G2N A;  4LCT A;  4I55 E;  2WXK A;  4FUL A;  3FUI A;  3FUN A;  1IAP A;  1WR6 A;  2NWB A;  2X66 A;  2Y8D A;  4BX9 A;  3URZ A;  4GB9 A;  4U0Z A;  2CLY B;  3RRM B;  3AS4 A;  3SZ7 A;  4J8D A;  4XKC A;  4AEZ C;  3JYS A;  3BQK A;  4O4H E;  5H6R B;  3HHM A;  3S7F A;  5JDN A;  5AEN A;  4I1A A;  5LCW J;  2VWA A;  3FUH A;  3UUX B;  4WBN E;  3Q47 B;  1IZN B;  4A3T A;  3FTW A;  3CVY A;  3C50 A;  3J9X 1;  4JHK A;  2VQ2 A;  2I1J A;  2MYS A;  3VKH A;  2KT9 A;  5HWY A;  4WNG A;  3I5P A;  3TJP A;  2DHR A;  2KMF A;  3TAX A;  4N2S A;  2X38 A;  1LVF A;  4FJZ A;  3VTY A;  4RG9 A;  5LOZ A;  2WXM A;  4WNE A;  2KC7 A;  5J2U E;  4I43 B;  4DLO A;  1YKH B;  4N78 D;  4YVQ C;  4ANU A;  4UVB B;  4WWN A;  3RX6 A;  2MTQ A;  4KMO A;  3Q15 A;  2RP4 A;  2VSO E;  3ZPJ A;  3RYH E;  4G11 A;  4GCO A;  3TG4 A;  1WAO 1;  3RIB A;  3FUJ A;  2A3D A;  3LJ3 A;  4IGU A;  1HS6 A;  3VLE A;  4QXH B;  4KVM A;  3DBS A;  2X3M A;  4W9R A;  3LK3 B;  2GGF A;  4CXX A;  4ANW A;  5DAB A;  1E8Z A;  3QC1 A;  3L22 A;  3N9Q A;  3IBE A;  1HCI A;  3CKD A;  4UWL A;  2LHN A;  4BTA A;  1KK7 A;  3BK9 A;  1YKE B;  2W62 A;  2VKO A;  4AM9 A;  1JPL A;  4WWP A;  4CI2 B;  2KLQ A;  2Y6X A;  3KV6 A;  4ILU A;  4KZC A;  5FJY A;  2FEZ A;  3N9M A;  3R6N A;  2YU2 A;  5KJN A;  3O4X E;  1ZU2 A;  1BR2 A;  5IYZ E;  4C90 A;  1MIY A;  2A2F X;  5JJ7 A;  2FF4 A;  5HAX A;  3ZIM A;  1ZV4 X;  4EIW A;  2LM9 A;  3U9W A;  4ANJ A;  3H37 A;  4TUY E;  1NZN A;  1SZA A;  1HFA A;  3D9N A;  3CKB A;  2X0L B;  3CLJ A;  3CQX C;  3HYM B;  4PS3 A;  5EK3 A;  1JWF A;  3IEG A;  3B7R L;  4JLE A;  3MAC A;  3MZK B;  2ODV A;  3R84 B;  4O8S A;  5HWX A;  3ASG A;  3SHF A;  4JZY A;  2R17 C;  1IQU A;  2IOL A;  4P0A A;  3S4U A;  1S0P A;  1Z6T A;  3APD A;  3RJV A;  4CCA A;  2C5J A;  4YHJ A;  2DWG A;  2NXP A;  3HR0 A;  3MXZ A;  5A23 A;  2IU1 A;  3VTX A;  2XCB A;  3M65 A;  1ZHC A;  3SWH A;  2DNX A;  3HVE B;  3LY7 A;  5FY0 A;  1LKX A;  2PBI A;  2HH7 A;  4A56 A;  3ONK A;  4N2Q A;  5LNK A;  4AKI A;  4HN9 A;  1BR0 A;  3FEY A;  2ZM2 A;  5L3G B;  3ESL A;  2ZLY A;  5ARF A;  3AA1 B;  1OXZ A;  4O2B E;  2XPY A;  2OVF A;  2Q9Q C;  4AKR B;  1UX4 A;  4APF A;  4H9N C;  4I6G A;  3QK6 A;  3CHO A;  3K8P C;  2YIN A;  3OTN A;  3LDZ A;  4XBF B;  5JJT A;  4O4J E;  2I9C A;  3CHP A;  2C5I T;  3EHM A;  1E90 A;  5FP3 A;  3AU4 A;  5JDH A;  3SGH A;  5LHG B;  3AAI A;  4IHJ E;  1D0Y A;  4WNK A;  2OV8 A;  3ANW A;  1GW6 A;  4WUY A;  4ZS3 A;  4OFZ A;  3SFZ A;  4EYY R;  4AIF A;  5EK4 A;  3E22 E;  3FU6 A;  4C0E A;  5J90 A;  2V4L A;  2W63 A;  4JEU A;  4F53 A;  3VLD A;  3F2E A;  3PU8 A;  3PRZ A;  4PW8 A;  5LA6 E;  1VOM A;  2LEH A;  2YHC A;  1QNF A;  4K0R A;  2LSI A;  3K9I A;  3QAQ A;  2XHE A;  5FZQ A;  2WXL A;  3D9M A;  5IHY A;  2WXP A;  1G8X A;  5HXH A;  2XQY A;  3MKR A;  3UFE A;  1HF8 A;  2E9X B;  3QUJ A;  3QKY A;  2JJ9 A;  1DNP A;  2VSN A;  2QY7 A;  2KIN B;  2GRL A;  4L5G A;  4XAX B;  5FNV E;  3RRW A;  3LVQ E;  5LOV E;  4CDM A;  4NUU A;  5LJN A;  4V3I A;  3ONL A;  3FTZ A;  5F3J A;  1WM5 A;  2RG8 A;  3UPV A;  2Q7F A;  2QA7 A;  3PUG A;  5BUZ A;  2C0S A;  2KCK A;  3KDS E;  2DI4 A;  2W0G A;  1QSD A;  3ZHE A;  2V0P A;  2WXN A;  2BVL A;  2P58 C;  3UT8 A;  1G73 A;  4GYW A;  4PK6 A;  1H7C A;  1ZKE A;  4XI9 A;  4MS6 A;  1Y64 B;  1IQR A;  5E0O A;  4Y6W A;  2P9B A;  5CMY A;  5G04 C;  1NP7 A;  1FVF A;  4ATG A;  2X9H A;  3FU0 A;  3U78 A;  3NBX X;  3CVV A;  4D10 C;  1U3C A;  4JXT A;  3NQP A;  4B8A A;  5C8Y E;  2K48 A;  4P0B A;  3PDY A;  3KBU A;  4UF0 B;  2GK9 A;  1LF8 A;  2GRM A;  4KXK B;  4UI9 K;  2VKJ A;  3N9L A;  4FLH A;  3PE3 A;  4FHJ A;  3AS5 A;  3TXM A;  4P29 A;  2AW6 A;  2WQ7 A;  2XHE B;  3QOU A;  1QZ2 A;  3EDU A;  4IE5 A;  1SZ9 A;  4PK4 A;  2L6J A;  5LHH B;  3P1U A;  3TL5 A;  5FY7 A;  1D0Z A;  1E7U A;  4GYY A;  1OWM A;  1PC2 A;  5JR9 B;  2KXP B;  2G0U A;  2LOP A;  1EF1 C;  4OHF A;  4G25 A;  1U4Q A;  2C0L A;  3LK2 B;  4AP2 A;  1D0X A;  1MIW A;  2WXH A;  3D9J A;  4X1Y E;  5JDF A;  3D9P A;  2YEV C;  3FTV A;  3JUI A;  2IC9 A;  3ZW3 A;  2LAH A;  4AKH A;  2L8K A;  3ZYL A;  4UQY A;  2WXQ A;  4CQI A;  3SBT B;  2HYZ A;  4XZ4 A;  3EHN A;  4ILI A;  3CK7 A;  4OVU A;  2ZMA A;  4UVC B;  2IC6 A;  2DCP A;  3MV2 B;  5FTP A;  2ZU6 B;  5JDM A;  5ADX L;  2E2E A;  4CI1 B;  3WAJ A;  4PJM A;  4FA6 A;  3CK9 A;  4I6E A;  2H7O A;  4KYO B;  2Q9Q D;  4UI9 J;  2M63 A;  4TV3 A;  2WMN A;  3FUD A;  1HS7 A;  3CKC A;  2MBG A;  3QDN A;  4BX8 A;  3ZJ1 A;  3ZLI A;  2A4Z A;  2X6I A;  4IYP A;  1JUQ A;  2L9B A;  4XZC A;  4CZZ B;  5KDM C;  1INZ A;  3Q5M A;  2LHR A;  3UUL A;  1TJF A;  3NRX A;  3ASF A;  1LVK A;  1H2T C;  2NTY A;  4F7A A;  3FHE A;  3KVB A;  3P2B A;  2M67 A;  2V7I A;  3MA9 A;  4KMC A;  5BV0 A;  3CX6 B;  5J1G A;  4X1I E;  1IHG A;  3WI3 A;  3FH7 A;  2CE7 A;  3O48 A;  3T5V A;  4BFR A;  2W00 A;  5LG4 A;  1X79 A;  3EDT B;  4GZ3 A;  5G05 C;  2J1D G;  2IOS A;  3APF A;  3CST A;  3LBX A;  4NQ0 A;  2V1D B;  3JC6 C;  3DJB A;  4FLB A;  3ENE A;  3D9K A;  1FCH A;  4A1S A;  3BQL A;  3GN5 A;  1NA3 A;  4P09 A;  4U74 A;  4E85 A;  5J08 A;  3U66 A;  2AWI A;  3HI2 A;  3E4B A;  2EQX A;  4J0U A;  1KT1 A;  5CB4 E;  4I6J A;  3RO3 A;  3ZEF A;  3VU7 H;  3S7B A;  4NUR A;  3RC3 A;  3HIZ A;  4H9Q C;  5FXV A;  2VB6 A;  5LYJ E;  2UWJ G;  4HGA A;  4IDZ A;  3SF4 A;  2VAS A;  2CFU A;  2FI7 A;  2LSJ A;  4WBO A;  2JPF A;  4ISS A;  1YD8 G;  1L5J A;  4B6X A;  3Q2M A;  1HZ4 A;  4GU5 A;  2J4B A;  3RRN B;  3IF8 B;  2VJ8 A;  1XNF A;  1EYH A;  3CHR A;  3ZN1 B;  2Q9Q A;  5T8I A;  2EHO A;  5T3R A;  3SRZ A;  5CCL A;  3PTR B;  3ZMZ B;  4NAC A;  2YHE A;  4HXI A;  3OYZ A;  5L3B B;  2J08 A;  3LBX B;  3KFW X;  2V8S E;  3ZYM A;  4N3A A;  2DIW A;  3IHY A;  1UN8 A;  2I6H A;  4F1S A;  4I4T E;  3GYZ A;  4KVO A;  4U72 A;  3C98 A;  4EB6 E;  3GN5 B;  2XAG B;  3APC A;  3MYV A;  2IJG X;  1WRD A;  2XAQ B;  5ANR A;  4UWF A;  5LBM A;  3CVX A;  2R5S A;  4GCN A;  2KWH A;  1O3X A;  3CQG B;  1HG5 A;  3L09 A;  4PS8 A;  4HOS A;  4PJL A;  3D9I A;  4GA1 A;  4ME2 A;  2CLY C;  1H2U A;  4AKG A;  4AY5 A;  2I59 A;  4O6F A;  4N39 A;  4L1B A;  3RPU A;  5JRC A;  3PE0 A;  4JA7 A;  2C5K T;  3HKD E;  5HI7 A;  3QNK A;  5FXX A;  2CHX A;  3G2V A;  2PM6 A;  4FHK A;  3I1A A;  4QHO A;  4I9E A;  1E1H B;  5E75 A;  1FEW A;  5LJM A;  2WXO A;  4CXW A;  3CK8 A;  3KAE A;  2L3L A;  2HM8 A;  3J7Y q;  5CMW A;  3CVW A;  3AVR A;  2MOW A;  4I1O B;  2EHO B;  4HS2 A;  2N9D A;  4BA9 A;  3LXU X;  2VYI A;  1WYB A;  3CX8 B;  3LJC A;  1E8X A;  4UVA B;  4DVD A;  5BNW A;  4KBQ A;  4O4L E;  3IKO B;  3OXL A;  3AA6 B;  3FHN A;  3ZYK A;  1KNZ A;  3DPD A;  3ETV A;  3Q9D A;  3EDV A;  4DO0 A;  1EDU A;  1WYC A;  1UJJ A;  3UT7 A;  3LPZ A;  4I2W A;  5LX8 A;  3R7R A;  2C0M A;  2YK0 A;  3E0Z A;  4GOU A;  4ABN A;  1H19 A;  3I0O A;  3CVU A;  3L17 A;  3Q4A B;  4GML A;  3JQ0 A;  2Y4T A;  5HXS A;  4CT4 A;  4KBM B;  1OWL A;  3ZRH A;  3U64 A;  3TKL B;  4J2C A;  1SHZ C;  2PJQ A;  3B7U X;  4EQF A;  2A5U A;  2VKH A;  3DP7 A;  3S2A A;  4K03 A;  1S35 A;  3KV5 A;  5ETW A;  4DI3 A;  4BAY B;  3EJN A;  3UT5 E;  3C4Z A;  5JRC B;  3I0Q A;  2H3R A;  3PVL A;  2CWY A;  2ES0 A;  3E08 A;  5L3E B;  4CDN A;  2XGO A;  4PK5 A;  3JC6 D;  1IJ6 A;  2PQR A;  3PEV B;  3SD5 A;  2QGS A;  4OK0 A;  5M72 A;  3FEX A;  1Y6I A;  3EVY A;  2WXI A;  4PH4 B;  4R7L A;  4PFP A;  4E7Z A;  3LCA A;  4EBA G;  3L08 A;  1AJ3 A;  1FVH A;  4DJA A;  1U5P A;  5L3D B;  4FU3 A;  2AXZ A;  2NW9 A;  3RYF E;  4AOF A;  3AAA B;  4DMV A;  1ELK A;  4QFV A;  3TGO A;  4UV9 B;  4KP3 C;  5FQ6 A;  2V7J A;  2YQ8 A;  3CGH A;  4WAF A;  1B89 A;  3N9P A;  4GAA A;  5DIZ A;  2Y4U A;  4F3V A;  1HXI A;  2NOX A;  3FDH A;  1FMV A;  4AXH A;  4AI6 A;  3PNT B;  4FI5 A;  3CPZ A;  3MJW A;  4EBA A;  4HOQ A;  1VRB A;  3MGB A;  3T8O A;  3FTY A;  2JQQ A;  4K0U A;  4JHJ A;  3RKO A;  4JA9 A;  1UX5 A;  3O4Z A;  4Y6C A;  4AY6 A;  4ZOL E;  2VTB A;  4FAD A;  3I3N A;  4EZK A;  4KT6 B;  4TV8 E;  3HKB E;  3FWV A;  3LEW A;  1D1C A;  2LOS A;  1LRZ A;  3ZC0 A;  4O4I E;  1ZBP A;  3ZFW A;  5L3F B;  1H0A A;  5EKQ D;  4GYR A;  4E7S A;  3AA0 B;  3FTS A;  4H7X A;  4HTE A;  4ZHQ E;  3MA5 A;  3ZYQ A;  4L23 A;  3PEU B;  2IQC A;  2XRZ A;  5FQ8 A;  5LXT E;  4FC8 A;  2AXU A;  3L3P A;  4BJN A;  3HA4 A;  3N2G E;  3CWZ B;  4A3V A;  2H7V C;  2AVP A;  3RYC E;  2KZT A;  1UJK A;  5JVD E;  1E8Y A;  4MBQ A;  4X1K E;  1DVP A;  5LBQ B;  3ASD A;  1OWO A;  2V7L A;  3OXF A;  3QWW A;  4U63 A;  3HL6 A;  5JQG E;  2V5F A;  3FH5 A;  4GZD A;  1B7T A;  3IHR A;  4DLQ A;  2DCF A;  1Z0P A;  3ONX A;  4U8H A;  2X9Y A;  2PG8 A;  2BUG A;  1U3D A;  5F8P A;  5EK2 A;  4Q96 A;  3AS8 A;  2PL2 A;  3ZMU B;  2HO1 A;  2OVB A;  3NZP A;  3ANW B;  4PJJ A;  4GPK A;  3FB2 A;  2ILR A;  3FUE A;  3PZD A;  2VSY A;  1IJ5 A;  4IIJ E;  4I9C A;  4RVB A;  4UIG A;  3MX3 A;  4DPR A;  2VL8 A;  2OND A;  3D0T A;  4B94 A;  4JEU B;  3FFL A;  4TZ4 C;  3PNL B;  3C51 A;  3GWH A;  3K3Q C;  4HOT A;  4L0R A;  4YLH A;  4B0Z A;  4PS7 A;  4BY6 A;  1MMG A;  3R7Q A;  3QC9 A;  4WNF A;  3RRC A;  1UW4 B;  3AU5 A;  5LCY A;  2ACX A;  4UI9 C;  2CHW A;  2WXR A;  4IN3 B;  3I4G A;  2CG2 A;  4G2A A;  4MLK A;  3CVR A;  4OYK A;  5ANL A;  2XCC A;  3OAW A;  4QKN A;  3PS6 A;  3SI5 A;  5JHA A;  3EUH A;  3U3W A;  5C1D A;  3FU3 A;  2R59 A;  2KZT B;  4MRU A;  3OXG A;  3RRU A;  2CA5 A;  4H63 H;  2CXD A;  1HG2 A;  4YFS A;  3FY4 A;  3ULQ A;  5T4Y A;  2V7M A;  1NAF A;  2LAI A;  4AKL A;  3D9L A;  3I4R B;  2E9X C;  3UUM A;  1VDY A;  1QUU A;  2E8I A;  4QXB B;  3ZN0 B;  2XRY A;  3G2T A;  3ZHE B;  2WPV A;  5LGU B;  3ML8 A;  3N9O A;  3G2W A;  4XKB A;  4AQF C;  2CG3 A;  4ZI7 E;  4UQX A;  1UCU A;  3F31 A;  4H7Y A;  4WWO A;  5BT1 A;  3KV9 A;  3VKG A;  1D1B A;  3EIQ C;  2B1E A;  1X5B A;  3IHV A;  2FBN A;  3WXX A;  3V5U A;  4QX8 B;  4I50 E;  3ZCJ A;  2MHK A;  3FTX A;  1ZEE A;  4N5C A;  5ARG A;  4FJO A;  4BJM A;  3CEQ A;  4PDX A;  5L2L A;  3MEK A;  2CMR A;  5CA1 E;  2XAF B;  4DBR A;  4C91 A;  2YNQ A;  3GMI A;  4B89 A;  4LUN U;  3V5S A;  3CVP A;  4AV7 A;  3LVR E;  5LCW C;  3BQI A;  3ZXS A;  4H9S E;  3TXN A;  4HFV A;  3MCX A;  4JVS A;  5CA0 E;  3ZMV B;  1UG3 A;  4EZJ A;  2KND A;  5DJQ C;  5HXC A;  3NRY A;  3C4W A;  5KJK A;  5FWQ A;  3MJX A;  3UUX A;  1A17 A;  2D5U A;  5CHE E;  4CI3 B;  2CM0 A;  3RU0 A;  1Z3Y A;  1EZ3 A;  2CXF A;  4LEU A;  3LG7 A;  2AXV A;  3S7D A;  1FMW A;  5FMN A;  3BEE A;  5JR9 C;  3FBL A;  5DQW A;  1OWN A;  4L7T A;  3R9A B;  1N54 A;  5A1L A;  3CSF A;  3ZMT B;  1BPO A;  1IYG A;  2OA5 A;  1FIO A;  4I43 A;  4UQZ A;  4GK5 E;  4IE6 A;  2XAH B;  3K3O A;  5JDQ A;  3UUN A;  5KMG P;  3MV3 B;  3OBV E;  1ELW A;  2PM7 A;  4OVV A;  1HU3 A;  4DK5 A;  2V7K A;  5JJ6 A;  3I9W A;  4JL0 A;  4U0S A;  3T8M A;  2DWK A;  4CT0 A;  2WVI A;  2LSG A;  3GZS A;  2WB2 A;  1ELR A;  2KZ7 B;  3PUS A;  3D9O A;  2SPC A;  5HXE A;  4L2L A;  5A6C A;  2XEV A;  3AA7 B;  2IFU A;  3N5L A;  3K3N A;  4WND A;  5HYA A;  4ILH B;  4APO A;  3PU3 A;  1H2V C;  4XIF A;  4RG6 A;  5LP6 E;  1PY1 A;  4N3B A;  4JW1 A;  4EZL A;  4DMW A;  2XUE A;  3PUR A;  4URK A;  5LFA A;  2Y3A A;  2LSU A;  1HX8 A;  1JWG A;  1US7 B;  2J07 A;  1HO8 A;  5FZR A;  4U04 A;  3MKQ A;  3CQC B;  2DBA A;  3P8C D;  4KUM B;  4V1A v;  1NA0 A;  2YU1 A;  4M1P A;  5M4Y A;  1YW0 A;  3L13 A;  5A7D B;  2IF4 A;  2X6J A;  2J09 A;  4YJ2 E;  5G55 A;  2ZM0 A;  4HLE A;  4H9P C;  4JUY A;  4H63 V;  2E0I A;  4I2Z A;  1MND A;  1MMN A;  4UWK A;  5G05 J;  3NZQ A;  5GON E;  4H9O C;  3RO2 A;  3RH3 A;  5J2T E;  3QB2 A;  4XI0 A;  4G2V A;  2ION A;  3ETU A;  2HPL A;  1MHQ A;  2CXL A;  3A5X A;  3I9Y A;  2KCL A;  2XPZ A;  3ZEF B;  3FXE B;  3N2K E;  3ZPO A;  2WXF A;  2ODU A;  2NSZ A;  3C64 A;  2LE8 A;  2E9X D;  4EXT A;  2X6F A;  1H6K A;  4MFR A;  4U07 A;  5KJM A;  4GZC A;  2JMK A;  5EZY E;  3JQ1 A;  2X6K A;  5JDL A;  1KT0 A;  4ERR A;  5HQ8 A;  5E76 A;  2KCV A;  1CUN A;  2N1G A;  4J6I A;  4EOZ B;  4G24 A;  4ACL A;  2UY1 A;  2K5B B;  4F6R C;  4CRW A;  3HVE A;  2VKD A;  2XTL A;  3MKQ B;  4G1T A;  3KVA A;  4UV8 B;  4AVX A;  4CDR A;  1QQE A;  5ENN A;  2Q9Q B;  3LS8 A;  4Q69 A;  2VGX A;  3LY8 A;  4Z8X A;  3L54 A;  4JPS A;  4E6H A;  4ZI3 C;  2XPI A;  5JHB A;  3ZCI A;  2PQN A;  2MRI A;  4HVB A;  2NW8 A;  2WQH A;  4PFO A;  1SA0 E;  5LGT B;  3FUL A;  2BDE A;  3B7S A;  2I2O A;  3TG5 A;  5BW8 C;  4IST A;  2L0T B;  4CGW A;  3C98 B;  3FBZ A;  2KAT A;  3G2U A;  3LK4 2;  3O1J A;  4ZI2 C;  4I17 A;  2CEA A;  5EDS A;  3PUK A;  4H9R C;  4EZH A;  3L6A A;  5BPP A;  3N9N A;  4IRU A;  2J49 A;  3B13 A;  5AFU L;  4EZ4 A;  4NUV A;  4AQG A;  1MNE A;  4C9B B;  4BT8 A;  1E8W A;  3AAE B;  5DQV A;  3ZMS B;  2D2S A;  3GW4 A;  3GZ2 A;  5DBK A;  3KIN B;  5LGN B;  4LRZ A;  1Y8M A;  2UY1 B;  2D0T A;  1OWA A;  4GIW A;  3OJA A;  3CVN A;  3MKD A;  3CHQ A;  3PH0 C;  2LO6 A;  2XGS A;  3T5X A;  3KV4 A;  5FQ4 A;  4N3C A;  1BR4 A;  3H3A A;  1WY6 A;  1E7V A;  3UT4 A;  2VGX B;  4UEM A;  4EYU A;  1TEZ A;  5BV1 A;  4G23 A;  2OOE A;  2XGM A;  1MIV A;  2L0I A;  5TAO A;  2BTD A;  5FXW A;  3UMV A;  2BZB A;  2RA1 A;  3BG1 B;  2E9X A;  2CHZ A;  5JRE A;  4ANV A;  3FP3 A;  4EEC A;  5CCM A;  5EX3 A;  4X20 E;  5BMV E;  2C2L A;  2WWU A;  3AB3 B;  2DLR A;  3VLF A;  2EHO C;  1TJC A;  5FZS A;  4RSY A;  4BTB A;  1BR1 A;  4BSX A;  2X9X A;  4AQF A;  4B8C B;  3RYI E;  4ADZ A;  1MMA A;  3ZVV A;  4TN7 B;  2WMO A;  1EPU A;  3CX7 B;  3GA8 A;  4GYS A;  5FT9 A;  2NW7 A;  5FY1 A;  3CHS A;  2WBL A;  3N2O A;  3UTK A;  3QAR A;  4QX7 B;  2I1K A;  3QJZ A;  4IE7 A;  4YJ3 E;  3ESK A;  2RD0 A;  4HOU A;  3DTO A;  3NZS A;  3L16 A;  5LP0 A;  4J8F A;  2V26 A;  3CR3 A;  5L3C B;  3FUF A;  4U0U A;  4HOR A;  3NZU A;  3KEZ A;  4FP7 A;  3KBT A;  4IUL A;  2X68 A;  4UF0 A;  3ZJ2 A;  3O1I A;  4XX5 A;  2CWO A;  3Q5W A;  2D0U A;  1P5Q A;  3PDN A;  3QK0 A;  3CVL A;  2JMH A;  2VK9 A;  2WSS V;  2XQ0 A;  3RK6 A;  4ZS2 A;  4JHR A;  3CV0 A;  3O1H A;  5H6Q B;  5AJD A;  3OYX A;  3LY9 A;  1W3B A;  4EPZ A;  1PAQ A;  1WLX A;  3WAK A;  4LER A;  2X67 A;  3SBS A;  4IE4 A;  5JR9 A;  3QWP A;  5JH7 E;  4HE8 A;  5D0Q D;  3S7J A;  3MK7 C;  1OUV A;  3CML A;  4YVO A;  4GA2 A;  1T98 A;  4PUC A;  4JC8 A;  3ML9 A;  2JRK A;  4WW0 A;  2PZI A;  4GMJ A;  3UQ3 A;  3Q49 B;  3PUQ A;  2K24 A;  1MQS A;  4GK0 E;  3QWV A;  2VGY A;  2Y48 B;  2IW5 B;  5LHI B;  4G63 A;  3N71 A;  3ZGQ A;  4MAL A;  2VTB B;  2NP9 A;  3SOL A;  2X9W A;  2IAK A;  5FXZ A;  3RC8 A;  1V9D A;  2NTX A;  1Z3X A;  1NWM X;  4OYS A;  2UXX B;  4DND A;  4TV9 E;  4KZ0 A;  4XE0 A;  3VHL A;  4Q94 A;  2WQ6 A;  2BF0 X;  2KWI B;  5KJL A;  2WAU A;  4PAG A;  3FUM A;  2LSK A;  3LYA A;  2L9Q A;  4ZI3 D;  2QFC A;  3W15 B;  2A72 A;  2WM9 A;  4BT9 A;  1HTJ F;  4A1G A;  3CHM A;  2MOZ A;  4PNI A;  4HEA A;  2VSX E;  3F57 A;  3PE4 A;  5D0O D;  5C2Y A;  2WXG A;  4L9I A;  3UX4 A;  4AXP A;  4O2A E;  4YND A;  3ZN3 A;  4TRQ A;  2NC9 A;  3PRE A;  4ZI2 D;  4BWR A;  4QWN B;  3SS1 A;  4HFG A;  3AVS A;  3HKC E;  3IEE A;  4G26 A;  4GYO A;  2X6H A;  5EX0 A;  4C0M A;  3GZ1 A;  2UXN B;  2GW1 A;  2ZM8 A;  3ZC1 A;  1KLX A;  5AJL A;  4ACK A;  4OYJ A;  4QXC B;  4DBQ A;  2FUL A;  3IBP A;  4UWG A;  4M3O A;  4ILG A;  2LJL A;  1S94 A;  4MLP A;  4A55 A;  2HR2 A;  3B57 A;  2BVM A;  4GZ5 A;  2J4D A;  4FJY A;  2K9A A;  3U3I A;  1D1A A;  3NF1 A;  2PFV A;  4J8E A;  2HPJ A;  3IV0 A;  4MKT A;  5AIJ A;  2WXJ A;  4JEH A;  3Q5X A;  2N2N A;  4J8S A;  3FUK A;  5KCM A;  1HH8 A;  4TX5 A;  5G04 J;  3KD7 A;  4EAH A;  1E96 B;  2W61 A;  5JDG A;  4TUU A;  3P7I A;  2LNI A;  3LFM A;  3U4T A;  3HKE E;  5KX5 E;  3O9X A;  4UEL A;  2CCQ A;  2XAS B;  3JCK C;  3CVQ A;  3PUJ A;  2EHO D;  2CFZ A;  4ASK A;  2J9Q A;  3SNX A;  2KM4 A;  3FXD B;  3KS2 A;  1HE8 A;  1SQM A;  3ASH A;  4DI4 A;  1OWP A;  3B7T A;  5AYW D;  3EIJ A;  2Z6E A;  4PJN A;  5HXR A;  4CXY A;  4HKA A;  5FQ7 A;  3FTU A;  2XAJ B;  2JLB A;  1UN9 A;  4CGV A;  4IE0 A;  2LT3 A;  3HDX A;  3OKQ A;  3FU5 A;  4AJW A;  2JEK A;  3D3M A;  4GZ6 A;  1YA0 A;  3FH8 A;  4UXN B;  4CEM A;  4UWH A;  1XGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...