1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
1LF8A 4GZCA 1HF8A 1JUQA 1SZAA 3D9OA 3G2SA 4NACA 2L0TB 2QY7A 4JXTA 1HFAA 2DCPA 4AVXA 2LO6A 1H0AA 1UJJA 3D9LA 1UJKA 1SZ9A 3G2UA 1VDYA 1HG2A 3G2TA 1HG5A 1PY1A 3ONLA 1JWGA 2KM4A 4GZDA 4Q96A 3RRUA 3D9NA 3ZYLA 1XGWA 2MOWA 3ZYQA 1EYHA 2V8SE 1JWFA 2L0IA 3D9KA 3D9JA 3D9PA 3ZYKA 4FU3A 2DIWA 3LDZA 4HFGA 3G2WA 3D9IA 5J08A 5CMWA 1JPLA 1HX8A 1DVPA 3D9MA 1EDUA 4Q94A 1ELKA 1MHQA 3ZYMA 3G2VA 5LOZA 4FLBA 2BF0X 5CMYA 1INZA 3CLJA 1X5BA 3ONKA 5LP0A
chains in the Genus database with same CATH superfamily
3KEAA 1FMVA 1J5ET 2XAFB 2BKPA 3U78A 4I6JA 2LUHA 3NRXA 3LJNA 5G55A 2LRLA 1PY1A 2UXNB 2YDRA 4HEAA 4M3OA 5D66A 3AU4A 4KI0F 1AP7A 2P9UG 2XASB 2YOEA 3SS1A 1MZCA 3MEKA 3SBSA 3ZMTB 2ZXWE 4EEDA 2CEAA 4DR7T 1OCCE 1QSDA 3RQWA 5CFBA 4DV0T 4DVDA 2XHEA 5FXZA 1QQEA 2Y4TA 5HYAA 3LPZA 4CI3B 3NKZA 3LBXB 4M7CA 4YSXA 3SZ7A 3PUKA 5KJKA 3P4SA 2YDQA 4ZI7E 3QNKA 3LJ3A 3D9OA 4U0SA 4HOQA 3TWRA 5CBNA 2K48A 2V5QC 3L22A 3Q9DA 2LM9A 3ZMZB 4X64T 1N4SA 3PV0F 3SFXA 3UXGA 1U2VG 2UWJG 5AARA 1HS7A 4NURA 4HWFA 2CLYB 4I2ZA 2KZTA 4B3RT 2IIUA 2VTBB 4TV8E 2XEHA 4ZI2D 5HI7A 5JVDE 4FP7A 4IE4A 5CEAA 1E8YA 5LX8A 5ITZF 2VK9A 4IDPA 1OWAA 2PM7A 2XM2A 2JMHA 2DCPA 2JPFA 3KD7A 2JQ9A 5JJ6A 1IAPA 3NAWA 1NFIE 2F8YA 2VSOE 3UM3A 2GW1A 4JVSA 4ILCA 3NZQA 4F53A 3OXGA 3EVYA 4L0RA 3ANWB 1ZBPA 3FUJA 2Q9QD 3ZYMA 4ILHB 1TN8A 4DX5D 2CCQA 2YHEA 5KBAA 3Q5XA 2QC9A 1N94A 3FZMB 3PUZF 5A7DB 5AIJA 3AA6B 2X6FA 4H9PC 1H7CA 2LKGA 4KHPT 1ZKEA 2L6BA 4BAYB 5JRCB 1OWMA 4X8QA 1JNZA 3J9X1 3GZ2A 4EIWA 4OYSA 2WWVA 4I17A 5C2YA 2ZM2A 2LOSA 5LCYA 3PE4A 4P29A 5HEOA 3Q5MA 2C0MA 4Y6WA 3RIAA 4OK0A 3FTVA 3WAKA 2XENA 3H37A 3AE3A 4O4HE 3PJAJ 2QZAA 4NXMT 5L4EA 3EJNA 1SQMA 4ISTA 3UQ3A 3SD5A 3QOUA 4H9QC 4JI7T 3MXZA 4U33A 5C1DA 4F1SA 2ODUA 5AQ9A 3ZMSB 4JEHA 4K5BA 2BBJA 4YHJA 5HWYA 1MMGA 5CERB 2V7KA 1MIYA 2UUAT 4ZFHA 5J90A 3RIUA 5HEJA 2WQ7A 3OJAA 3LG7A 4PFPA 1HS6A 2AWIA 2J4GA 2WM9A 2VSXE 4CDNA 1NEKA 4I6GA 2V5CA 4ZEYA 1S64A 3VKHA 2WDRA 2H88A 4N78D 1Z5SC 4AISA 2J09A 1HG2A 2W00A 2J49A 3KSLA 3TWUA 4X66T 2K3WA 3SHFA 3DSUA 2BZBA 2HM8A 4DV3T 3DSSA 4HVBA 2XGOA 5KXJA 3SNXA 1US7B 4NRHB 1CUNA 5CMWA 2WXHA 2XM1A 2NXPA 4UI9J 3ULQA 3PS6A 3F6QA 1E90A 1BD8A 4EZKA 3UU6A 3A5XA 1OWOA 3I9YA 3IV0A 3MYVA 4ILAA 1HO8A 2XRYA 2M6BA 4R7LA 1V54E 1O3XA 2ACZA 3EHMA 5CJ5A 5JDNA 2I1KA 3U3WA 4KUMB 4U95D 4JEUB 4TWDA 4OVUA 1OEDB 1R8IA 4CGVA 4HORA 5KMGP 2JQHA 3CEQA 4UWFA 4ADZA 4GTOA 3C64A 4AEZC 3R9AB 1SZAA 3H3MA 3AS8A 4QH5A 2KMFA 2AJAA 5CA0E 4CEMA 4U3CA 4YNDA 3ML9A 4B8CB 2BKOA 2NW7A 1E7PA 3LCAA 3PH0C 4DV6T 1E7VA 4PS3A 1HE8A 4AI6A 3AE7A 3RIFA 5EX3A 3PUQA 2J62A 4EQFA 4CXWA 1N95A 1IKND 3I4GA 3J7Yq 4JI6T 5JR9A 1IZNB 2KBXA 2JQKA 1G73A 4C90A 3WG7E 2H6GA 4GCOA 3CHMA 4HOUA 4XE0A 3IBPA 4G26A 2CM0A 2UU9T 4HE8A 5ABGA 4GZCA 1HNZT 2GROB 2DWGA 4HKAA 5EKQD 1XDOA 4LG6A 1S94A 3AEEA 2WMOA 3QWWA 4ACLA 2BDEA 4JA9A 1WR6A 4ANWA 2DL1A 3D9KA 1T72A 4E7SA 3AAAB 1L5JA 1FPPA 4NIKA 5T4YA 4FHJA 3PRZA 4J8FA 2WXNA 3MKQA 4TNWA 4IHJE 4G2VA 4HFDA 2R5SA 1O5MA 4CXYA 3P4RA 3VLDA 3M65A 4WZXA 2MPKA 2FO1E 1U3CA 2AVPA 3ESKA 3RC3A 1Y01A 2VKDA 5DQVA 5FZRA 5F8PA 3L6AA 2KT9A 4ATGA 4DUIA 4MLPA 1SUMB 2VVNA 5ABFB 5JJTA 1EYHA 3GZ1A 3MCXA 2XPIA 3C72A 2BG9E 4P09A 1U3DA 2IC9A 1BR2A 4U8VD 1T8BA 4WWPA 4X5TA 4I0UA 2D2SA 4APOA 3ASGA 1ZHCA 4AIFA 4F1PA 4EV6A 2HR2A 2ETCA 1Z0PA 3O4ZA 5G05J 1N34T 4DV7T 5KX5E 1X9BA 2H6FA 3O4XE 2E0IA 4HOTA 4TZ4C 2Y1LE 1YMPA 2IY0C 3JAEA 3E0ZA 3KV6A 4PH4B 3QAQA 1N4RA 3PU8A 4J8SA 3ZCIA 3NWIA 3FULA 1LTXA 4PJLA 2RKKA 4GA2A 4GK0E 4TN7B 1Y8MA 2VSNA 4A1GA 2GRQB 5JDGA 3ZNGA 3ZC1A 3QK0A 2R59A 3L39A 3CHOA 3O1IA 5AQMB 3C4XA 2E5VA 3AE2A 2XQAA 3DXMG 2UXCT 3AEFA 4XIFA 2XQ8A 4AKHA 1Z6TA 3AS4A 5CRVA 4ZZBA 3HRAA 1MX6A 4PK6A 4U2YA 3N9PA 3HR0A 1E96B 1E7UA 5LG3A 1OCRE 4WBOA 5LP6E 2V4LA 2XPZA 2DYSE 3AB3B 1W0AA 3S7BA 1D0XA 4PW8A 2IAKA 3LEWA 4A98A 2CHNA 3NBNB 1UGOA 3AE1A 2KXPB 3OYXA 4AVXA 3EHZA 2B0OE 5HXSA 4J2CA 3CVXA 1B89A 5B1BE 3GMIA 2B76A 2PTFA 4JI2T 3EAMA 3UFEA 3J5QB 2L0IA 4A55A 2A9UA 3EHRA 1BU9A 4UF0B 1AJ3A 3K9IA 4DBRA 3KV9A 3CVYA 2XAJB 4JBWF 5LOZA 2E9XC 3ZIMA 5IWAT 1YKEB 2LO6A 3QDNA 1WLXA 4GZ3A 4KXKB 3ESLA 2LEHA 4JHKA 3FUFA 5EN5D 2QGSA 1VDYA 1H6PA 4EBAG 5AQOB 3ZEFB 3GWHA 2PFVA 3D9NA 3TL5A 4DPRA 3ZMVB 4EYUA 5JHBA 4PJMA 2CWOA 2XAQB 4UQXA 3TWQA 3ONLC 3C3RA 3N2GE 3HKDE 3TLTA 3ZN1B 4BJMA 1IBKT 4WNGA 3P4WA 2JQQA 3ANWA 3WAJA 4KYOB 5CMYA 4G63A 4J8DA 3ABKE 3LFMA 1E1HB 2KSRA 3JXJA 3W9FA 2AXDS 4G8LA 1MMDA 2XGSA 4TRQA 4BT9A 2IC6A 4L2YA 3UPVA 1TR4A 1MMNA 2CBJA 5J1GA 1YW0A 3ASNE 5AQJB 3RSEG 1FMWA 1Z3XA 5AQQB 3GW4A 4NUVA 3BQKA 3UUBA 2UXXB 1KF6A 1MHQA 4P0AA 4L9IA 2Y3AA 2LRKA 4FLBA 3IA3A 5EX0A 2EHOB 1X81A 2W0GA 3ZPJA 3C98B 3HKEE 2RFMA 5HXRA 4Q69A 2IONA 3HXFA 3D9HA 5AJLA 4A1SA 2CHXA 1QBQA 2GGFA 5LOVE 3UU8A 3O1JA 2WXRA 3DPYA 4IE7A 5KNHD 3ASFA 3CX6B 5BXOA 3L17A 3TLUA 3TXNA 3L13A 2LSJA 4LF8T 3AEBA 3UU4A 3HG0D 3KV5A 2W62A 3QB5A 3B7UX 5HQ8A 5CBOA 3F57A 1UCUA 5HXCA 4U7IA 4XKBA 4BWRA 5F5WA 3V2XA 5JTGA 2VL8A 3FUEA 4O4IE 4IDNA 4KBQA 3ZT5A 2P9BA 2KLQA 4N5QA 4JHRA 3R7RA 3N2KE 1WYCA 1G3NB 3CVWA 4HI8A 4JD2G 1S63A 3IBEA 4NQ0A 3QOFA 5LG4A 3CVPA 4N3CA 3FB2A 1UX5A 2XS1A 1LKXA 2ZM8A 4JC8A 3ONJA 2BF0X 2FO7A 5HCJA 5AQBA 4BETA 5LBMA 3PTRB 4YT0A 1P5QA 4CDMA 2R6GF 3MZLB 4HOSA 2FF4A 1LVKA 3UKUG 1J5WA 3G2UA 4X1YE 3FUIA 3UT7A 2BBHA 2DZNA 2KXPC 4K0UA 1J1JA 2MAWA 4JZYA 1NENA 1JCSA 1IXVA 3ABME 3ZSSA 2IEJA 4MS6A 4AKIA 4UQZA 5HEUA 3R6NA 4A56A 2GK9A 4PFOA 2LM2A 2Y48B 3LK2B 5KJMA 1OEDA 3LS8A 2ZMAA 2MTQA 2CA5A 2OA5A 2LSIA 4AP2A 3PVLA 1BLXB 1XMQT 3I5PA 5DJQC 4C0MA 3FH8A 4U72A 2ZLYA 2MBGA 4G25A 2UXBT 4BFRA 1VCSA 3ASDA 3GZSA 2MOWA 1UN8A 2A5EA 3HVEA 4UWLA 2BKGA 3L09A 2JRKA 4YTPA 4JB8P 5L3BB 4CZ2D 4Q94A 2AE9A 4YY3T 2A72A 1JNRA 5EDSA 3TG4A 3LY9A 3Q75A 3TLVA 2ZIRA 4FA6A 4L1BA 2ZISA 2E5LT 2ZU6B 3U4TA 2FJEA 5IHYA 4GYSA 3ZHEB 1XZYA 2WXIA 3CPZA 2KM4A 4DR2T 3V5UA 2H7VC 2J4BA 1B7TA 4O4LE 1N0RA 5ENRD 2LSYA 5FXXA 2Q7FA 5FINA 4H9SE 1AWCB 4NXNT 3VRBA 2YINA 3ULEG 3FZLB 3Q9UC 4JLEA 3RF1A 3NRYA 5FP3A 3CQXC 4E7ZA 3CK7A 4TXRA 2ONDA 2XS8A 2BEDA 4JV5T 3RI5A 3NZPA 1ZV4X 4NIQA 5EK4A 1N54A 5ABFA 3ZT7A 5JA4D 3FDHA 3APDA 2L9BA 3BG0B 1GQEA 3Q47B 2BKNA 2PNNA 2HE0A 3AS5A 5ANLA 4OVVA 2J1DG 3RGLA 3RIUC 2QYWA 3ZN0B 5FTPA 2RG8A 4U96D 4AOFA 3LVRE 3OXFA 3ETVA 3HKBE 3N9QA 3SI5A 5G2NA 4IRUA 3DEPA 3FWVA 2XAHB 3B7BA 4CN4A 3RRMB 5ENQD 5AQ7A 1EPUA 2ODVA 2C2LA 5BV1A 4RQIA 3CK8A 2MYSA 2NC9A 1DCQA 3D9MA 5LGUB 5HAXA 3C4ZA 3AE9A 1YXRA 3U3IA 3L82A 4WWNA 2FBWA 4CXXA 4EZ4A 3CVLA 3CR3A 3IEEA 3IKOB 1VCTA 3T1YT 2ACXA 4XI0A 4WNFA 2OEWA 1SA5A 4O8SA 2X0LB 3KSQA 4YJ3E 4BY6A 2LSGA 4JI1T 1BPOA 3RJVA 3N9MA 1S0PA 5FQ4A 3D9IA 1JPLA 3R9MA 3EIJA 1XNRT 2GRMA 4UWHA 3VTYA 3O9XA 5FKYA 1YD8G 4B6XA 3FH7A 2X9WA 4RSYA 1TNBA 1LVFA 5T8IA 5DQWA 2YK0A 4I43A 4WAFA 5HEHA 5AQTB 4IYPA 3PE3A 3Q15A 3KV4A 2WBLA 3P8CD 4GTMA 4H9OC 4LF6T 3RRUA 4GA0A 2X9XA 5ENTD 4QX7B 3ZN3A 3G06A 2WXMA 4FADA 2NYJA 3UM1A 1H2UA 1N36T 3QC9A 3EI0A 2V6XA 4UF0A 2WXOA 5FVLA 3KDSE 3AE4A 4HGAA 1MNDA 2WDQA 1K1BA 2LSUA 2KCLA 4DJAA 2J8SD 3ZPOA 1VRBA 1UK5A 2X6HA 4F6RC 1LF8A 4MRUA 2R17C 1OWPA 4JI4T 4CN6A 5B1AE 4DX1A 2PM6A 4AQFC 4Q96A 3ZEFA 3OTOT 4JHJA 3ZYQA 4ILUA 4ZHQE 5DBKA 4LFCT 4UI9K 4AXHA 2X67A 5JDFA 4LF4T 4UI9C 2CXFA 2OLTA 4AY5A 5LXTE 2ZM6T 4UELA 3RYFE 4IE5A 2HYZA 3G2VA 4G23A 2PL2A 3T1HT 3GN5B 5E0OA 4RG9A 4LMKA 2M67A 3UUMA 2OVFA 5E75A 2I9CA 2WB2A 5FJYA 3CWZB 2V1DB 1NWMX 2JJ9A 4PJJA 5L3EB 1XGWA 1LRZA 4N3BA 1XNQT 3Q5WA 4URKA 4AIUA 4ERRA 1GW6A 2DIWA 3EABA 1HX8A 2X6JA 3BQOA 2VSYA 2LLYA 3CKCA 4AJWA 3PUVF 3TLWA 2EHOA 1W9RA 2WY2A 3Q5EA 4Z91A 3MJXA 3C98A 4U0UA 4UWGA 1CHUA 2P9PG 3V31A 3R84B 2LAIA 2Y8DA 5CECB 3SGHA 1IQUA 3UM0A 3K8PC 4QKNA 2LXLA 2ZGGA 2VGEA 3QARA 3NOGD 5EILA 3SQVA 1XMOT 4L7TA 4DX6D 4AKGA 2XQ4A 3PEUB 4G1TA 2VQ2A 3UQ7A 4PNIA 5JDHA 4WWOA 4GYWA 1TNYA 3OXLA 4UVAB 4ZI2C 1UOHA 3QUJA 1A5EA 3FTZA 4H7XA 3D9LA 4J7WA 4COFA 4IDQA 5LA6E 2RD0A 4GPKA 4YJ2E 2I59A 3P2BA 4OAUC 3JCKC 1ZP0A 3LYAA 3GYZA 4V1Av 1KFYA 4GMLA 4TV3A 4QX8B 3PE0A 4JW1A 2X0HA 1EF1C 4GKKT 3SY2A 4B0ZA 1OWLA 3BG1B 4HFBA 3AG2E 3E37A 3RYHE 3EIQC 2G0UA 4U2ZA 3JC6D 3MKRA 3EUHA 4CI1B 2ETBA 2SPCA 2EIKE 3B95A 1QNFA 2Q9QC 3PZ1A 4XX5A 3V2OA 4P1NA 3ZXPA 5BXUA 4CT0A 1N9AA 4BJNA 2CHZA 2E9XB 1MIVA 3Q2MA 3RRWA 1D0ZA 3PDNA 4CT4A 2VASA 4J8EA 4YDEA 2VGYA 5G05C 3A8YC 1ZOYA 2NSZA 5AQGB 2IO3C 3NZSA 2N1GA 1K8KG 3FHEA 4CYMD 4YHHT 5KCMA 2CHWA 4KT6B 3ZUVB 4OYKA 5ENPD 5BV0A 3TAXA 1IQRA 2YEVC 3FFLA 4AM9A 1VOMA 4KBMB 4IL4A 2XQ0A 1TYQG 4JA7A 3J5PA 2LSKA 3PUJA 3CMLA 2XQ3A 1WDYA 4H7YA 4TXQA 3EUVA 1OXJA 4GTVA 2DWKA 4YFSA 3DWLG 2ZGDA 2WQ6A 1FT2A 2W66A 3TWVA 3HHMA 3UTMA 3RU0A 4CDRA 2VVSA 4O2BE 3CVNA 3UT4A 1IYGA 2A3DA 3IHVA 3FH5A 1O1TA 4I6EA 5FT9A 3CK9A 1OEDE 3CHQA 2WPVA 4EHMA 3LSVA 2XPYA 4X20E 4LSZE 4EOZB 4U7YA 3UKRG 1S70B 4KHZF 2WDVA 1OUVA 3ZJ2A 2P9IG 2XQ7A 1IBMT 4ATZD 1WRDA 3V79K 2I2OA 1MQSA 2NP9A 3DJBA 3TLSA 3SFDA 4QFVA 5E76A 2OV8A 4LEUA 2UUCT 3HA4A 1HG5A 2N2NA 3CHSA 2XZEA 3T8KA 5LMUT 1WR0A 5ANRA 5BW8C 4N2SA 3O48A 2F4VT 5J2TE 3G2WA 2LOPA 3PUXF 4PUCA 4U31A 1N11A 4DBQA 2IO2C 2DCFA 5CRUA 4HRLA 1INZA 5L3DB 3ZKRA 4AKRB 5C3JA 4DLQA 3Q73A 3QB5K 2VWAA 4JYAT 4F7AA 4X1KE 3F2EA 3F31A 2XQ9A 3I3NA 2I6HA 3T9KA 3DSXA 3PURA 4LFAT 3AEDA 3AECA 2XHEB 3B13A 3I0OA 4DNDA 4UV9B 4GU5A 2DWZA 3TWWA 2XZDG 4GYRA 4HB5A 4FULA 2CMRA 3UQ4A 3LBXA 4FJYA 3RRCA 3FZFB 4I1OB 5H6QB 3AVRA 2CWYA 5LMNT 1NP7A 3AU5A 2DVWA 3IEGA 2BKKB 2VKJA 2NWBA 5BPPA 5CEDB 2IU1A 3RRNB 2X9YA 4WNEA 1MX2A 3FBZA 1TJFA 2LNIA 4DI3A 2R03A 5J08A 2VTBA 4LRZA 5H7PA 1BR4A 2BS2A 4WYVA 3RLFF 2H89A 4UR9A 4J6IA 5FQ6A 4AKLA 4HFEA 4I4TE 3CLJA 2NR4A 3ONKA 3K3NA 2L0TB 3MZKB 2BG9C 2R02A 5ARGA 3RIBA 2BTDA 2L9QA 5AAOA 5LJMA 5A23A 3ULYA 2RFAA 3P50A 4A97A 4W9RA 5FZSA 3K3OA 3ZVVA 3MGBA 4QWNB 5TAOA 3UX4A 4EEBA 5EYLA 5HWXA 4A63B 1UW4B 3KBUA 1M62A 2V7MA 3QC1A 1UURA 1Q2ZA 4Z90A 1T7SA 4MBGA 1V9DA 5LHGB 3TJPA 3LDQB 4DLOA 4PK5A 2CFZA 2H3RA 5JRCA 4MFRA 2KWHA 5LCWC 4XEIG 1FCHA 4K5CA 2P9KG 4FU3A 4L5GA 3PUYF 4ZOLE 4P0BA 4N5CA 5L2LA 4GMRA 4U7EB 2MRIA 2QYUA 4C9BB 4PAGA 3ZRHA 4GB9A 3GN5A 5FMNA 4GOUA 4DR1T 2EQXA 2V4HC 5ABHA 3C3QA 3FTUA 4WNKA 5FXWA 3ZCJA 4NACA 1N0QA 4MHCA 2ETAA 4KP3C 5G04J 3S7JA 2IOSA 5BR8T 3B7TA 5AN8A 2WS3A 4UV8B 4IIJE 3BEEA 4GTRA 3CQCB 3ZYKA 1NA3A 2CG3A 3ZJ1A 1O1SA 3KEZA 3VRAA 2HO1A 5EYPF 3CSTA 4DR4T 1XNFA 3X1DA 3LVQE 1ZU2A 2VL0A 1U4QA 3TWXA 3S4UA 3PNLB 4ANXA 4PJNA 3ETUA 4YTNA 3OBVE 3C3OA 4ILBA 3CKBA 3AE6A 4RLYA 4B3TT 5LCWJ 2D0UA 4LF5T 1H2VC 3Q7AA 3JQ0A 1YA0A 2RPAA 2ES0A 1HNXT 2UUBT 2WMNA 1D1AA 2EHOD 4K5AB 1S35A 2EINE 3AE5A 2H6IA 1SVXA 4JXTA 2XGMA 4LFBT 2DHRA 2WXGA 2F8XK 3E30A 5HXEA 3U64A 5BUZA 1LD8A 3E4BA 3FXEB 3WXXA 2IQCA 2DYRE 1K1AA 2XEVA 4JEUA 3LKUA 4B3ST 1N4PA 4ZS2A 3VU7H 2X3MA 3UT5E 4RVBA 4LCTA 1X5BA 4DR6T 3DBSA 2VGXB 5FXVA 4IULA 3HKCE 4CN1A 2OCCE 1HFAA 2OV9A 1BI8B 3CX7B 3PUGA 3HXDA 2YN6A 4ANUA 5CB4E 4HXIA 3C51A 2LE8A 1DCEA 1DC2A 4EECA 3RHWA 1HCIA 2E9XA 3DRAA 2BVMA 2V26A 3DEOA 3TKLB 2DZOA 2Y6XA 4FJOA 2LSVA 2V7JA 2EIJE 4GZ5A 5AQSB 3UT8A 2XTLA 2KZ7B 4I1AA 4DV1T 3M3ZB 2DLRA 2WXQA 3ZGQA 3G2SA 2QY7A 2XAGB 1KT0A 2I1JA 1H19A 2KNDA 3LY7A 1HX1B 2HH7A 2BS4A 3BQIA 4U0ZA 4X62T 4U74A 5ARFA 5EIDA 1NA0A 5B3SE 1MMAA 3SWHA 5KJNA 2GRPB 2E8IA 3E32A 2WP9A 4YDOA 5L3GB 3MKQB 3LK42 2X6IA 4YTMA 2AW6A 4CGWA 4C0EA 4H9RC 3PREA 4GTPA 4LERA 4BSXA 3PNTB 2Z6EA 3DP7A 4EAHA 5LHIB 1BR0A 4PDXA 4HRNA 2PG8A 3VHLA 2WXPA 2XJ7A 3AAEB 3MV2B 3LJCA 3DXKG 2UY1B 2HPJA 2V5DA 3OYZA 2Y0BG 4O4JE 5LHHB 3B5MA 5ETWA 3DSVA 2PJQA 2VURA 2GRRB 4HI9A 4CZZB 2BS3A 2FJAA 1KPSB 5LP0A 5AQVB 1FJGT 2CHOA 5AJDA 4CI2B 2CXLA 1OCZE 4GTSA 3CSFA 3IF8B 1N33T 3MJWA 3CVQA 4YSYA 4KVOA 3L3PA 3RO3A 3AG3E 1OT8A 4FI5A 3HXCA 2QRXA 3OPCA 3UINC 2WSSV 1D8DA 3FTXA 2ZM0A 3IHRA 3OAWA 3X2QE 4HLEA 3CKDA 3K1SA 3CV0A 1SW6A 1W3BA 3JYSA 1UUSA 3SBTB 2XQYA 1JCQA 1UX4A 5H6RB 4U63A 2YKSA 3PUAA 4MLKA 1WY6A 4TUMA 1HNWT 4KX6A 4H63H 4JPSA 1HXIA 3RKOA 4HFGA 3BQLA 5AYWD 3FUMA 2C0LA 4B8AA 1Y64B 3AEAA 4GMJA 2FI7A 4CRWA 3FP3A 3FTWA 2Q9QB 2V7LA 3SFEA 4HTEA 4Q25A 3ZC0A 1A17A 4QXBB 3PZDA 4GAAA 4U07A 3D0TA 4YDWA 1JUQA 3DTOA 4PK4A 2W4XA 2X66A 3L8RA 4L9PA 2LKHA 1UJJA 1JCRA 4F8HA 2VKOA 3C4WA 2CBIA 2BVLA 3OKQA 3ZW3A 1YYHA 2FUPA 4DR5T 4XZ4A 2X51A 3MA9A 5BMVE 3E33A 2JABA 3I4RB 1DVPA 3AA1B 1W09A 3UI2A 3T5VA 2WXKA 4ME2A 4J0UA 4AQGA 5JR9C 1NZNA 2E2AA 1SHZC 4YXDA 4G8KA 3RX6A 2X68A 3S7DA 3SFYA 4OAVB 1D9SA 3SO8A 1H0AA 2XCBA 3G2TA 1ZEEA 2IW5B 3KBTA 4WNDA 3MX3A 2WZIA 5CGMA 2JEKA 4ZXLA 3FU3A 5C2TA 3HXBA 4F3VA 3T8OA 3BU8A 4O1PA 5L4HA 1HTJF 2CPTA 4O60A 4HN9A 4MKTA 4HFVA 3FUHA 4IGUA 2R2LA 4CCAA 3B7RL 3HYMB 4KMCA 2DNXA 1D1CA 3EDVA 3OTNA 4QXCB 4LF7T 4AQYT 1PAQA 4ANJA 2V7IA 3B7SA 5AQUB 4ZS3A 2DBAA 1N52A 1G8XA 1SE7A 2WU2A 1H6KA 1WM5A 2YQ8A 1E8WA 2IUBA 4DIDB 2MOZA 5EK2A 1IJ6A 3U9WA 1QUUA 4GZDA 4IREA 4Z68A 2WAUA 2M63A 4ZHBA 5F3JA 4H63V 4HFHA 3O1HA 2IDOB 5M72A 3VLEA 2P9SG 5AQPB 4O1OA 3VR9A 1WCRA 1PC2A 4G24A 5LNKA 5HXHA 1FIOA 2CFUA 3QJZA 3HXEA 3JUIA 1N32T 4HWHA 1TNZA 5FY7A 5J0ZA 2XEEA 3APCA 4H9NC 4BEPA 3KAEA 5D0QD 5FWQA 1KNZA 4YLHA 3L08A 2XUEA 4UEMA 3RH3A 2W67A 3UU5A 1JWGA 2KC7A 5JDLA 4JI0T 3OVUA 4EPZA 2W61A 1SA4A 4G2AA 2M6IA 1JWFA 3W15B 2PQRA 4BA9A 3FU0A 4APFA 2JLBA 3N9OA 4RG6A 3TG5A 3RKGA 4BTBA 5GONE 1KLXA 2NW8A 4GTQA 2W2UA 3QKYA 2QVAA 3SOLA 3UUXB 4UVCB 2XPKA 4YVOA 2VQFT 4LMJA 4DV5T 5BNWA 4I2WA 4TUUA 1W0BA 2LT3A 2XY8B 4EZHA 4HFIA 4TXPA 1HU3A 3KVAA 1HZ4A 3FUDA 2QA7A 3W9GA 3AE8A 1ELRA 4YVQC 3PUWF 2K5BB 3HI2A 1I6ZA 3D9PA 4X65T 3VLFA 4K0RA 3FTSA 4E85A 4U04A 3N9LA 3HDXA 4V3IA 5ABEA 4IE0A 2BUGA 2WQYA 3AG4E 3IXEA 3UIPC 4AY6A 3Q5DA 4BERA 5ENOD 2J9QA 1HH8A 4FLHA 1D8EA 3L9TA 4KZ0A 2LHNA 1WAO1 3FZHB 2Y4UA 1FEWA 2IOLA 3FUNA 3KS2A 3V30A 1YQ4A 2YU2A 3P4QA 1NAFA 3ZMUB 3RYIE 1WG0A 3PJAA 4D10C 4DK5A 4C48B 3HIZA 3AA0B 2AXZA 3SFZA 4Y6CA 4TUYE 2P9NG 2BG9B 2LXMA 5FY1A 2CLYC 3FU6A 4YDYA 3Q7FA 2JMKA 4DUZT 2VGXA 4DUYT 5FL0A 5T3RA 4HS2A 2F37A 3JUEA 4FJZA 5LGNB 3ONXA 3T5XA 1OXZA 5DABA 5C8YE 3HVEB 5J2UE 3NB2A 5JMND 5AQFB 4GA1A 3IHYA 3TGOA 2B1EA 2GRLA 3LDZA 2GRNB 1Y6IA 4J8YA 4KZCA 5L3FB 4FC8A 2V6YB 1EDUA 5AQAA 3AVSA 3T8MA 3RKVA 1YCSB 4AQFA 3Q49B 3UFGA 1E8ZA 2X0YA 1KT1A 2B6CA 5JQGE 1N4QA 3FTYA 1Z8UA 5EIBE 1WFDA 3VTXA 3AXJB 5JHAA 5HCMA 3ZHEA 4LNGA 3NBXX 4UIGA 4ASKA 3ASHA 2E9XD 3U66A 3RK6A 4O6FA 3NOCD 5HKPA 1WYBA 3WI3A 4BT8A 5LJNA 4DRXE 4TWFA 3RYCE 3FHNA 3QK6A 4XKCA 2L8KA 1YKHB 5LFAA 4BX9A 3ZFWA 3MA5A 3NF1A 1TNOA 4JUYA 4ZI3D 5AQNB 1SZ9A 2DI4A 3KVBA 2D0TA 3QB2A 2YDSA 4HWIB 1BR1A 3R7QA 2IMLA 2QYJA 4CQIA 5A6CA 2K9AA 2UY1A 4UUCA 1UG3A 2WB5A 1ELKA 3C5RA 3AG1E 3TWSA 4WW0A 3KINB 5LB7B 4OYJA 5AQIB 2ILRA 1O1RA 1DU2A 4QHOA 1KK7A 4BTAA 4AV7A 2FBNA 3FEYA 2J08A 2XQ5A 5D2MC 3CIRA 4TWHA 1NL4A 1KNPA 5KWDA 4GCNA 5HS0A 3UM2A 3JC6C 3N2OA 4QQIA 3AEGA 3Q9NC 4K0KT 3PZ3A 3FU5A 3E22E 4IL9A 3RO2A 2NTXA 3N5LA 3ZT6A 3UTKA 2UXDT 4MALA 3BUAA 3RC8A 4Z8XA 4UVBB 1RW2A 3QWVA 5D0OD 5LBQB 1DNPA 2HN2A 5FQ8A 3TXMA 2R05A 1FVFA 5ENSD 4IT4A 3CGHA 2N9DA 1TN7A 2VB6A 4HQDA 4XZCA 3FXDB 2IFUA 4E6HA 2NW9A 4WBNE 1TEZA 2CE7A 5CCMA 2KZTB 3VR8A 5JREA 1OWNA 1NI1A 3PZ4A 2Y69E 3UU3A 1MX4A 4BX8A 3NZUA 2Q9QA 2E2EA 3QNUA 1XWMA 4I43B 5AQRB 3P4PA 4DI4A 3ABVA 1FT1A 5G04C 4U8HA 1OEDC 3ISMC 4GYYA 4JI3T 1EZ3A 4AXPA 3FEXA 1OCOE 3EDTB 5IUXA 4EGWA 2D9DA 3ZYLA 3FY4A 5KDMC 4A3VA 4DX2A 4HRMB 5LYJE 2YNQA 1BI7B 4EBAA 3ZSTA 2HPLA 5AQLB 2CXDA 3DSTA 4HWCA 3D3MA 3JXIA 1MNEA 4GYOA 4KMOA 4JL0A 2CG2A 5JJ7A 4N39A 3I0QA 3K3QC 3LXUX 5FVKA 4QH4A 2RA1A 4HWDA 4NUUA 4I50E 5IYZE 4QH1A 4HLLA 3CK6A 1E2AA 2XRZA 4GZ6A 3Q4AB 4GKJT 4UWKA 3MKDA 4HBDA 4TX5A 4ZI3C 3CIAA 4N2QA 3CVUA 4PS8A 1KEYA 3TWTA 5AFUL 2X38A 3UULA 4UXNB 4K03A 3I1AA 3MK7C 5IY5E 3VKGA 3ZU7B 2MYOA 2L3LA 4DR3T 2PQNA 3AAAC 1ELWA 1MYOA 1FVHA 2PZIA 2P2CP 5HEGA 2XSAA 2WWUA 3SRZA 2K24A 3L16A 3JCFA 4GIWA 2WXFA 3EU9A 4JI8T 3PDYA 4JEHB 5KNGA 3UIOC 1IHGA 2X6KA 4TV9E 4GTTA 1SA0E 5BT1A 3AAIA 2LJLA 2C5IT 2C5JA 2H6HA 3A7MA 2KATA 1XDPA 5FIOA 5A1LA 1RZ4A 1TNUA 2XCCA 2IJGX 1IBLT 5M4YA 2KCKA 3FUKA 1M7KA 1IHBA 3ZKJA 3UMVA 1UN9A 2OEVA 4U8YD 4XBFB 1X79A 1MIWA 3EDUA 4XAXB 1UJKA 4TNVA 2A2FX 2X9HA 2QFCA 4OX9T 1KZOA 3CX8B 3ENEA 4XI9A 4LNBA 2YU1A 2FULA 4IN3B 4DX7D 2D5UA 3LY8A 1IJ5A 2J07A 4IDOA 4O2AE 2EILE 3CVVA 1LD7A 4DV4T 4GPMA 3S2AA 4DMWA 4I9EA 1E8XA 1ZB1A 5FQ7A 5JH7E 4B89A 3NVOA 3HL6A 3JQ1A 1H2TC 3UUXA 1HF8A 4G11A 4L23A 1K3ZD 3DSWA 3SF4A 4ILGA 4EXTA 4DV2T 3NQPA 5AQHB 1KNRA 4UQYA 5CHEE 3RPUA 3S7FA 3RQUA 2C0SA 3E34A 4ILIA 2WU5A 3RAUA 4A3TA 4N3AA 2KINB 5FL1A 3V5SA 4LNUD 4I9CA 4ACKA 5EK3A 2FEZA 4BESA 1T98A 1D1BA 2LAHA 3E08A 2P58C 2F0YA 1TJCA 4I1MA 4ANVA 5AENA 2J47A 4I55E 5CCLA 3QWPA 2VQET 3AA7B 4QXHB 4DO0A 2WZHA 4B3MT 2W63A 2OVBA 2A5UA 2A4ZA 4EZLA 2IHR1 3JAFA 3Q78A 2P9LG 2WCAA 2WXJA 4M1PA 3PU3A 3ZLIA 3ASOE 3ZXSA 3D9JA 5JR9B 2XQ6A 2NTYA 2WXLA 4OHFA 4HNAD 2BG9A 2V8SV 2WVIA 1L0VA 4A5XA 4OFZA 3Q79A 3B57A 5FZQA 2NOXA 1QLBA 4YSZA 3EU5A 3H3AA 3UUNA 2AXVA 5ENNA 3CQGB 3LK3B 4C91A 2WQHA 4IDZA 3ONLA 4EZJA 3MV3B 1MJ0A 4EB6E 4ISSA 3EHNA 3L54A 2CRBA 2AXUA 2IF4A 5FY0A 5L3CB 4LMLA 4ABNA 2JIWA 3FZKB 5JDQA 4NPPA 3P7IA 4EYYR 3BK9A 4IE6A 3CHPA 2V6YA 2PBIA 1U5PA 3DPDA 1H6OA 5CA1E 2KWIB 3PUSA 5KJLA 2YHCA 4FHKA 3EHQA 2HHHT 3N71A 5DIZA 1KZPA 3AXJA 2VKHA 4BSZB 1OY3D 4HFCA 2V5FA 4X1IE 1V55E 3APFA 2HN1A 2I0MA 2FJBA 1HR0T 3ABLE 3PZ2A 3GA8A 2KCVA 2H7OA 3N9NA 4ZZCA 3FBLA 4F6RD 2OOEA 2RP4A 2LHRA 5FNVE 3ML8A 1D0YA 3PEVB 3URZA 2MHKA 2VJ8A 4DMVA 4LF9T 2C5KT 4MBQA 4LUNU 4B94A 3C50A 5EZYE 4B93B 2XZTG 3KFWX 5JDMA 3CHRA 3I9WA 2VYIA 2J4DA 1QYMA 5HRYA 2FJDA 3JADA 2EHOC 1QZ2A 5LGTB 4JI5T 2V8SE 4KVMA 4WUYA 3CVRA 3P1UA 4PS7A 1YQ3A 5L47A 4GK5E 2XSBA 2EIME 1I94T 3AJIA 1Z3YA 4L2LA 5AQKB 1TN6A 5FYMA 2V0PA 2L6JA 3MACA 5ADXL
chains in the Genus database with same CATH topology
1FMVA 2XAFB 3U78A 4I6JA 3NRXA 5G55A 1PY1A 2UXNB 4HEAA 4M3OA 3AU4A 2XASB 3SS1A 3MEKA 3SBSA 3ZMTB 2CEAA 1QSDA 2Y4TA 2XHEA 4DVDA 5FXZA 1QQEA 5HYAA 3LPZA 4CI3B 3LBXB 3SZ7A 3PUKA 5KJKA 3QNKA 4ZI7E 3LJ3A 3D9OA 4U0SA 4HOQA 2K48A 3L22A 3Q9DA 2LM9A 3ZMZB 2UWJG 1HS7A 4NURA 4I2ZA 2CLYB 2KZTA 2VTBB 4TV8E 4ZI2D 5HI7A 5JVDE 4FP7A 4IE4A 1E8YA 5LX8A 2VK9A 1OWAA 2PM7A 2JMHA 2DCPA 2JPFA 3KD7A 5JJ6A 1IAPA 2VSOE 2GW1A 4JVSA 3NZQA 4F53A 3OXGA 3EVYA 4L0RA 3ANWB 1ZBPA 3FUJA 2Q9QD 3ZYMA 4ILHB 2CCQA 2YHEA 3Q5XA 5A7DB 5AIJA 3AA6B 2X6FA 4H9PC 1H7CA 1ZKEA 4BAYB 5JRCB 1OWMA 3J9X1 3GZ2A 4EIWA 4OYSA 4I17A 5C2YA 2ZM2A 2LOSA 5LCYA 3PE4A 4P29A 3Q5MA 2C0MA 4Y6WA 4OK0A 3FTVA 3WAKA 3H37A 4O4HE 3EJNA 1SQMA 4ISTA 3UQ3A 3SD5A 3QOUA 4H9QC 3MXZA 5C1DA 4F1SA 2ODUA 3ZMSB 4JEHA 4YHJA 5HWYA 1MMGA 2V7KA 1MIYA 5J90A 2WQ7A 3OJAA 3LG7A 4PFPA 1HS6A 2AWIA 2WM9A 2VSXE 4CDNA 4I6GA 3VKHA 4N78D 2J09A 1HG2A 2W00A 2J49A 3SHFA 4HVBA 2BZBA 2HM8A 2XGOA 3SNXA 1US7B 4NRHB 1CUNA 5CMWA 2WXHA 2NXPA 4UI9J 3ULQA 3PS6A 1E90A 4EZKA 3A5XA 1OWOA 3I9YA 3IV0A 3MYVA 1HO8A 2XRYA 4R7LA 1O3XA 3EHMA 5JDNA 2I1KA 3U3WA 4KUMB 4JEUB 4OVUA 4CGVA 4HORA 5KMGP 3CEQA 4UWFA 4ADZA 3C64A 4AEZC 3R9AB 1SZAA 3AS8A 2KMFA 5CA0E 4CEMA 4YNDA 3ML9A 4B8CB 2NW7A 3LCAA 3PH0C 1E7VA 4PS3A 1HE8A 4AI6A 5EX3A 3PUQA 4EQFA 4CXWA 3I4GA 3J7Yq 5JR9A 1IZNB 1G73A 4C90A 4GCOA 3CHMA 4HOUA 4XE0A 3IBPA 4G26A 2CM0A 4HE8A 4GZCA 2DWGA 4HKAA 5EKQD 1S94A 2WMOA 3QWWA 4ACLA 2BDEA 4JA9A 1WR6A 4ANWA 3D9KA 4E7SA 3AAAB 1L5JA 5T4YA 4FHJA 3PRZA 4J8FA 2WXNA 3MKQA 4IHJE 4G2VA 2R5SA 4CXYA 3VLDA 3M65A 1U3CA 2AVPA 3ESKA 3RC3A 2VKDA 5DQVA 5FZRA 5F8PA 3L6AA 2KT9A 4ATGA 4MLPA 5JJTA 1EYHA 3GZ1A 3MCXA 2XPIA 4P09A 1U3DA 2IC9A 1BR2A 4WWPA 2D2SA 4APOA 3ASGA 1ZHCA 4AIFA 2HR2A 1Z0PA 3O4ZA 5G05J 5KX5E 3O4XE 2E0IA 4HOTA 4TZ4C 3E0ZA 3KV6A 4PH4B 3QAQA 3PU8A 4J8SA 3ZCIA 3FULA 4PJLA 4GA2A 4GK0E 4TN7B 1Y8MA 2VSNA 4A1GA 5JDGA 3ZC1A 3QK0A 2R59A 3CHOA 3O1IA 3C4XA 4XIFA 4AKHA 1Z6TA 3AS4A 4PK6A 3N9PA 3HR0A 1E96B 1E7UA 4WBOA 5LP6E 2V4LA 2XPZA 3AB3B 3S7BA 1D0XA 4PW8A 2IAKA 3LEWA 2KXPB 3OYXA 4AVXA 5HXSA 4J2CA 3CVXA 1B89A 3GMIA 3UFEA 2L0IA 4A55A 4UF0B 1AJ3A 3K9IA 4DBRA 3KV9A 3CVYA 2XAJB 5LOZA 2E9XC 3ZIMA 1YKEB 2LO6A 3QDNA 1WLXA 4GZ3A 4KXKB 3ESLA 2LEHA 4JHKA 3FUFA 2QGSA 1VDYA 4EBAG 3ZEFB 3GWHA 2PFVA 3D9NA 3TL5A 4DPRA 3ZMVB 4EYUA 5JHBA 4PJMA 2CWOA 2XAQB 4UQXA 3N2GE 3HKDE 3ZN1B 4BJMA 4WNGA 2JQQA 3ANWA 3WAJA 4KYOB 5CMYA 4G63A 4J8DA 3LFMA 1E1HB 1MMDA 2XGSA 4TRQA 4BT9A 2IC6A 4L2YA 3UPVA 1MMNA 5J1GA 1YW0A 1FMWA 1Z3XA 3GW4A 4NUVA 3BQKA 2UXXB 1MHQA 4P0AA 4L9IA 2Y3AA 4FLBA 5EX0A 2EHOB 3ZPJA 2W0GA 3C98B 3HKEE 5HXRA 4Q69A 2IONA 5AJLA 4A1SA 2CHXA 2GGFA 5LOVE 3O1JA 2WXRA 4IE7A 3ASFA 3CX6B 3L17A 3TXNA 3L13A 2LSJA 3KV5A 2W62A 3B7UX 5HQ8A 3F57A 1UCUA 5HXCA 4XKBA 4BWRA 2VL8A 3FUEA 4O4IE 4KBQA 2P9BA 2KLQA 3R7RA 4JHRA 3N2KE 1WYCA 3CVWA 3IBEA 4NQ0A 5LG4A 3CVPA 4N3CA 3FB2A 1UX5A 1LKXA 2ZM8A 4JC8A 2BF0X 2FO7A 5LBMA 3PTRB 1P5QA 4CDMA 3MZLB 4HOSA 2FF4A 1LVKA 3G2UA 4X1YE 3FUIA 3UT7A 4K0UA 4JZYA 4MS6A 4AKIA 4UQZA 3R6NA 4A56A 2GK9A 4PFOA 2Y48B 3LK2B 5KJMA 3LS8A 2ZMAA 2MTQA 2CA5A 2OA5A 2LSIA 4AP2A 3PVLA 3I5PA 5DJQC 4C0MA 3FH8A 4U72A 2ZLYA 2MBGA 4G25A 4BFRA 3ASDA 3GZSA 2MOWA 1UN8A 3HVEA 4UWLA 3L09A 2JRKA 5L3BB 4Q94A 2A72A 5EDSA 3TG4A 3LY9A 4FA6A 4L1BA 2ZU6B 3U4TA 5IHYA 4GYSA 3ZHEB 2WXIA 3CPZA 2KM4A 3V5UA 2H7VC 2J4BA 1B7TA 4O4LE 2LSYA 5FXXA 2Q7FA 4H9SE 2YINA 4JLEA 3NRYA 5FP3A 3CQXC 4E7ZA 3CK7A 2ONDA 3NZPA 1ZV4X 5EK4A 1N54A 3FDHA 3APDA 2L9BA 3BG0B 3Q47B 3AS5A 5ANLA 4OVVA 2J1DG 3ZN0B 5FTPA 2RG8A 4AOFA 3LVRE 3OXFA 3ETVA 3HKBE 3N9QA 3SI5A 5G2NA 4IRUA 3FWVA 2XAHB 3RRMB 1EPUA 2ODVA 2C2LA 5BV1A 3CK8A 2MYSA 2NC9A 3D9MA 5LGUB 5HAXA 3C4ZA 3U3IA 4WWNA 4CXXA 4EZ4A 3CVLA 3CR3A 3IEEA 3IKOB 2ACXA 4XI0A 4WNFA 4O8SA 2X0LB 4YJ3E 4BY6A 2LSGA 1BPOA 3RJVA 3N9MA 1S0PA 5FQ4A 3D9IA 1JPLA 3EIJA 2GRMA 4UWHA 3VTYA 3O9XA 1YD8G 4B6XA 3FH7A 2X9WA 4RSYA 1LVFA 5T8IA 5DQWA 2YK0A 4I43A 4WAFA 4IYPA 3PE3A 3Q15A 3KV4A 2WBLA 3P8CD 4H9OC 3RRUA 4GA0A 2X9XA 4QX7B 3ZN3A 2WXMA 4FADA 1H2UA 3QC9A 4UF0A 2WXOA 3KDSE 4HGAA 1MNDA 2LSUA 2KCLA 4DJAA 3ZPOA 1VRBA 2X6HA 4F6RC 1LF8A 4MRUA 2R17C 1OWPA 2PM6A 4AQFC 4Q96A 3ZEFA 4JHJA 3ZYQA 4ILUA 4ZHQE 5DBKA 4UI9K 4AXHA 2X67A 5JDFA 4UI9C 2CXFA 4AY5A 5LXTE 4UELA 3RYFE 4IE5A 2HYZA 3G2VA 4G23A 2PL2A 4RG9A 3GN5B 5E0OA 2M67A 3UUMA 2OVFA 5E75A 2I9CA 2WB2A 5FJYA 3CWZB 2V1DB 1NWMX 2JJ9A 4PJJA 5L3EB 1XGWA 1LRZA 4N3BA 3Q5WA 4URKA 4ERRA 1GW6A 2DIWA 1HX8A 2X6JA 2VSYA 3CKCA 4AJWA 2EHOA 3C98A 3MJXA 4U0UA 4UWGA 3R84B 2LAIA 2Y8DA 3SGHA 1IQUA 3K8PC 4QKNA 3QARA 4L7TA 4AKGA 3PEUB 4G1TA 2VQ2A 4PNIA 5JDHA 4WWOA 4GYWA 3OXLA 4UVAB 4ZI2C 3QUJA 3FTZA 4H7XA 3D9LA 5LA6E 2RD0A 4GPKA 4YJ2E 2I59A 3P2BA 3JCKC 3LYAA 3GYZA 4V1Av 4GMLA 4TV3A 4QX8B 3PE0A 4JW1A 1EF1C 4B0ZA 1OWLA 3BG1B 3RYHE 3EIQC 2G0UA 3JC6D 3MKRA 3EUHA 4CI1B 2SPCA 4XX5A 1QNFA 2Q9QC 4CT0A 4BJNA 2CHZA 2E9XB 1MIVA 3Q2MA 3RRWA 1D0ZA 3PDNA 4CT4A 2VASA 4J8EA 2VGYA 5G05C 2NSZA 3NZSA 2N1GA 3FHEA 5KCMA 2CHWA 4KT6B 4OYKA 5BV0A 3TAXA 1IQRA 2YEVC 3FFLA 4AM9A 1VOMA 4KBMB 2XQ0A 4JA7A 2LSKA 3PUJA 3CMLA 4H7YA 2DWKA 4YFSA 2WQ6A 3HHMA 3RU0A 4CDRA 4O2BE 3CVNA 3UT4A 1IYGA 2A3DA 3IHVA 3FH5A 4I6EA 5FT9A 3CK9A 3CHQA 2WPVA 2XPYA 4X20E 4EOZB 1OUVA 3ZJ2A 1WRDA 2I2OA 1MQSA 2NP9A 3DJBA 4QFVA 5E76A 2OV8A 4LEUA 3HA4A 1HG5A 2N2NA 3CHSA 5ANRA 5BW8C 4N2SA 3O48A 5J2TE 3G2WA 2LOPA 4PUCA 4DBQA 2DCFA 1INZA 5L3DB 4AKRB 4DLQA 2VWAA 4F7AA 4X1KE 3F2EA 3F31A 3I3NA 2I6HA 3PURA 2XHEB 3B13A 3I0OA 4DNDA 4UV9B 4GU5A 4GYRA 4FULA 2CMRA 3LBXA 4FJYA 3RRCA 4I1OB 5H6QB 3AVRA 2CWYA 1NP7A 3AU5A 3IEGA 2VKJA 2NWBA 5BPPA 2IU1A 3RRNB 2X9YA 4WNEA 3FBZA 1TJFA 2LNIA 4DI3A 5J08A 2VTBA 4LRZA 1BR4A 4J6IA 5FQ6A 4AKLA 4I4TE 3CLJA 3ONKA 3K3NA 2L0TB 3MZKB 5ARGA 3RIBA 2BTDA 2L9QA 5LJMA 5A23A 4W9RA 5FZSA 3K3OA 3ZVVA 3MGBA 4QWNB 5TAOA 3UX4A 5HWXA 1UW4B 3KBUA 2V7MA 3QC1A 1V9DA 5LHGB 3TJPA 4DLOA 4PK5A 2CFZA 2H3RA 5JRCA 4MFRA 2KWHA 5LCWC 1FCHA 4FU3A 4L5GA 4ZOLE 4P0BA 4N5CA 5L2LA 2MRIA 4C9BB 4PAGA 3ZRHA 4GB9A 3GN5A 5FMNA 4GOUA 2EQXA 3FTUA 4WNKA 5FXWA 3ZCJA 4NACA 4MHCA 4KP3C 5G04J 3S7JA 2IOSA 3B7TA 4UV8B 4IIJE 3BEEA 3CQCB 3ZYKA 1NA3A 2CG3A 3ZJ1A 3KEZA 2HO1A 3CSTA 1XNFA 3LVQE 1ZU2A 1U4QA 3S4UA 3PNLB 4ANXA 4PJNA 3ETUA 3OBVE 3CKBA 5LCWJ 2D0UA 1H2VC 3JQ0A 1YA0A 2ES0A 2WMNA 1D1AA 2EHOD 1S35A 4JXTA 2XGMA 2DHRA 2WXGA 5HXEA 3U64A 5BUZA 3E4BA 3WXXA 3FXEB 2IQCA 2XEVA 4JEUA 3LKUA 4ZS2A 3VU7H 2X3MA 3UT5E 4RVBA 4LCTA 1X5BA 3DBSA 2VGXB 5FXVA 4IULA 3HKCE 1HFAA 4ANUA 3CX7B 3PUGA 5CB4E 4HXIA 3C51A 2LE8A 4EECA 1HCIA 2E9XA 2BVMA 2V26A 3TKLB 2Y6XA 4FJOA 2LSVA 2V7JA 4GZ5A 3UT8A 2XTLA 2KZ7B 4I1AA 2WXQA 2DLRA 3ZGQA 3G2SA 2QY7A 2XAGB 1KT0A 2I1JA 1H19A 2KNDA 3LY7A 2HH7A 3BQIA 4U0ZA 4U74A 5ARFA 1NA0A 1MMAA 3SWHA 5KJNA 2E8IA 5L3GB 3MKQB 3LK42 2X6IA 2AW6A 4CGWA 4C0EA 4H9RC 3PREA 4LERA 4BSXA 3PNTB 2Z6EA 3DP7A 4EAHA 5LHIB 1BR0A 4PDXA 2PG8A 3VHLA 2WXPA 3AAEB 3MV2B 3LJCA 2UY1B 2HPJA 3OYZA 4O4JE 5LHHB 5ETWA 2PJQA 4CZZB 5LP0A 5AJDA 4CI2B 2CXLA 3CSFA 3IF8B 3MJWA 3CVQA 4KVOA 3L3PA 3RO3A 4FI5A 2WSSV 3FTXA 2ZM0A 3IHRA 3OAWA 4HLEA 3CKDA 3CV0A 1W3BA 3JYSA 3SBTB 2XQYA 1UX4A 5H6RB 4U63A 3PUAA 4MLKA 1WY6A 4H63H 4JPSA 1HXIA 3RKOA 4HFGA 3BQLA 5AYWD 3FUMA 2C0LA 4B8AA 1Y64B 4GMJA 2FI7A 4CRWA 3FP3A 3FTWA 2Q9QB 2V7LA 3PZDA 4HTEA 3ZC0A 1A17A 4GAAA 4QXBB 4U07A 3D0TA 1JUQA 3DTOA 4PK4A 2X66A 1UJJA 2VKOA 3C4WA 2BVLA 3OKQA 3ZW3A 4XZ4A 2X51A 3MA9A 5BMVE 3I4RB 1DVPA 3AA1B 3T5VA 2WXKA 4ME2A 4J0UA 4AQGA 5JR9C 1NZNA 1SHZC 3S7DA 3RX6A 2X68A 1H0AA 2XCBA 3G2TA 1ZEEA 2IW5B 3KBTA 4WNDA 3MX3A 2JEKA 3FU3A 4F3VA 3T8OA 1HTJF 4HN9A 4MKTA 4HFVA 3FUHA 4IGUA 4CCAA 3B7RL 3HYMB 4KMCA 2DNXA 1D1CA 3EDVA 3OTNA 4QXCB 1PAQA 4ANJA 2V7IA 3B7SA 4ZS3A 2DBAA 1N52A 1G8XA 2YQ8A 1H6KA 1WM5A 1E8WA 2MOZA 5EK2A 1IJ6A 3U9WA 1QUUA 4GZDA 2WAUA 2M63A 5F3JA 4H63V 3O1HA 5M72A 3VLEA 1PC2A 4G24A 5LNKA 5HXHA 1FIOA 2CFUA 3QJZA 3JUIA 3APCA 5FY7A 4H9NC 3KAEA 5D0QD 5FWQA 1KNZA 4YLHA 3L08A 2XUEA 4UEMA 3RH3A 1JWGA 2KC7A 5JDLA 4EPZA 2W61A 4G2AA 1JWFA 3W15B 2PQRA 4BA9A 3FU0A 4APFA 2JLBA 3N9OA 4RG6A 3TG5A 4BTBA 5GONE 1KLXA 2NW8A 3QKYA 3SOLA 3UUXB 4UVCB 4YVOA 5BNWA 4I2WA 4TUUA 2LT3A 4EZHA 1HU3A 3KVAA 1HZ4A 3FUDA 2QA7A 1ELRA 4YVQC 2K5BB 3HI2A 3D9PA 3VLFA 4K0RA 3FTSA 4E85A 4U04A 3N9LA 3HDXA 4V3IA 4IE0A 2BUGA 4AY6A 2J9QA 1HH8A 4FLHA 4KZ0A 2LHNA 1WAO1 2Y4UA 3FUNA 1FEWA 2IOLA 3KS2A 2YU2A 1NAFA 3ZMUB 3RYIE 4DK5A 4D10C 3HIZA 3AA0B 2AXZA 3SFZA 4Y6CA 4TUYE 5FY1A 2CLYC 3FU6A 2JMKA 2VGXA 5T3RA 4HS2A 4FJZA 5LGNB 3ONXA 3T5XA 1OXZA 5DABA 5C8YE 3HVEB 5J2UE 4GA1A 3IHYA 3TGOA 2B1EA 2GRLA 3LDZA 1Y6IA 4KZCA 5L3FB 4FC8A 1EDUA 3AVSA 3T8MA 3RKVA 4AQFA 3Q49B 1E8ZA 1KT1A 5JQGE 3FTYA 5JHAA 3VTXA 3ZHEA 3NBXX 4UIGA 4ASKA 3ASHA 2E9XD 3U66A 3RK6A 4O6FA 1WYBA 3WI3A 4BT8A 5LJNA 3RYCE 3FHNA 3QK6A 4XKCA 2L8KA 1YKHB 5LFAA 4BX9A 3ZFWA 3MA5A 3NF1A 4JUYA 4ZI3D 1SZ9A 2DI4A 3KVBA 2D0TA 3QB2A 1BR1A 3R7QA 4CQIA 5A6CA 2K9AA 2UY1A 1UG3A 1ELKA 4WW0A 3KINB 4OYJA 2ILRA 4QHOA 1KK7A 4BTAA 4AV7A 2FBNA 3FEYA 2J08A 4GCNA 3JC6C 3N2OA 3FU5A 3E22E 3RO2A 2NTXA 3N5LA 3UTKA 4MALA 3RC8A 4Z8XA 4UVBB 3QWVA 5D0OD 5LBQB 1DNPA 5FQ8A 3TXMA 1FVFA 3CGHA 2N9DA 2VB6A 4XZCA 3FXDB 2IFUA 4E6HA 2NW9A 4WBNE 1TEZA 2CE7A 5CCMA 2KZTB 5JREA 1OWNA 4BX8A 3NZUA 2Q9QA 2E2EA 4I43B 4DI4A 5G04C 4U8HA 4GYYA 1EZ3A 4AXPA 3FEXA 3EDTB 3ZYLA 3FY4A 5KDMC 4A3VA 5LYJE 2YNQA 4EBAA 2HPLA 2CXDA 3D3MA 4KMOA 1MNEA 4GYOA 5JJ7A 4JL0A 2CG2A 4N39A 3I0QA 3K3QC 3LXUX 2RA1A 4NUUA 4I50E 5IYZE 2XRZA 4GZ6A 3Q4AB 4UWKA 3MKDA 4TX5A 4ZI3C 3CIAA 4N2QA 3CVUA 4PS8A 5AFUL 2X38A 3UULA 4UXNB 4K03A 3I1AA 3MK7C 3VKGA 2L3LA 2PQNA 1ELWA 1FVHA 2PZIA 3SRZA 2WWUA 2K24A 3L16A 4GIWA 2WXFA 3PDYA 4JEHB 1IHGA 2X6KA 4TV9E 1SA0E 5BT1A 3AAIA 2LJLA 2C5IT 2C5JA 2KATA 5A1LA 2XCCA 2IJGX 5M4YA 2KCKA 3FUKA 3UMVA 1UN9A 4XBFB 1X79A 1MIWA 3EDUA 4XAXB 1UJKA 2A2FX 2X9HA 2QFCA 3ENEA 3CX8B 4XI9A 2YU1A 2FULA 4IN3B 2D5UA 3LY8A 1IJ5A 2J07A 4O2AE 3CVVA 3S2AA 4DMWA 4I9EA 1E8XA 5FQ7A 5JH7E 4B89A 3HL6A 3JQ1A 1H2TC 3UUXA 1HF8A 4G11A 4L23A 3SF4A 4ILGA 4EXTA 3NQPA 4UQYA 5CHEE 3RPUA 3S7FA 4ILIA 2C0SA 4A3TA 4N3AA 2KINB 3V5SA 4I9CA 4ACKA 5EK3A 2FEZA 1T98A 1D1BA 2LAHA 3E08A 2P58C 1TJCA 4I1MA 4ANVA 5AENA 4I55E 5CCLA 3QWPA 3AA7B 4QXHB 2OVBA 4DO0A 2W63A 2A5UA 2A4ZA 4EZLA 2WXJA 4M1PA 3PU3A 3ZLIA 3ZXSA 3D9JA 5JR9B 2NTYA 2WXLA 4OHFA 2WVIA 4OFZA 3B57A 5FZQA 2NOXA 3H3AA 3UUNA 2AXVA 5ENNA 3CQGB 3LK3B 4C91A 2WQHA 4IDZA 3ONLA 4EZJA 3MV3B 4EB6E 4ISSA 3EHNA 3L54A 2AXUA 2IF4A 5FY0A 5L3CB 4ABNA 5JDQA 3P7IA 4EYYR 3BK9A 4IE6A 3CHPA 2PBIA 3DPDA 1U5PA 5CA1E 2KWIB 3PUSA 5KJLA 2YHCA 4FHKA 3N71A 5DIZA 2VKHA 2V5FA 4X1IE 3APFA 3GA8A 2KCVA 2H7OA 3N9NA 3FBLA 2OOEA 2RP4A 2LHRA 5FNVE 3ML8A 1D0YA 3PEVB 3URZA 2MHKA 2VJ8A 4DMVA 2C5KT 4MBQA 4LUNU 4B94A 3C50A 5EZYE 3KFWX 5JDMA 3CHRA 3I9WA 2VYIA 2J4DA 2EHOC 1QZ2A 5LGTB 2V8SE 4KVMA 4WUYA 3CVRA 3P1UA 4PS7A 4GK5E 1Z3YA 4L2LA 5FYMA 2V0PA 2L6JA 3MACA 5ADXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LF8 A;  4GZC A;  1HF8 A;  1JUQ A;  1SZA A;  3D9O A;  3G2S A;  4NAC A;  2L0T B;  2QY7 A;  4JXT A;  1HFA A;  2DCP A;  4AVX A;  2LO6 A;  1H0A A;  1UJJ A;  3D9L A;  1UJK A;  1SZ9 A;  3G2U A;  1VDY A;  1HG2 A;  3G2T A;  1HG5 A;  1PY1 A;  3ONL A;  1JWG A;  2KM4 A;  4GZD A;  4Q96 A;  3RRU A;  3D9N A;  3ZYL A;  1XGW A;  2MOW A;  3ZYQ A;  1EYH A;  2V8S E;  1JWF A;  2L0I A;  3D9K A;  3D9J A;  3D9P A;  3ZYK A;  4FU3 A;  2DIW A;  3LDZ A;  4HFG A;  3G2W A;  3D9I A;  5J08 A;  5CMW A;  1JPL A;  1HX8 A;  1DVP A;  3D9M A;  1EDU A;  4Q94 A;  1ELK A;  1MHQ A;  3ZYM A;  3G2V A;  5LOZ A;  4FLB A;  2BF0 X;  5CMY A;  1INZ A;  3CLJ A;  1X5B A;  3ONK A;  5LP0 A; 
#chains in the Genus database with same CATH topology
 3KEA A;  1FMV A;  1J5E T;  2XAF B;  2BKP A;  3U78 A;  4I6J A;  2LUH A;  3NRX A;  3LJN A;  5G55 A;  2LRL A;  1PY1 A;  2UXN B;  2YDR A;  4HEA A;  4M3O A;  5D66 A;  3AU4 A;  4KI0 F;  1AP7 A;  2P9U G;  2XAS B;  2YOE A;  3SS1 A;  1MZC A;  3MEK A;  3SBS A;  3ZMT B;  2ZXW E;  4EED A;  2CEA A;  4DR7 T;  1OCC E;  1QSD A;  3RQW A;  5CFB A;  4DV0 T;  4DVD A;  2XHE A;  5FXZ A;  1QQE A;  2Y4T A;  5HYA A;  3LPZ A;  4CI3 B;  3NKZ A;  3LBX B;  4M7C A;  4YSX A;  3SZ7 A;  3PUK A;  5KJK A;  3P4S A;  2YDQ A;  4ZI7 E;  3QNK A;  3LJ3 A;  3D9O A;  4U0S A;  4HOQ A;  3TWR A;  5CBN A;  2K48 A;  2V5Q C;  3L22 A;  3Q9D A;  2LM9 A;  3ZMZ B;  4X64 T;  1N4S A;  3PV0 F;  3SFX A;  3UXG A;  1U2V G;  2UWJ G;  5AAR A;  1HS7 A;  4NUR A;  4HWF A;  2CLY B;  4I2Z A;  2KZT A;  4B3R T;  2IIU A;  2VTB B;  4TV8 E;  2XEH A;  4ZI2 D;  5HI7 A;  5JVD E;  4FP7 A;  4IE4 A;  5CEA A;  1E8Y A;  5LX8 A;  5ITZ F;  2VK9 A;  4IDP A;  1OWA A;  2PM7 A;  2XM2 A;  2JMH A;  2DCP A;  2JPF A;  3KD7 A;  2JQ9 A;  5JJ6 A;  1IAP A;  3NAW A;  1NFI E;  2F8Y A;  2VSO E;  3UM3 A;  2GW1 A;  4JVS A;  4ILC A;  3NZQ A;  4F53 A;  3OXG A;  3EVY A;  4L0R A;  3ANW B;  1ZBP A;  3FUJ A;  2Q9Q D;  3ZYM A;  4ILH B;  1TN8 A;  4DX5 D;  2CCQ A;  2YHE A;  5KBA A;  3Q5X A;  2QC9 A;  1N94 A;  3FZM B;  3PUZ F;  5A7D B;  5AIJ A;  3AA6 B;  2X6F A;  4H9P C;  1H7C A;  2LKG A;  4KHP T;  1ZKE A;  2L6B A;  4BAY B;  5JRC B;  1OWM A;  4X8Q A;  1JNZ A;  3J9X 1;  3GZ2 A;  4EIW A;  4OYS A;  2WWV A;  4I17 A;  5C2Y A;  2ZM2 A;  2LOS A;  5LCY A;  3PE4 A;  4P29 A;  5HEO A;  3Q5M A;  2C0M A;  4Y6W A;  3RIA A;  4OK0 A;  3FTV A;  3WAK A;  2XEN A;  3H37 A;  3AE3 A;  4O4H E;  3PJA J;  2QZA A;  4NXM T;  5L4E A;  3EJN A;  1SQM A;  4IST A;  3UQ3 A;  3SD5 A;  3QOU A;  4H9Q C;  4JI7 T;  3MXZ A;  4U33 A;  5C1D A;  4F1S A;  2ODU A;  5AQ9 A;  3ZMS B;  4JEH A;  4K5B A;  2BBJ A;  4YHJ A;  5HWY A;  1MMG A;  5CER B;  2V7K A;  1MIY A;  2UUA T;  4ZFH A;  5J90 A;  3RIU A;  5HEJ A;  2WQ7 A;  3OJA A;  3LG7 A;  4PFP A;  1HS6 A;  2AWI A;  2J4G A;  2WM9 A;  2VSX E;  4CDN A;  1NEK A;  4I6G A;  2V5C A;  4ZEY A;  1S64 A;  3VKH A;  2WDR A;  2H88 A;  4N78 D;  1Z5S C;  4AIS A;  2J09 A;  1HG2 A;  2W00 A;  2J49 A;  3KSL A;  3TWU A;  4X66 T;  2K3W A;  3SHF A;  3DSU A;  2BZB A;  2HM8 A;  4DV3 T;  3DSS A;  4HVB A;  2XGO A;  5KXJ A;  3SNX A;  1US7 B;  4NRH B;  1CUN A;  5CMW A;  2WXH A;  2XM1 A;  2NXP A;  4UI9 J;  3ULQ A;  3PS6 A;  3F6Q A;  1E90 A;  1BD8 A;  4EZK A;  3UU6 A;  3A5X A;  1OWO A;  3I9Y A;  3IV0 A;  3MYV A;  4ILA A;  1HO8 A;  2XRY A;  2M6B A;  4R7L A;  1V54 E;  1O3X A;  2ACZ A;  3EHM A;  5CJ5 A;  5JDN A;  2I1K A;  3U3W A;  4KUM B;  4U95 D;  4JEU B;  4TWD A;  4OVU A;  1OED B;  1R8I A;  4CGV A;  4HOR A;  5KMG P;  2JQH A;  3CEQ A;  4UWF A;  4ADZ A;  4GTO A;  3C64 A;  4AEZ C;  3R9A B;  1SZA A;  3H3M A;  3AS8 A;  4QH5 A;  2KMF A;  2AJA A;  5CA0 E;  4CEM A;  4U3C A;  4YND A;  3ML9 A;  4B8C B;  2BKO A;  2NW7 A;  1E7P A;  3LCA A;  3PH0 C;  4DV6 T;  1E7V A;  4PS3 A;  1HE8 A;  4AI6 A;  3AE7 A;  3RIF A;  5EX3 A;  3PUQ A;  2J62 A;  4EQF A;  4CXW A;  1N95 A;  1IKN D;  3I4G A;  3J7Y q;  4JI6 T;  5JR9 A;  1IZN B;  2KBX A;  2JQK A;  1G73 A;  4C90 A;  3WG7 E;  2H6G A;  4GCO A;  3CHM A;  4HOU A;  4XE0 A;  3IBP A;  4G26 A;  2CM0 A;  2UU9 T;  4HE8 A;  5ABG A;  4GZC A;  1HNZ T;  2GRO B;  2DWG A;  4HKA A;  5EKQ D;  1XDO A;  4LG6 A;  1S94 A;  3AEE A;  2WMO A;  3QWW A;  4ACL A;  2BDE A;  4JA9 A;  1WR6 A;  4ANW A;  2DL1 A;  3D9K A;  1T72 A;  4E7S A;  3AAA B;  1L5J A;  1FPP A;  4NIK A;  5T4Y A;  4FHJ A;  3PRZ A;  4J8F A;  2WXN A;  3MKQ A;  4TNW A;  4IHJ E;  4G2V A;  4HFD A;  2R5S A;  1O5M A;  4CXY A;  3P4R A;  3VLD A;  3M65 A;  4WZX A;  2MPK A;  2FO1 E;  1U3C A;  2AVP A;  3ESK A;  3RC3 A;  1Y01 A;  2VKD A;  5DQV A;  5FZR A;  5F8P A;  3L6A A;  2KT9 A;  4ATG A;  4DUI A;  4MLP A;  1SUM B;  2VVN A;  5ABF B;  5JJT A;  1EYH A;  3GZ1 A;  3MCX A;  2XPI A;  3C72 A;  2BG9 E;  4P09 A;  1U3D A;  2IC9 A;  1BR2 A;  4U8V D;  1T8B A;  4WWP A;  4X5T A;  4I0U A;  2D2S A;  4APO A;  3ASG A;  1ZHC A;  4AIF A;  4F1P A;  4EV6 A;  2HR2 A;  2ETC A;  1Z0P A;  3O4Z A;  5G05 J;  1N34 T;  4DV7 T;  5KX5 E;  1X9B A;  2H6F A;  3O4X E;  2E0I A;  4HOT A;  4TZ4 C;  2Y1L E;  1YMP A;  2IY0 C;  3JAE A;  3E0Z A;  3KV6 A;  4PH4 B;  3QAQ A;  1N4R A;  3PU8 A;  4J8S A;  3ZCI A;  3NWI A;  3FUL A;  1LTX A;  4PJL A;  2RKK A;  4GA2 A;  4GK0 E;  4TN7 B;  1Y8M A;  2VSN A;  4A1G A;  2GRQ B;  5JDG A;  3ZNG A;  3ZC1 A;  3QK0 A;  2R59 A;  3L39 A;  3CHO A;  3O1I A;  5AQM B;  3C4X A;  2E5V A;  3AE2 A;  2XQA A;  3DXM G;  2UXC T;  3AEF A;  4XIF A;  2XQ8 A;  4AKH A;  1Z6T A;  3AS4 A;  5CRV A;  4ZZB A;  3HRA A;  1MX6 A;  4PK6 A;  4U2Y A;  3N9P A;  3HR0 A;  1E96 B;  1E7U A;  5LG3 A;  1OCR E;  4WBO A;  5LP6 E;  2V4L A;  2XPZ A;  2DYS E;  3AB3 B;  1W0A A;  3S7B A;  1D0X A;  4PW8 A;  2IAK A;  3LEW A;  4A98 A;  2CHN A;  3NBN B;  1UGO A;  3AE1 A;  2KXP B;  3OYX A;  4AVX A;  3EHZ A;  2B0O E;  5HXS A;  4J2C A;  3CVX A;  1B89 A;  5B1B E;  3GMI A;  2B76 A;  2PTF A;  4JI2 T;  3EAM A;  3UFE A;  3J5Q B;  2L0I A;  4A55 A;  2A9U A;  3EHR A;  1BU9 A;  4UF0 B;  1AJ3 A;  3K9I A;  4DBR A;  3KV9 A;  3CVY A;  2XAJ B;  4JBW F;  5LOZ A;  2E9X C;  3ZIM A;  5IWA T;  1YKE B;  2LO6 A;  3QDN A;  1WLX A;  4GZ3 A;  4KXK B;  3ESL A;  2LEH A;  4JHK A;  3FUF A;  5EN5 D;  2QGS A;  1VDY A;  1H6P A;  4EBA G;  5AQO B;  3ZEF B;  3GWH A;  2PFV A;  3D9N A;  3TL5 A;  4DPR A;  3ZMV B;  4EYU A;  5JHB A;  4PJM A;  2CWO A;  2XAQ B;  4UQX A;  3TWQ A;  3ONL C;  3C3R A;  3N2G E;  3HKD E;  3TLT A;  3ZN1 B;  4BJM A;  1IBK T;  4WNG A;  3P4W A;  2JQQ A;  3ANW A;  3WAJ A;  4KYO B;  5CMY A;  4G63 A;  4J8D A;  3ABK E;  3LFM A;  1E1H B;  2KSR A;  3JXJ A;  3W9F A;  2AXD S;  4G8L A;  1MMD A;  2XGS A;  4TRQ A;  4BT9 A;  2IC6 A;  4L2Y A;  3UPV A;  1TR4 A;  1MMN A;  2CBJ A;  5J1G A;  1YW0 A;  3ASN E;  5AQJ B;  3RSE G;  1FMW A;  1Z3X A;  5AQQ B;  3GW4 A;  4NUV A;  3BQK A;  3UUB A;  2UXX B;  1KF6 A;  1MHQ A;  4P0A A;  4L9I A;  2Y3A A;  2LRK A;  4FLB A;  3IA3 A;  5EX0 A;  2EHO B;  1X81 A;  2W0G A;  3ZPJ A;  3C98 B;  3HKE E;  2RFM A;  5HXR A;  4Q69 A;  2ION A;  3HXF A;  3D9H A;  5AJL A;  4A1S A;  2CHX A;  1QBQ A;  2GGF A;  5LOV E;  3UU8 A;  3O1J A;  2WXR A;  3DPY A;  4IE7 A;  5KNH D;  3ASF A;  3CX6 B;  5BXO A;  3L17 A;  3TLU A;  3TXN A;  3L13 A;  2LSJ A;  4LF8 T;  3AEB A;  3UU4 A;  3HG0 D;  3KV5 A;  2W62 A;  3QB5 A;  3B7U X;  5HQ8 A;  5CBO A;  3F57 A;  1UCU A;  5HXC A;  4U7I A;  4XKB A;  4BWR A;  5F5W A;  3V2X A;  5JTG A;  2VL8 A;  3FUE A;  4O4I E;  4IDN A;  4KBQ A;  3ZT5 A;  2P9B A;  2KLQ A;  4N5Q A;  4JHR A;  3R7R A;  3N2K E;  1WYC A;  1G3N B;  3CVW A;  4HI8 A;  4JD2 G;  1S63 A;  3IBE A;  4NQ0 A;  3QOF A;  5LG4 A;  3CVP A;  4N3C A;  3FB2 A;  1UX5 A;  2XS1 A;  1LKX A;  2ZM8 A;  4JC8 A;  3ONJ A;  2BF0 X;  2FO7 A;  5HCJ A;  5AQB A;  4BET A;  5LBM A;  3PTR B;  4YT0 A;  1P5Q A;  4CDM A;  2R6G F;  3MZL B;  4HOS A;  2FF4 A;  1LVK A;  3UKU G;  1J5W A;  3G2U A;  4X1Y E;  3FUI A;  3UT7 A;  2BBH A;  2DZN A;  2KXP C;  4K0U A;  1J1J A;  2MAW A;  4JZY A;  1NEN A;  1JCS A;  1IXV A;  3ABM E;  3ZSS A;  2IEJ A;  4MS6 A;  4AKI A;  4UQZ A;  5HEU A;  3R6N A;  4A56 A;  2GK9 A;  4PFO A;  2LM2 A;  2Y48 B;  3LK2 B;  5KJM A;  1OED A;  3LS8 A;  2ZMA A;  2MTQ A;  2CA5 A;  2OA5 A;  2LSI A;  4AP2 A;  3PVL A;  1BLX B;  1XMQ T;  3I5P A;  5DJQ C;  4C0M A;  3FH8 A;  4U72 A;  2ZLY A;  2MBG A;  4G25 A;  2UXB T;  4BFR A;  1VCS A;  3ASD A;  3GZS A;  2MOW A;  1UN8 A;  2A5E A;  3HVE A;  4UWL A;  2BKG A;  3L09 A;  2JRK A;  4YTP A;  4JB8 P;  5L3B B;  4CZ2 D;  4Q94 A;  2AE9 A;  4YY3 T;  2A72 A;  1JNR A;  5EDS A;  3TG4 A;  3LY9 A;  3Q75 A;  3TLV A;  2ZIR A;  4FA6 A;  4L1B A;  2ZIS A;  2E5L T;  2ZU6 B;  3U4T A;  2FJE A;  5IHY A;  4GYS A;  3ZHE B;  1XZY A;  2WXI A;  3CPZ A;  2KM4 A;  4DR2 T;  3V5U A;  2H7V C;  2J4B A;  1B7T A;  4O4L E;  1N0R A;  5ENR D;  2LSY A;  5FXX A;  2Q7F A;  5FIN A;  4H9S E;  1AWC B;  4NXN T;  3VRB A;  2YIN A;  3ULE G;  3FZL B;  3Q9U C;  4JLE A;  3RF1 A;  3NRY A;  5FP3 A;  3CQX C;  4E7Z A;  3CK7 A;  4TXR A;  2OND A;  2XS8 A;  2BED A;  4JV5 T;  3RI5 A;  3NZP A;  1ZV4 X;  4NIQ A;  5EK4 A;  1N54 A;  5ABF A;  3ZT7 A;  5JA4 D;  3FDH A;  3APD A;  2L9B A;  3BG0 B;  1GQE A;  3Q47 B;  2BKN A;  2PNN A;  2HE0 A;  3AS5 A;  5ANL A;  4OVV A;  2J1D G;  3RGL A;  3RIU C;  2QYW A;  3ZN0 B;  5FTP A;  2RG8 A;  4U96 D;  4AOF A;  3LVR E;  3OXF A;  3ETV A;  3HKB E;  3N9Q A;  3SI5 A;  5G2N A;  4IRU A;  3DEP A;  3FWV A;  2XAH B;  3B7B A;  4CN4 A;  3RRM B;  5ENQ D;  5AQ7 A;  1EPU A;  2ODV A;  2C2L A;  5BV1 A;  4RQI A;  3CK8 A;  2MYS A;  2NC9 A;  1DCQ A;  3D9M A;  5LGU B;  5HAX A;  3C4Z A;  3AE9 A;  1YXR A;  3U3I A;  3L82 A;  4WWN A;  2FBW A;  4CXX A;  4EZ4 A;  3CVL A;  3CR3 A;  3IEE A;  3IKO B;  1VCT A;  3T1Y T;  2ACX A;  4XI0 A;  4WNF A;  2OEW A;  1SA5 A;  4O8S A;  2X0L B;  3KSQ A;  4YJ3 E;  4BY6 A;  2LSG A;  4JI1 T;  1BPO A;  3RJV A;  3N9M A;  1S0P A;  5FQ4 A;  3D9I A;  1JPL A;  3R9M A;  3EIJ A;  1XNR T;  2GRM A;  4UWH A;  3VTY A;  3O9X A;  5FKY A;  1YD8 G;  4B6X A;  3FH7 A;  2X9W A;  4RSY A;  1TNB A;  1LVF A;  5T8I A;  5DQW A;  2YK0 A;  4I43 A;  4WAF A;  5HEH A;  5AQT B;  4IYP A;  3PE3 A;  3Q15 A;  3KV4 A;  2WBL A;  3P8C D;  4GTM A;  4H9O C;  4LF6 T;  3RRU A;  4GA0 A;  2X9X A;  5ENT D;  4QX7 B;  3ZN3 A;  3G06 A;  2WXM A;  4FAD A;  2NYJ A;  3UM1 A;  1H2U A;  1N36 T;  3QC9 A;  3EI0 A;  2V6X A;  4UF0 A;  2WXO A;  5FVL A;  3KDS E;  3AE4 A;  4HGA A;  1MND A;  2WDQ A;  1K1B A;  2LSU A;  2KCL A;  4DJA A;  2J8S D;  3ZPO A;  1VRB A;  1UK5 A;  2X6H A;  4F6R C;  1LF8 A;  4MRU A;  2R17 C;  1OWP A;  4JI4 T;  4CN6 A;  5B1A E;  4DX1 A;  2PM6 A;  4AQF C;  4Q96 A;  3ZEF A;  3OTO T;  4JHJ A;  3ZYQ A;  4ILU A;  4ZHQ E;  5DBK A;  4LFC T;  4UI9 K;  4AXH A;  2X67 A;  5JDF A;  4LF4 T;  4UI9 C;  2CXF A;  2OLT A;  4AY5 A;  5LXT E;  2ZM6 T;  4UEL A;  3RYF E;  4IE5 A;  2HYZ A;  3G2V A;  4G23 A;  2PL2 A;  3T1H T;  3GN5 B;  5E0O A;  4RG9 A;  4LMK A;  2M67 A;  3UUM A;  2OVF A;  5E75 A;  2I9C A;  2WB2 A;  5FJY A;  3CWZ B;  2V1D B;  1NWM X;  2JJ9 A;  4PJJ A;  5L3E B;  1XGW A;  1LRZ A;  4N3B A;  1XNQ T;  3Q5W A;  4URK A;  4AIU A;  4ERR A;  1GW6 A;  2DIW A;  3EAB A;  1HX8 A;  2X6J A;  3BQO A;  2VSY A;  2LLY A;  3CKC A;  4AJW A;  3PUV F;  3TLW A;  2EHO A;  1W9R A;  2WY2 A;  3Q5E A;  4Z91 A;  3MJX A;  3C98 A;  4U0U A;  4UWG A;  1CHU A;  2P9P G;  3V31 A;  3R84 B;  2LAI A;  2Y8D A;  5CEC B;  3SGH A;  1IQU A;  3UM0 A;  3K8P C;  4QKN A;  2LXL A;  2ZGG A;  2VGE A;  3QAR A;  3NOG D;  5EIL A;  3SQV A;  1XMO T;  4L7T A;  4DX6 D;  4AKG A;  2XQ4 A;  3PEU B;  4G1T A;  2VQ2 A;  3UQ7 A;  4PNI A;  5JDH A;  4WWO A;  4GYW A;  1TNY A;  3OXL A;  4UVA B;  4ZI2 C;  1UOH A;  3QUJ A;  1A5E A;  3FTZ A;  4H7X A;  3D9L A;  4J7W A;  4COF A;  4IDQ A;  5LA6 E;  2RD0 A;  4GPK A;  4YJ2 E;  2I59 A;  3P2B A;  4OAU C;  3JCK C;  1ZP0 A;  3LYA A;  3GYZ A;  4V1A v;  1KFY A;  4GML A;  4TV3 A;  4QX8 B;  3PE0 A;  4JW1 A;  2X0H A;  1EF1 C;  4GKK T;  3SY2 A;  4B0Z A;  1OWL A;  3BG1 B;  4HFB A;  3AG2 E;  3E37 A;  3RYH E;  3EIQ C;  2G0U A;  4U2Z A;  3JC6 D;  3MKR A;  3EUH A;  4CI1 B;  2ETB A;  2SPC A;  2EIK E;  3B95 A;  1QNF A;  2Q9Q C;  3PZ1 A;  4XX5 A;  3V2O A;  4P1N A;  3ZXP A;  5BXU A;  4CT0 A;  1N9A A;  4BJN A;  2CHZ A;  2E9X B;  1MIV A;  3Q2M A;  3RRW A;  1D0Z A;  3PDN A;  4CT4 A;  2VAS A;  4J8E A;  4YDE A;  2VGY A;  5G05 C;  3A8Y C;  1ZOY A;  2NSZ A;  5AQG B;  2IO3 C;  3NZS A;  2N1G A;  1K8K G;  3FHE A;  4CYM D;  4YHH T;  5KCM A;  2CHW A;  4KT6 B;  3ZUV B;  4OYK A;  5ENP D;  5BV0 A;  3TAX A;  1IQR A;  2YEV C;  3FFL A;  4AM9 A;  1VOM A;  4KBM B;  4IL4 A;  2XQ0 A;  1TYQ G;  4JA7 A;  3J5P A;  2LSK A;  3PUJ A;  3CML A;  2XQ3 A;  1WDY A;  4H7Y A;  4TXQ A;  3EUV A;  1OXJ A;  4GTV A;  2DWK A;  4YFS A;  3DWL G;  2ZGD A;  2WQ6 A;  1FT2 A;  2W66 A;  3TWV A;  3HHM A;  3UTM A;  3RU0 A;  4CDR A;  2VVS A;  4O2B E;  3CVN A;  3UT4 A;  1IYG A;  2A3D A;  3IHV A;  3FH5 A;  1O1T A;  4I6E A;  5FT9 A;  3CK9 A;  1OED E;  3CHQ A;  2WPV A;  4EHM A;  3LSV A;  2XPY A;  4X20 E;  4LSZ E;  4EOZ B;  4U7Y A;  3UKR G;  1S70 B;  4KHZ F;  2WDV A;  1OUV A;  3ZJ2 A;  2P9I G;  2XQ7 A;  1IBM T;  4ATZ D;  1WRD A;  3V79 K;  2I2O A;  1MQS A;  2NP9 A;  3DJB A;  3TLS A;  3SFD A;  4QFV A;  5E76 A;  2OV8 A;  4LEU A;  2UUC T;  3HA4 A;  1HG5 A;  2N2N A;  3CHS A;  2XZE A;  3T8K A;  5LMU T;  1WR0 A;  5ANR A;  5BW8 C;  4N2S A;  3O48 A;  2F4V T;  5J2T E;  3G2W A;  2LOP A;  3PUX F;  4PUC A;  4U31 A;  1N11 A;  4DBQ A;  2IO2 C;  2DCF A;  5CRU A;  4HRL A;  1INZ A;  5L3D B;  3ZKR A;  4AKR B;  5C3J A;  4DLQ A;  3Q73 A;  3QB5 K;  2VWA A;  4JYA T;  4F7A A;  4X1K E;  3F2E A;  3F31 A;  2XQ9 A;  3I3N A;  2I6H A;  3T9K A;  3DSX A;  3PUR A;  4LFA T;  3AED A;  3AEC A;  2XHE B;  3B13 A;  3I0O A;  4DND A;  4UV9 B;  4GU5 A;  2DWZ A;  3TWW A;  2XZD G;  4GYR A;  4HB5 A;  4FUL A;  2CMR A;  3UQ4 A;  3LBX A;  4FJY A;  3RRC A;  3FZF B;  4I1O B;  5H6Q B;  3AVR A;  2CWY A;  5LMN T;  1NP7 A;  3AU5 A;  2DVW A;  3IEG A;  2BKK B;  2VKJ A;  2NWB A;  5BPP A;  5CED B;  2IU1 A;  3RRN B;  2X9Y A;  4WNE A;  1MX2 A;  3FBZ A;  1TJF A;  2LNI A;  4DI3 A;  2R03 A;  5J08 A;  2VTB A;  4LRZ A;  5H7P A;  1BR4 A;  2BS2 A;  4WYV A;  3RLF F;  2H89 A;  4UR9 A;  4J6I A;  5FQ6 A;  4AKL A;  4HFE A;  4I4T E;  3CLJ A;  2NR4 A;  3ONK A;  3K3N A;  2L0T B;  3MZK B;  2BG9 C;  2R02 A;  5ARG A;  3RIB A;  2BTD A;  2L9Q A;  5AAO A;  5LJM A;  5A23 A;  3ULY A;  2RFA A;  3P50 A;  4A97 A;  4W9R A;  5FZS A;  3K3O A;  3ZVV A;  3MGB A;  4QWN B;  5TAO A;  3UX4 A;  4EEB A;  5EYL A;  5HWX A;  4A63 B;  1UW4 B;  3KBU A;  1M62 A;  2V7M A;  3QC1 A;  1UUR A;  1Q2Z A;  4Z90 A;  1T7S A;  4MBG A;  1V9D A;  5LHG B;  3TJP A;  3LDQ B;  4DLO A;  4PK5 A;  2CFZ A;  2H3R A;  5JRC A;  4MFR A;  2KWH A;  5LCW C;  4XEI G;  1FCH A;  4K5C A;  2P9K G;  4FU3 A;  4L5G A;  3PUY F;  4ZOL E;  4P0B A;  4N5C A;  5L2L A;  4GMR A;  4U7E B;  2MRI A;  2QYU A;  4C9B B;  4PAG A;  3ZRH A;  4GB9 A;  3GN5 A;  5FMN A;  4GOU A;  4DR1 T;  2EQX A;  2V4H C;  5ABH A;  3C3Q A;  3FTU A;  4WNK A;  5FXW A;  3ZCJ A;  4NAC A;  1N0Q A;  4MHC A;  2ETA A;  4KP3 C;  5G04 J;  3S7J A;  2IOS A;  5BR8 T;  3B7T A;  5AN8 A;  2WS3 A;  4UV8 B;  4IIJ E;  3BEE A;  4GTR A;  3CQC B;  3ZYK A;  1NA3 A;  2CG3 A;  3ZJ1 A;  1O1S A;  3KEZ A;  3VRA A;  2HO1 A;  5EYP F;  3CST A;  4DR4 T;  1XNF A;  3X1D A;  3LVQ E;  1ZU2 A;  2VL0 A;  1U4Q A;  3TWX A;  3S4U A;  3PNL B;  4ANX A;  4PJN A;  3ETU A;  4YTN A;  3OBV E;  3C3O A;  4ILB A;  3CKB A;  3AE6 A;  4RLY A;  4B3T T;  5LCW J;  2D0U A;  4LF5 T;  1H2V C;  3Q7A A;  3JQ0 A;  1YA0 A;  2RPA A;  2ES0 A;  1HNX T;  2UUB T;  2WMN A;  1D1A A;  2EHO D;  4K5A B;  1S35 A;  2EIN E;  3AE5 A;  2H6I A;  1SVX A;  4JXT A;  2XGM A;  4LFB T;  2DHR A;  2WXG A;  2F8X K;  3E30 A;  5HXE A;  3U64 A;  5BUZ A;  1LD8 A;  3E4B A;  3FXE B;  3WXX A;  2IQC A;  2DYR E;  1K1A A;  2XEV A;  4JEU A;  3LKU A;  4B3S T;  1N4P A;  4ZS2 A;  3VU7 H;  2X3M A;  3UT5 E;  4RVB A;  4LCT A;  1X5B A;  4DR6 T;  3DBS A;  2VGX B;  5FXV A;  4IUL A;  3HKC E;  4CN1 A;  2OCC E;  1HFA A;  2OV9 A;  1BI8 B;  3CX7 B;  3PUG A;  3HXD A;  2YN6 A;  4ANU A;  5CB4 E;  4HXI A;  3C51 A;  2LE8 A;  1DCE A;  1DC2 A;  4EEC A;  3RHW A;  1HCI A;  2E9X A;  3DRA A;  2BVM A;  2V26 A;  3DEO A;  3TKL B;  2DZO A;  2Y6X A;  4FJO A;  2LSV A;  2V7J A;  2EIJ E;  4GZ5 A;  5AQS B;  3UT8 A;  2XTL A;  2KZ7 B;  4I1A A;  4DV1 T;  3M3Z B;  2DLR A;  2WXQ A;  3ZGQ A;  3G2S A;  2QY7 A;  2XAG B;  1KT0 A;  2I1J A;  1H19 A;  2KND A;  3LY7 A;  1HX1 B;  2HH7 A;  2BS4 A;  3BQI A;  4U0Z A;  4X62 T;  4U74 A;  5ARF A;  5EID A;  1NA0 A;  5B3S E;  1MMA A;  3SWH A;  5KJN A;  2GRP B;  2E8I A;  3E32 A;  2WP9 A;  4YDO A;  5L3G B;  3MKQ B;  3LK4 2;  2X6I A;  4YTM A;  2AW6 A;  4CGW A;  4C0E A;  4H9R C;  3PRE A;  4GTP A;  4LER A;  4BSX A;  3PNT B;  2Z6E A;  3DP7 A;  4EAH A;  5LHI B;  1BR0 A;  4PDX A;  4HRN A;  2PG8 A;  3VHL A;  2WXP A;  2XJ7 A;  3AAE B;  3MV2 B;  3LJC A;  3DXK G;  2UY1 B;  2HPJ A;  2V5D A;  3OYZ A;  2Y0B G;  4O4J E;  5LHH B;  3B5M A;  5ETW A;  3DSV A;  2PJQ A;  2VUR A;  2GRR B;  4HI9 A;  4CZZ B;  2BS3 A;  2FJA A;  1KPS B;  5LP0 A;  5AQV B;  1FJG T;  2CHO A;  5AJD A;  4CI2 B;  2CXL A;  1OCZ E;  4GTS A;  3CSF A;  3IF8 B;  1N33 T;  3MJW A;  3CVQ A;  4YSY A;  4KVO A;  3L3P A;  3RO3 A;  3AG3 E;  1OT8 A;  4FI5 A;  3HXC A;  2QRX A;  3OPC A;  3UIN C;  2WSS V;  1D8D A;  3FTX A;  2ZM0 A;  3IHR A;  3OAW A;  3X2Q E;  4HLE A;  3CKD A;  3K1S A;  3CV0 A;  1SW6 A;  1W3B A;  3JYS A;  1UUS A;  3SBT B;  2XQY A;  1JCQ A;  1UX4 A;  5H6R B;  4U63 A;  2YKS A;  3PUA A;  4MLK A;  1WY6 A;  4TUM A;  1HNW T;  4KX6 A;  4H63 H;  4JPS A;  1HXI A;  3RKO A;  4HFG A;  3BQL A;  5AYW D;  3FUM A;  2C0L A;  4B8A A;  1Y64 B;  3AEA A;  4GMJ A;  2FI7 A;  4CRW A;  3FP3 A;  3FTW A;  2Q9Q B;  2V7L A;  3SFE A;  4HTE A;  4Q25 A;  3ZC0 A;  1A17 A;  4QXB B;  3PZD A;  4GAA A;  4U07 A;  3D0T A;  4YDW A;  1JUQ A;  3DTO A;  4PK4 A;  2W4X A;  2X66 A;  3L8R A;  4L9P A;  2LKH A;  1UJJ A;  1JCR A;  4F8H A;  2VKO A;  3C4W A;  2CBI A;  2BVL A;  3OKQ A;  3ZW3 A;  1YYH A;  2FUP A;  4DR5 T;  4XZ4 A;  2X51 A;  3MA9 A;  5BMV E;  3E33 A;  2JAB A;  3I4R B;  1DVP A;  3AA1 B;  1W09 A;  3UI2 A;  3T5V A;  2WXK A;  4ME2 A;  4J0U A;  4AQG A;  5JR9 C;  1NZN A;  2E2A A;  1SHZ C;  4YXD A;  4G8K A;  3RX6 A;  2X68 A;  3S7D A;  3SFY A;  4OAV B;  1D9S A;  3SO8 A;  1H0A A;  2XCB A;  3G2T A;  1ZEE A;  2IW5 B;  3KBT A;  4WND A;  3MX3 A;  2WZI A;  5CGM A;  2JEK A;  4ZXL A;  3FU3 A;  5C2T A;  3HXB A;  4F3V A;  3T8O A;  3BU8 A;  4O1P A;  5L4H A;  1HTJ F;  2CPT A;  4O60 A;  4HN9 A;  4MKT A;  4HFV A;  3FUH A;  4IGU A;  2R2L A;  4CCA A;  3B7R L;  3HYM B;  4KMC A;  2DNX A;  1D1C A;  3EDV A;  3OTN A;  4QXC B;  4LF7 T;  4AQY T;  1PAQ A;  4ANJ A;  2V7I A;  3B7S A;  5AQU B;  4ZS3 A;  2DBA A;  1N52 A;  1G8X A;  1SE7 A;  2WU2 A;  1H6K A;  1WM5 A;  2YQ8 A;  1E8W A;  2IUB A;  4DID B;  2MOZ A;  5EK2 A;  1IJ6 A;  3U9W A;  1QUU A;  4GZD A;  4IRE A;  4Z68 A;  2WAU A;  2M63 A;  4ZHB A;  5F3J A;  4H63 V;  4HFH A;  3O1H A;  2IDO B;  5M72 A;  3VLE A;  2P9S G;  5AQP B;  4O1O A;  3VR9 A;  1WCR A;  1PC2 A;  4G24 A;  5LNK A;  5HXH A;  1FIO A;  2CFU A;  3QJZ A;  3HXE A;  3JUI A;  1N32 T;  4HWH A;  1TNZ A;  5FY7 A;  5J0Z A;  2XEE A;  3APC A;  4H9N C;  4BEP A;  3KAE A;  5D0Q D;  5FWQ A;  1KNZ A;  4YLH A;  3L08 A;  2XUE A;  4UEM A;  3RH3 A;  2W67 A;  3UU5 A;  1JWG A;  2KC7 A;  5JDL A;  4JI0 T;  3OVU A;  4EPZ A;  2W61 A;  1SA4 A;  4G2A A;  2M6I A;  1JWF A;  3W15 B;  2PQR A;  4BA9 A;  3FU0 A;  4APF A;  2JLB A;  3N9O A;  4RG6 A;  3TG5 A;  3RKG A;  4BTB A;  5GON E;  1KLX A;  2NW8 A;  4GTQ A;  2W2U A;  3QKY A;  2QVA A;  3SOL A;  3UUX B;  4UVC B;  2XPK A;  4YVO A;  2VQF T;  4LMJ A;  4DV5 T;  5BNW A;  4I2W A;  4TUU A;  1W0B A;  2LT3 A;  2XY8 B;  4EZH A;  4HFI A;  4TXP A;  1HU3 A;  3KVA A;  1HZ4 A;  3FUD A;  2QA7 A;  3W9G A;  3AE8 A;  1ELR A;  4YVQ C;  3PUW F;  2K5B B;  3HI2 A;  1I6Z A;  3D9P A;  4X65 T;  3VLF A;  4K0R A;  3FTS A;  4E85 A;  4U04 A;  3N9L A;  3HDX A;  4V3I A;  5ABE A;  4IE0 A;  2BUG A;  2WQY A;  3AG4 E;  3IXE A;  3UIP C;  4AY6 A;  3Q5D A;  4BER A;  5ENO D;  2J9Q A;  1HH8 A;  4FLH A;  1D8E A;  3L9T A;  4KZ0 A;  2LHN A;  1WAO 1;  3FZH B;  2Y4U A;  1FEW A;  2IOL A;  3FUN A;  3KS2 A;  3V30 A;  1YQ4 A;  2YU2 A;  3P4Q A;  1NAF A;  3ZMU B;  3RYI E;  1WG0 A;  3PJA A;  4D10 C;  4DK5 A;  4C48 B;  3HIZ A;  3AA0 B;  2AXZ A;  3SFZ A;  4Y6C A;  4TUY E;  2P9N G;  2BG9 B;  2LXM A;  5FY1 A;  2CLY C;  3FU6 A;  4YDY A;  3Q7F A;  2JMK A;  4DUZ T;  2VGX A;  4DUY T;  5FL0 A;  5T3R A;  4HS2 A;  2F37 A;  3JUE A;  4FJZ A;  5LGN B;  3ONX A;  3T5X A;  1OXZ A;  5DAB A;  5C8Y E;  3HVE B;  5J2U E;  3NB2 A;  5JMN D;  5AQF B;  4GA1 A;  3IHY A;  3TGO A;  2B1E A;  2GRL A;  3LDZ A;  2GRN B;  1Y6I A;  4J8Y A;  4KZC A;  5L3F B;  4FC8 A;  2V6Y B;  1EDU A;  5AQA A;  3AVS A;  3T8M A;  3RKV A;  1YCS B;  4AQF A;  3Q49 B;  3UFG A;  1E8Z A;  2X0Y A;  1KT1 A;  2B6C A;  5JQG E;  1N4Q A;  3FTY A;  1Z8U A;  5EIB E;  1WFD A;  3VTX A;  3AXJ B;  5JHA A;  5HCM A;  3ZHE A;  4LNG A;  3NBX X;  4UIG A;  4ASK A;  3ASH A;  2E9X D;  3U66 A;  3RK6 A;  4O6F A;  3NOC D;  5HKP A;  1WYB A;  3WI3 A;  4BT8 A;  5LJN A;  4DRX E;  4TWF A;  3RYC E;  3FHN A;  3QK6 A;  4XKC A;  2L8K A;  1YKH B;  5LFA A;  4BX9 A;  3ZFW A;  3MA5 A;  3NF1 A;  1TNO A;  4JUY A;  4ZI3 D;  5AQN B;  1SZ9 A;  2DI4 A;  3KVB A;  2D0T A;  3QB2 A;  2YDS A;  4HWI B;  1BR1 A;  3R7Q A;  2IML A;  2QYJ A;  4CQI A;  5A6C A;  2K9A A;  2UY1 A;  4UUC A;  1UG3 A;  2WB5 A;  1ELK A;  3C5R A;  3AG1 E;  3TWS A;  4WW0 A;  3KIN B;  5LB7 B;  4OYJ A;  5AQI B;  2ILR A;  1O1R A;  1DU2 A;  4QHO A;  1KK7 A;  4BTA A;  4AV7 A;  2FBN A;  3FEY A;  2J08 A;  2XQ5 A;  5D2M C;  3CIR A;  4TWH A;  1NL4 A;  1KNP A;  5KWD A;  4GCN A;  5HS0 A;  3UM2 A;  3JC6 C;  3N2O A;  4QQI A;  3AEG A;  3Q9N C;  4K0K T;  3PZ3 A;  3FU5 A;  3E22 E;  4IL9 A;  3RO2 A;  2NTX A;  3N5L A;  3ZT6 A;  3UTK A;  2UXD T;  4MAL A;  3BUA A;  3RC8 A;  4Z8X A;  4UVB B;  1RW2 A;  3QWV A;  5D0O D;  5LBQ B;  1DNP A;  2HN2 A;  5FQ8 A;  3TXM A;  2R05 A;  1FVF A;  5ENS D;  4IT4 A;  3CGH A;  2N9D A;  1TN7 A;  2VB6 A;  4HQD A;  4XZC A;  3FXD B;  2IFU A;  4E6H A;  2NW9 A;  4WBN E;  1TEZ A;  2CE7 A;  5CCM A;  2KZT B;  3VR8 A;  5JRE A;  1OWN A;  1NI1 A;  3PZ4 A;  2Y69 E;  3UU3 A;  1MX4 A;  4BX8 A;  3NZU A;  2Q9Q A;  2E2E A;  3QNU A;  1XWM A;  4I43 B;  5AQR B;  3P4P A;  4DI4 A;  3ABV A;  1FT1 A;  5G04 C;  4U8H A;  1OED C;  3ISM C;  4GYY A;  4JI3 T;  1EZ3 A;  4AXP A;  3FEX A;  1OCO E;  3EDT B;  5IUX A;  4EGW A;  2D9D A;  3ZYL A;  3FY4 A;  5KDM C;  4A3V A;  4DX2 A;  4HRM B;  5LYJ E;  2YNQ A;  1BI7 B;  4EBA A;  3ZST A;  2HPL A;  5AQL B;  2CXD A;  3DST A;  4HWC A;  3D3M A;  3JXI A;  1MNE A;  4GYO A;  4KMO A;  4JL0 A;  2CG2 A;  5JJ7 A;  4N39 A;  3I0Q A;  3K3Q C;  3LXU X;  5FVK A;  4QH4 A;  2RA1 A;  4HWD A;  4NUU A;  4I50 E;  5IYZ E;  4QH1 A;  4HLL A;  3CK6 A;  1E2A A;  2XRZ A;  4GZ6 A;  3Q4A B;  4GKJ T;  4UWK A;  3MKD A;  4HBD A;  4TX5 A;  4ZI3 C;  3CIA A;  4N2Q A;  3CVU A;  4PS8 A;  1KEY A;  3TWT A;  5AFU L;  2X38 A;  3UUL A;  4UXN B;  4K03 A;  3I1A A;  3MK7 C;  5IY5 E;  3VKG A;  3ZU7 B;  2MYO A;  2L3L A;  4DR3 T;  2PQN A;  3AAA C;  1ELW A;  1MYO A;  1FVH A;  2PZI A;  2P2C P;  5HEG A;  2XSA A;  2WWU A;  3SRZ A;  2K24 A;  3L16 A;  3JCF A;  4GIW A;  2WXF A;  3EU9 A;  4JI8 T;  3PDY A;  4JEH B;  5KNG A;  3UIO C;  1IHG A;  2X6K A;  4TV9 E;  4GTT A;  1SA0 E;  5BT1 A;  3AAI A;  2LJL A;  2C5I T;  2C5J A;  2H6H A;  3A7M A;  2KAT A;  1XDP A;  5FIO A;  5A1L A;  1RZ4 A;  1TNU A;  2XCC A;  2IJG X;  1IBL T;  5M4Y A;  2KCK A;  3FUK A;  1M7K A;  1IHB A;  3ZKJ A;  3UMV A;  1UN9 A;  2OEV A;  4U8Y D;  4XBF B;  1X79 A;  1MIW A;  3EDU A;  4XAX B;  1UJK A;  4TNV A;  2A2F X;  2X9H A;  2QFC A;  4OX9 T;  1KZO A;  3CX8 B;  3ENE A;  4XI9 A;  4LNB A;  2YU1 A;  2FUL A;  4IN3 B;  4DX7 D;  2D5U A;  3LY8 A;  1IJ5 A;  2J07 A;  4IDO A;  4O2A E;  2EIL E;  3CVV A;  1LD7 A;  4DV4 T;  4GPM A;  3S2A A;  4DMW A;  4I9E A;  1E8X A;  1ZB1 A;  5FQ7 A;  5JH7 E;  4B89 A;  3NVO A;  3HL6 A;  3JQ1 A;  1H2T C;  3UUX A;  1HF8 A;  4G11 A;  4L23 A;  1K3Z D;  3DSW A;  3SF4 A;  4ILG A;  4EXT A;  4DV2 T;  3NQP A;  5AQH B;  1KNR A;  4UQY A;  5CHE E;  3RPU A;  3S7F A;  3RQU A;  2C0S A;  3E34 A;  4ILI A;  2WU5 A;  3RAU A;  4A3T A;  4N3A A;  2KIN B;  5FL1 A;  3V5S A;  4LNU D;  4I9C A;  4ACK A;  5EK3 A;  2FEZ A;  4BES A;  1T98 A;  1D1B A;  2LAH A;  3E08 A;  2P58 C;  2F0Y A;  1TJC A;  4I1M A;  4ANV A;  5AEN A;  2J47 A;  4I55 E;  5CCL A;  3QWP A;  2VQE T;  3AA7 B;  4QXH B;  4DO0 A;  2WZH A;  4B3M T;  2W63 A;  2OVB A;  2A5U A;  2A4Z A;  4EZL A;  2IHR 1;  3JAF A;  3Q78 A;  2P9L G;  2WCA A;  2WXJ A;  4M1P A;  3PU3 A;  3ZLI A;  3ASO E;  3ZXS A;  3D9J A;  5JR9 B;  2XQ6 A;  2NTY A;  2WXL A;  4OHF A;  4HNA D;  2BG9 A;  2V8S V;  2WVI A;  1L0V A;  4A5X A;  4OFZ A;  3Q79 A;  3B57 A;  5FZQ A;  2NOX A;  1QLB A;  4YSZ A;  3EU5 A;  3H3A A;  3UUN A;  2AXV A;  5ENN A;  3CQG B;  3LK3 B;  4C91 A;  2WQH A;  4IDZ A;  3ONL A;  4EZJ A;  3MV3 B;  1MJ0 A;  4EB6 E;  4ISS A;  3EHN A;  3L54 A;  2CRB A;  2AXU A;  2IF4 A;  5FY0 A;  5L3C B;  4LML A;  4ABN A;  2JIW A;  3FZK B;  5JDQ A;  4NPP A;  3P7I A;  4EYY R;  3BK9 A;  4IE6 A;  3CHP A;  2V6Y A;  2PBI A;  1U5P A;  3DPD A;  1H6O A;  5CA1 E;  2KWI B;  3PUS A;  5KJL A;  2YHC A;  4FHK A;  3EHQ A;  2HHH T;  3N71 A;  5DIZ A;  1KZP A;  3AXJ A;  2VKH A;  4BSZ B;  1OY3 D;  4HFC A;  2V5F A;  4X1I E;  1V55 E;  3APF A;  2HN1 A;  2I0M A;  2FJB A;  1HR0 T;  3ABL E;  3PZ2 A;  3GA8 A;  2KCV A;  2H7O A;  3N9N A;  4ZZC A;  3FBL A;  4F6R D;  2OOE A;  2RP4 A;  2LHR A;  5FNV E;  3ML8 A;  1D0Y A;  3PEV B;  3URZ A;  2MHK A;  2VJ8 A;  4DMV A;  4LF9 T;  2C5K T;  4MBQ A;  4LUN U;  4B94 A;  3C50 A;  5EZY E;  4B93 B;  2XZT G;  3KFW X;  5JDM A;  3CHR A;  3I9W A;  2VYI A;  2J4D A;  1QYM A;  5HRY A;  2FJD A;  3JAD A;  2EHO C;  1QZ2 A;  5LGT B;  4JI5 T;  2V8S E;  4KVM A;  4WUY A;  3CVR A;  3P1U A;  4PS7 A;  1YQ3 A;  5L47 A;  4GK5 E;  2XSB A;  2EIM E;  1I94 T;  3AJI A;  1Z3Y A;  4L2L A;  5AQK B;  1TN6 A;  5FYM A;  2V0P A;  2L6J A;  3MAC A;  5ADX L; 
#chains in the Genus database with same CATH homology
 1FMV A;  2XAF B;  3U78 A;  4I6J A;  3NRX A;  5G55 A;  1PY1 A;  2UXN B;  4HEA A;  4M3O A;  3AU4 A;  2XAS B;  3SS1 A;  3MEK A;  3SBS A;  3ZMT B;  2CEA A;  1QSD A;  2Y4T A;  2XHE A;  4DVD A;  5FXZ A;  1QQE A;  5HYA A;  3LPZ A;  4CI3 B;  3LBX B;  3SZ7 A;  3PUK A;  5KJK A;  3QNK A;  4ZI7 E;  3LJ3 A;  3D9O A;  4U0S A;  4HOQ A;  2K48 A;  3L22 A;  3Q9D A;  2LM9 A;  3ZMZ B;  2UWJ G;  1HS7 A;  4NUR A;  4I2Z A;  2CLY B;  2KZT A;  2VTB B;  4TV8 E;  4ZI2 D;  5HI7 A;  5JVD E;  4FP7 A;  4IE4 A;  1E8Y A;  5LX8 A;  2VK9 A;  1OWA A;  2PM7 A;  2JMH A;  2DCP A;  2JPF A;  3KD7 A;  5JJ6 A;  1IAP A;  2VSO E;  2GW1 A;  4JVS A;  3NZQ A;  4F53 A;  3OXG A;  3EVY A;  4L0R A;  3ANW B;  1ZBP A;  3FUJ A;  2Q9Q D;  3ZYM A;  4ILH B;  2CCQ A;  2YHE A;  3Q5X A;  5A7D B;  5AIJ A;  3AA6 B;  2X6F A;  4H9P C;  1H7C A;  1ZKE A;  4BAY B;  5JRC B;  1OWM A;  3J9X 1;  3GZ2 A;  4EIW A;  4OYS A;  4I17 A;  5C2Y A;  2ZM2 A;  2LOS A;  5LCY A;  3PE4 A;  4P29 A;  3Q5M A;  2C0M A;  4Y6W A;  4OK0 A;  3FTV A;  3WAK A;  3H37 A;  4O4H E;  3EJN A;  1SQM A;  4IST A;  3UQ3 A;  3SD5 A;  3QOU A;  4H9Q C;  3MXZ A;  5C1D A;  4F1S A;  2ODU A;  3ZMS B;  4JEH A;  4YHJ A;  5HWY A;  1MMG A;  2V7K A;  1MIY A;  5J90 A;  2WQ7 A;  3OJA A;  3LG7 A;  4PFP A;  1HS6 A;  2AWI A;  2WM9 A;  2VSX E;  4CDN A;  4I6G A;  3VKH A;  4N78 D;  2J09 A;  1HG2 A;  2W00 A;  2J49 A;  3SHF A;  4HVB A;  2BZB A;  2HM8 A;  2XGO A;  3SNX A;  1US7 B;  4NRH B;  1CUN A;  5CMW A;  2WXH A;  2NXP A;  4UI9 J;  3ULQ A;  3PS6 A;  1E90 A;  4EZK A;  3A5X A;  1OWO A;  3I9Y A;  3IV0 A;  3MYV A;  1HO8 A;  2XRY A;  4R7L A;  1O3X A;  3EHM A;  5JDN A;  2I1K A;  3U3W A;  4KUM B;  4JEU B;  4OVU A;  4CGV A;  4HOR A;  5KMG P;  3CEQ A;  4UWF A;  4ADZ A;  3C64 A;  4AEZ C;  3R9A B;  1SZA A;  3AS8 A;  2KMF A;  5CA0 E;  4CEM A;  4YND A;  3ML9 A;  4B8C B;  2NW7 A;  3LCA A;  3PH0 C;  1E7V A;  4PS3 A;  1HE8 A;  4AI6 A;  5EX3 A;  3PUQ A;  4EQF A;  4CXW A;  3I4G A;  3J7Y q;  5JR9 A;  1IZN B;  1G73 A;  4C90 A;  4GCO A;  3CHM A;  4HOU A;  4XE0 A;  3IBP A;  4G26 A;  2CM0 A;  4HE8 A;  4GZC A;  2DWG A;  4HKA A;  5EKQ D;  1S94 A;  2WMO A;  3QWW A;  4ACL A;  2BDE A;  4JA9 A;  1WR6 A;  4ANW A;  3D9K A;  4E7S A;  3AAA B;  1L5J A;  5T4Y A;  4FHJ A;  3PRZ A;  4J8F A;  2WXN A;  3MKQ A;  4IHJ E;  4G2V A;  2R5S A;  4CXY A;  3VLD A;  3M65 A;  1U3C A;  2AVP A;  3ESK A;  3RC3 A;  2VKD A;  5DQV A;  5FZR A;  5F8P A;  3L6A A;  2KT9 A;  4ATG A;  4MLP A;  5JJT A;  1EYH A;  3GZ1 A;  3MCX A;  2XPI A;  4P09 A;  1U3D A;  2IC9 A;  1BR2 A;  4WWP A;  2D2S A;  4APO A;  3ASG A;  1ZHC A;  4AIF A;  2HR2 A;  1Z0P A;  3O4Z A;  5G05 J;  5KX5 E;  3O4X E;  2E0I A;  4HOT A;  4TZ4 C;  3E0Z A;  3KV6 A;  4PH4 B;  3QAQ A;  3PU8 A;  4J8S A;  3ZCI A;  3FUL A;  4PJL A;  4GA2 A;  4GK0 E;  4TN7 B;  1Y8M A;  2VSN A;  4A1G A;  5JDG A;  3ZC1 A;  3QK0 A;  2R59 A;  3CHO A;  3O1I A;  3C4X A;  4XIF A;  4AKH A;  1Z6T A;  3AS4 A;  4PK6 A;  3N9P A;  3HR0 A;  1E96 B;  1E7U A;  4WBO A;  5LP6 E;  2V4L A;  2XPZ A;  3AB3 B;  3S7B A;  1D0X A;  4PW8 A;  2IAK A;  3LEW A;  2KXP B;  3OYX A;  4AVX A;  5HXS A;  4J2C A;  3CVX A;  1B89 A;  3GMI A;  3UFE A;  2L0I A;  4A55 A;  4UF0 B;  1AJ3 A;  3K9I A;  4DBR A;  3KV9 A;  3CVY A;  2XAJ B;  5LOZ A;  2E9X C;  3ZIM A;  1YKE B;  2LO6 A;  3QDN A;  1WLX A;  4GZ3 A;  4KXK B;  3ESL A;  2LEH A;  4JHK A;  3FUF A;  2QGS A;  1VDY A;  4EBA G;  3ZEF B;  3GWH A;  2PFV A;  3D9N A;  3TL5 A;  4DPR A;  3ZMV B;  4EYU A;  5JHB A;  4PJM A;  2CWO A;  2XAQ B;  4UQX A;  3N2G E;  3HKD E;  3ZN1 B;  4BJM A;  4WNG A;  2JQQ A;  3ANW A;  3WAJ A;  4KYO B;  5CMY A;  4G63 A;  4J8D A;  3LFM A;  1E1H B;  1MMD A;  2XGS A;  4TRQ A;  4BT9 A;  2IC6 A;  4L2Y A;  3UPV A;  1MMN A;  5J1G A;  1YW0 A;  1FMW A;  1Z3X A;  3GW4 A;  4NUV A;  3BQK A;  2UXX B;  1MHQ A;  4P0A A;  4L9I A;  2Y3A A;  4FLB A;  5EX0 A;  2EHO B;  3ZPJ A;  2W0G A;  3C98 B;  3HKE E;  5HXR A;  4Q69 A;  2ION A;  5AJL A;  4A1S A;  2CHX A;  2GGF A;  5LOV E;  3O1J A;  2WXR A;  4IE7 A;  3ASF A;  3CX6 B;  3L17 A;  3TXN A;  3L13 A;  2LSJ A;  3KV5 A;  2W62 A;  3B7U X;  5HQ8 A;  3F57 A;  1UCU A;  5HXC A;  4XKB A;  4BWR A;  2VL8 A;  3FUE A;  4O4I E;  4KBQ A;  2P9B A;  2KLQ A;  3R7R A;  4JHR A;  3N2K E;  1WYC A;  3CVW A;  3IBE A;  4NQ0 A;  5LG4 A;  3CVP A;  4N3C A;  3FB2 A;  1UX5 A;  1LKX A;  2ZM8 A;  4JC8 A;  2BF0 X;  2FO7 A;  5LBM A;  3PTR B;  1P5Q A;  4CDM A;  3MZL B;  4HOS A;  2FF4 A;  1LVK A;  3G2U A;  4X1Y E;  3FUI A;  3UT7 A;  4K0U A;  4JZY A;  4MS6 A;  4AKI A;  4UQZ A;  3R6N A;  4A56 A;  2GK9 A;  4PFO A;  2Y48 B;  3LK2 B;  5KJM A;  3LS8 A;  2ZMA A;  2MTQ A;  2CA5 A;  2OA5 A;  2LSI A;  4AP2 A;  3PVL A;  3I5P A;  5DJQ C;  4C0M A;  3FH8 A;  4U72 A;  2ZLY A;  2MBG A;  4G25 A;  4BFR A;  3ASD A;  3GZS A;  2MOW A;  1UN8 A;  3HVE A;  4UWL A;  3L09 A;  2JRK A;  5L3B B;  4Q94 A;  2A72 A;  5EDS A;  3TG4 A;  3LY9 A;  4FA6 A;  4L1B A;  2ZU6 B;  3U4T A;  5IHY A;  4GYS A;  3ZHE B;  2WXI A;  3CPZ A;  2KM4 A;  3V5U A;  2H7V C;  2J4B A;  1B7T A;  4O4L E;  2LSY A;  5FXX A;  2Q7F A;  4H9S E;  2YIN A;  4JLE A;  3NRY A;  5FP3 A;  3CQX C;  4E7Z A;  3CK7 A;  2OND A;  3NZP A;  1ZV4 X;  5EK4 A;  1N54 A;  3FDH A;  3APD A;  2L9B A;  3BG0 B;  3Q47 B;  3AS5 A;  5ANL A;  4OVV A;  2J1D G;  3ZN0 B;  5FTP A;  2RG8 A;  4AOF A;  3LVR E;  3OXF A;  3ETV A;  3HKB E;  3N9Q A;  3SI5 A;  5G2N A;  4IRU A;  3FWV A;  2XAH B;  3RRM B;  1EPU A;  2ODV A;  2C2L A;  5BV1 A;  3CK8 A;  2MYS A;  2NC9 A;  3D9M A;  5LGU B;  5HAX A;  3C4Z A;  3U3I A;  4WWN A;  4CXX A;  4EZ4 A;  3CVL A;  3CR3 A;  3IEE A;  3IKO B;  2ACX A;  4XI0 A;  4WNF A;  4O8S A;  2X0L B;  4YJ3 E;  4BY6 A;  2LSG A;  1BPO A;  3RJV A;  3N9M A;  1S0P A;  5FQ4 A;  3D9I A;  1JPL A;  3EIJ A;  2GRM A;  4UWH A;  3VTY A;  3O9X A;  1YD8 G;  4B6X A;  3FH7 A;  2X9W A;  4RSY A;  1LVF A;  5T8I A;  5DQW A;  2YK0 A;  4I43 A;  4WAF A;  4IYP A;  3PE3 A;  3Q15 A;  3KV4 A;  2WBL A;  3P8C D;  4H9O C;  3RRU A;  4GA0 A;  2X9X A;  4QX7 B;  3ZN3 A;  2WXM A;  4FAD A;  1H2U A;  3QC9 A;  4UF0 A;  2WXO A;  3KDS E;  4HGA A;  1MND A;  2LSU A;  2KCL A;  4DJA A;  3ZPO A;  1VRB A;  2X6H A;  4F6R C;  1LF8 A;  4MRU A;  2R17 C;  1OWP A;  2PM6 A;  4AQF C;  4Q96 A;  3ZEF A;  4JHJ A;  3ZYQ A;  4ILU A;  4ZHQ E;  5DBK A;  4UI9 K;  4AXH A;  2X67 A;  5JDF A;  4UI9 C;  2CXF A;  4AY5 A;  5LXT E;  4UEL A;  3RYF E;  4IE5 A;  2HYZ A;  3G2V A;  4G23 A;  2PL2 A;  4RG9 A;  3GN5 B;  5E0O A;  2M67 A;  3UUM A;  2OVF A;  5E75 A;  2I9C A;  2WB2 A;  5FJY A;  3CWZ B;  2V1D B;  1NWM X;  2JJ9 A;  4PJJ A;  5L3E B;  1XGW A;  1LRZ A;  4N3B A;  3Q5W A;  4URK A;  4ERR A;  1GW6 A;  2DIW A;  1HX8 A;  2X6J A;  2VSY A;  3CKC A;  4AJW A;  2EHO A;  3C98 A;  3MJX A;  4U0U A;  4UWG A;  3R84 B;  2LAI A;  2Y8D A;  3SGH A;  1IQU A;  3K8P C;  4QKN A;  3QAR A;  4L7T A;  4AKG A;  3PEU B;  4G1T A;  2VQ2 A;  4PNI A;  5JDH A;  4WWO A;  4GYW A;  3OXL A;  4UVA B;  4ZI2 C;  3QUJ A;  3FTZ A;  4H7X A;  3D9L A;  5LA6 E;  2RD0 A;  4GPK A;  4YJ2 E;  2I59 A;  3P2B A;  3JCK C;  3LYA A;  3GYZ A;  4V1A v;  4GML A;  4TV3 A;  4QX8 B;  3PE0 A;  4JW1 A;  1EF1 C;  4B0Z A;  1OWL A;  3BG1 B;  3RYH E;  3EIQ C;  2G0U A;  3JC6 D;  3MKR A;  3EUH A;  4CI1 B;  2SPC A;  4XX5 A;  1QNF A;  2Q9Q C;  4CT0 A;  4BJN A;  2CHZ A;  2E9X B;  1MIV A;  3Q2M A;  3RRW A;  1D0Z A;  3PDN A;  4CT4 A;  2VAS A;  4J8E A;  2VGY A;  5G05 C;  2NSZ A;  3NZS A;  2N1G A;  3FHE A;  5KCM A;  2CHW A;  4KT6 B;  4OYK A;  5BV0 A;  3TAX A;  1IQR A;  2YEV C;  3FFL A;  4AM9 A;  1VOM A;  4KBM B;  2XQ0 A;  4JA7 A;  2LSK A;  3PUJ A;  3CML A;  4H7Y A;  2DWK A;  4YFS A;  2WQ6 A;  3HHM A;  3RU0 A;  4CDR A;  4O2B E;  3CVN A;  3UT4 A;  1IYG A;  2A3D A;  3IHV A;  3FH5 A;  4I6E A;  5FT9 A;  3CK9 A;  3CHQ A;  2WPV A;  2XPY A;  4X20 E;  4EOZ B;  1OUV A;  3ZJ2 A;  1WRD A;  2I2O A;  1MQS A;  2NP9 A;  3DJB A;  4QFV A;  5E76 A;  2OV8 A;  4LEU A;  3HA4 A;  1HG5 A;  2N2N A;  3CHS A;  5ANR A;  5BW8 C;  4N2S A;  3O48 A;  5J2T E;  3G2W A;  2LOP A;  4PUC A;  4DBQ A;  2DCF A;  1INZ A;  5L3D B;  4AKR B;  4DLQ A;  2VWA A;  4F7A A;  4X1K E;  3F2E A;  3F31 A;  3I3N A;  2I6H A;  3PUR A;  2XHE B;  3B13 A;  3I0O A;  4DND A;  4UV9 B;  4GU5 A;  4GYR A;  4FUL A;  2CMR A;  3LBX A;  4FJY A;  3RRC A;  4I1O B;  5H6Q B;  3AVR A;  2CWY A;  1NP7 A;  3AU5 A;  3IEG A;  2VKJ A;  2NWB A;  5BPP A;  2IU1 A;  3RRN B;  2X9Y A;  4WNE A;  3FBZ A;  1TJF A;  2LNI A;  4DI3 A;  5J08 A;  2VTB A;  4LRZ A;  1BR4 A;  4J6I A;  5FQ6 A;  4AKL A;  4I4T E;  3CLJ A;  3ONK A;  3K3N A;  2L0T B;  3MZK B;  5ARG A;  3RIB A;  2BTD A;  2L9Q A;  5LJM A;  5A23 A;  4W9R A;  5FZS A;  3K3O A;  3ZVV A;  3MGB A;  4QWN B;  5TAO A;  3UX4 A;  5HWX A;  1UW4 B;  3KBU A;  2V7M A;  3QC1 A;  1V9D A;  5LHG B;  3TJP A;  4DLO A;  4PK5 A;  2CFZ A;  2H3R A;  5JRC A;  4MFR A;  2KWH A;  5LCW C;  1FCH A;  4FU3 A;  4L5G A;  4ZOL E;  4P0B A;  4N5C A;  5L2L A;  2MRI A;  4C9B B;  4PAG A;  3ZRH A;  4GB9 A;  3GN5 A;  5FMN A;  4GOU A;  2EQX A;  3FTU A;  4WNK A;  5FXW A;  3ZCJ A;  4NAC A;  4MHC A;  4KP3 C;  5G04 J;  3S7J A;  2IOS A;  3B7T A;  4UV8 B;  4IIJ E;  3BEE A;  3CQC B;  3ZYK A;  1NA3 A;  2CG3 A;  3ZJ1 A;  3KEZ A;  2HO1 A;  3CST A;  1XNF A;  3LVQ E;  1ZU2 A;  1U4Q A;  3S4U A;  3PNL B;  4ANX A;  4PJN A;  3ETU A;  3OBV E;  3CKB A;  5LCW J;  2D0U A;  1H2V C;  3JQ0 A;  1YA0 A;  2ES0 A;  2WMN A;  1D1A A;  2EHO D;  1S35 A;  4JXT A;  2XGM A;  2DHR A;  2WXG A;  5HXE A;  3U64 A;  5BUZ A;  3E4B A;  3WXX A;  3FXE B;  2IQC A;  2XEV A;  4JEU A;  3LKU A;  4ZS2 A;  3VU7 H;  2X3M A;  3UT5 E;  4RVB A;  4LCT A;  1X5B A;  3DBS A;  2VGX B;  5FXV A;  4IUL A;  3HKC E;  1HFA A;  4ANU A;  3CX7 B;  3PUG A;  5CB4 E;  4HXI A;  3C51 A;  2LE8 A;  4EEC A;  1HCI A;  2E9X A;  2BVM A;  2V26 A;  3TKL B;  2Y6X A;  4FJO A;  2LSV A;  2V7J A;  4GZ5 A;  3UT8 A;  2XTL A;  2KZ7 B;  4I1A A;  2WXQ A;  2DLR A;  3ZGQ A;  3G2S A;  2QY7 A;  2XAG B;  1KT0 A;  2I1J A;  1H19 A;  2KND A;  3LY7 A;  2HH7 A;  3BQI A;  4U0Z A;  4U74 A;  5ARF A;  1NA0 A;  1MMA A;  3SWH A;  5KJN A;  2E8I A;  5L3G B;  3MKQ B;  3LK4 2;  2X6I A;  2AW6 A;  4CGW A;  4C0E A;  4H9R C;  3PRE A;  4LER A;  4BSX A;  3PNT B;  2Z6E A;  3DP7 A;  4EAH A;  5LHI B;  1BR0 A;  4PDX A;  2PG8 A;  3VHL A;  2WXP A;  3AAE B;  3MV2 B;  3LJC A;  2UY1 B;  2HPJ A;  3OYZ A;  4O4J E;  5LHH B;  5ETW A;  2PJQ A;  4CZZ B;  5LP0 A;  5AJD A;  4CI2 B;  2CXL A;  3CSF A;  3IF8 B;  3MJW A;  3CVQ A;  4KVO A;  3L3P A;  3RO3 A;  4FI5 A;  2WSS V;  3FTX A;  2ZM0 A;  3IHR A;  3OAW A;  4HLE A;  3CKD A;  3CV0 A;  1W3B A;  3JYS A;  3SBT B;  2XQY A;  1UX4 A;  5H6R B;  4U63 A;  3PUA A;  4MLK A;  1WY6 A;  4H63 H;  4JPS A;  1HXI A;  3RKO A;  4HFG A;  3BQL A;  5AYW D;  3FUM A;  2C0L A;  4B8A A;  1Y64 B;  4GMJ A;  2FI7 A;  4CRW A;  3FP3 A;  3FTW A;  2Q9Q B;  2V7L A;  3PZD A;  4HTE A;  3ZC0 A;  1A17 A;  4GAA A;  4QXB B;  4U07 A;  3D0T A;  1JUQ A;  3DTO A;  4PK4 A;  2X66 A;  1UJJ A;  2VKO A;  3C4W A;  2BVL A;  3OKQ A;  3ZW3 A;  4XZ4 A;  2X51 A;  3MA9 A;  5BMV E;  3I4R B;  1DVP A;  3AA1 B;  3T5V A;  2WXK A;  4ME2 A;  4J0U A;  4AQG A;  5JR9 C;  1NZN A;  1SHZ C;  3S7D A;  3RX6 A;  2X68 A;  1H0A A;  2XCB A;  3G2T A;  1ZEE A;  2IW5 B;  3KBT A;  4WND A;  3MX3 A;  2JEK A;  3FU3 A;  4F3V A;  3T8O A;  1HTJ F;  4HN9 A;  4MKT A;  4HFV A;  3FUH A;  4IGU A;  4CCA A;  3B7R L;  3HYM B;  4KMC A;  2DNX A;  1D1C A;  3EDV A;  3OTN A;  4QXC B;  1PAQ A;  4ANJ A;  2V7I A;  3B7S A;  4ZS3 A;  2DBA A;  1N52 A;  1G8X A;  2YQ8 A;  1H6K A;  1WM5 A;  1E8W A;  2MOZ A;  5EK2 A;  1IJ6 A;  3U9W A;  1QUU A;  4GZD A;  2WAU A;  2M63 A;  5F3J A;  4H63 V;  3O1H A;  5M72 A;  3VLE A;  1PC2 A;  4G24 A;  5LNK A;  5HXH A;  1FIO A;  2CFU A;  3QJZ A;  3JUI A;  3APC A;  5FY7 A;  4H9N C;  3KAE A;  5D0Q D;  5FWQ A;  1KNZ A;  4YLH A;  3L08 A;  2XUE A;  4UEM A;  3RH3 A;  1JWG A;  2KC7 A;  5JDL A;  4EPZ A;  2W61 A;  4G2A A;  1JWF A;  3W15 B;  2PQR A;  4BA9 A;  3FU0 A;  4APF A;  2JLB A;  3N9O A;  4RG6 A;  3TG5 A;  4BTB A;  5GON E;  1KLX A;  2NW8 A;  3QKY A;  3SOL A;  3UUX B;  4UVC B;  4YVO A;  5BNW A;  4I2W A;  4TUU A;  2LT3 A;  4EZH A;  1HU3 A;  3KVA A;  1HZ4 A;  3FUD A;  2QA7 A;  1ELR A;  4YVQ C;  2K5B B;  3HI2 A;  3D9P A;  3VLF A;  4K0R A;  3FTS A;  4E85 A;  4U04 A;  3N9L A;  3HDX A;  4V3I A;  4IE0 A;  2BUG A;  4AY6 A;  2J9Q A;  1HH8 A;  4FLH A;  4KZ0 A;  2LHN A;  1WAO 1;  2Y4U A;  3FUN A;  1FEW A;  2IOL A;  3KS2 A;  2YU2 A;  1NAF A;  3ZMU B;  3RYI E;  4DK5 A;  4D10 C;  3HIZ A;  3AA0 B;  2AXZ A;  3SFZ A;  4Y6C A;  4TUY E;  5FY1 A;  2CLY C;  3FU6 A;  2JMK A;  2VGX A;  5T3R A;  4HS2 A;  4FJZ A;  5LGN B;  3ONX A;  3T5X A;  1OXZ A;  5DAB A;  5C8Y E;  3HVE B;  5J2U E;  4GA1 A;  3IHY A;  3TGO A;  2B1E A;  2GRL A;  3LDZ A;  1Y6I A;  4KZC A;  5L3F B;  4FC8 A;  1EDU A;  3AVS A;  3T8M A;  3RKV A;  4AQF A;  3Q49 B;  1E8Z A;  1KT1 A;  5JQG E;  3FTY A;  5JHA A;  3VTX A;  3ZHE A;  3NBX X;  4UIG A;  4ASK A;  3ASH A;  2E9X D;  3U66 A;  3RK6 A;  4O6F A;  1WYB A;  3WI3 A;  4BT8 A;  5LJN A;  3RYC E;  3FHN A;  3QK6 A;  4XKC A;  2L8K A;  1YKH B;  5LFA A;  4BX9 A;  3ZFW A;  3MA5 A;  3NF1 A;  4JUY A;  4ZI3 D;  1SZ9 A;  2DI4 A;  3KVB A;  2D0T A;  3QB2 A;  1BR1 A;  3R7Q A;  4CQI A;  5A6C A;  2K9A A;  2UY1 A;  1UG3 A;  1ELK A;  4WW0 A;  3KIN B;  4OYJ A;  2ILR A;  4QHO A;  1KK7 A;  4BTA A;  4AV7 A;  2FBN A;  3FEY A;  2J08 A;  4GCN A;  3JC6 C;  3N2O A;  3FU5 A;  3E22 E;  3RO2 A;  2NTX A;  3N5L A;  3UTK A;  4MAL A;  3RC8 A;  4Z8X A;  4UVB B;  3QWV A;  5D0O D;  5LBQ B;  1DNP A;  5FQ8 A;  3TXM A;  1FVF A;  3CGH A;  2N9D A;  2VB6 A;  4XZC A;  3FXD B;  2IFU A;  4E6H A;  2NW9 A;  4WBN E;  1TEZ A;  2CE7 A;  5CCM A;  2KZT B;  5JRE A;  1OWN A;  4BX8 A;  3NZU A;  2Q9Q A;  2E2E A;  4I43 B;  4DI4 A;  5G04 C;  4U8H A;  4GYY A;  1EZ3 A;  4AXP A;  3FEX A;  3EDT B;  3ZYL A;  3FY4 A;  5KDM C;  4A3V A;  5LYJ E;  2YNQ A;  4EBA A;  2HPL A;  2CXD A;  3D3M A;  4KMO A;  1MNE A;  4GYO A;  5JJ7 A;  4JL0 A;  2CG2 A;  4N39 A;  3I0Q A;  3K3Q C;  3LXU X;  2RA1 A;  4NUU A;  4I50 E;  5IYZ E;  2XRZ A;  4GZ6 A;  3Q4A B;  4UWK A;  3MKD A;  4TX5 A;  4ZI3 C;  3CIA A;  4N2Q A;  3CVU A;  4PS8 A;  5AFU L;  2X38 A;  3UUL A;  4UXN B;  4K03 A;  3I1A A;  3MK7 C;  3VKG A;  2L3L A;  2PQN A;  1ELW A;  1FVH A;  2PZI A;  3SRZ A;  2WWU A;  2K24 A;  3L16 A;  4GIW A;  2WXF A;  3PDY A;  4JEH B;  1IHG A;  2X6K A;  4TV9 E;  1SA0 E;  5BT1 A;  3AAI A;  2LJL A;  2C5I T;  2C5J A;  2KAT A;  5A1L A;  2XCC A;  2IJG X;  5M4Y A;  2KCK A;  3FUK A;  3UMV A;  1UN9 A;  4XBF B;  1X79 A;  1MIW A;  3EDU A;  4XAX B;  1UJK A;  2A2F X;  2X9H A;  2QFC A;  3ENE A;  3CX8 B;  4XI9 A;  2YU1 A;  2FUL A;  4IN3 B;  2D5U A;  3LY8 A;  1IJ5 A;  2J07 A;  4O2A E;  3CVV A;  3S2A A;  4DMW A;  4I9E A;  1E8X A;  5FQ7 A;  5JH7 E;  4B89 A;  3HL6 A;  3JQ1 A;  1H2T C;  3UUX A;  1HF8 A;  4G11 A;  4L23 A;  3SF4 A;  4ILG A;  4EXT A;  3NQP A;  4UQY A;  5CHE E;  3RPU A;  3S7F A;  4ILI A;  2C0S A;  4A3T A;  4N3A A;  2KIN B;  3V5S A;  4I9C A;  4ACK A;  5EK3 A;  2FEZ A;  1T98 A;  1D1B A;  2LAH A;  3E08 A;  2P58 C;  1TJC A;  4I1M A;  4ANV A;  5AEN A;  4I55 E;  5CCL A;  3QWP A;  3AA7 B;  4QXH B;  2OVB A;  4DO0 A;  2W63 A;  2A5U A;  2A4Z A;  4EZL A;  2WXJ A;  4M1P A;  3PU3 A;  3ZLI A;  3ZXS A;  3D9J A;  5JR9 B;  2NTY A;  2WXL A;  4OHF A;  2WVI A;  4OFZ A;  3B57 A;  5FZQ A;  2NOX A;  3H3A A;  3UUN A;  2AXV A;  5ENN A;  3CQG B;  3LK3 B;  4C91 A;  2WQH A;  4IDZ A;  3ONL A;  4EZJ A;  3MV3 B;  4EB6 E;  4ISS A;  3EHN A;  3L54 A;  2AXU A;  2IF4 A;  5FY0 A;  5L3C B;  4ABN A;  5JDQ A;  3P7I A;  4EYY R;  3BK9 A;  4IE6 A;  3CHP A;  2PBI A;  3DPD A;  1U5P A;  5CA1 E;  2KWI B;  3PUS A;  5KJL A;  2YHC A;  4FHK A;  3N71 A;  5DIZ A;  2VKH A;  2V5F A;  4X1I E;  3APF A;  3GA8 A;  2KCV A;  2H7O A;  3N9N A;  3FBL A;  2OOE A;  2RP4 A;  2LHR A;  5FNV E;  3ML8 A;  1D0Y A;  3PEV B;  3URZ A;  2MHK A;  2VJ8 A;  4DMV A;  2C5K T;  4MBQ A;  4LUN U;  4B94 A;  3C50 A;  5EZY E;  3KFW X;  5JDM A;  3CHR A;  3I9W A;  2VYI A;  2J4D A;  2EHO C;  1QZ2 A;  5LGT B;  2V8S E;  4KVM A;  4WUY A;  3CVR A;  3P1U A;  4PS7 A;  4GK5 E;  1Z3Y A;  4L2L A;  5FYM A;  2V0P A;  2L6J A;  3MAC A;  5ADX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...