1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
4FLBA 3G2WA 2L0TB 1HG5A 2DCPA 1ELKA 5CMWA 1EYHA 3G2VA 1X5BA 3ZYKA 4GZCA 1HX8A 4FU3A 1LF8A 2DIWA 1UJJA 1VDYA 1UJKA 3D9OA 3D9KA 3D9MA 4JXTA 4NACA 3ZYQA 3G2TA 3ONKA 5J08A 3D9NA 1SZ9A 1HG2A 3D9JA 1EDUA 1PY1A 1JPLA 1HFAA 3D9IA 3D9LA 3G2UA 4HFGA 2V8SE 1MHQA 3G2SA 5LP0A 3D9PA 1SZAA 3LDZA 4AVXA 1INZA 3RRUA 1JUQA 2BF0X 5LOZA 1JWFA 2KM4A 2L0IA 3ZYMA 1H0AA 2MOWA 4Q96A 5CMYA 3ZYLA 1HF8A 2QY7A 2LO6A 4GZDA 4Q94A 3CLJA 3ONLA 1DVPA 1JWGA 1XGWA
chains in the Genus database with same CATH superfamily
3UKUG 1Y64B 5DABA 1KFYA 1K8KG 2V7MA 1LVFA 3NOCD 2XHEB 2JLBA 3CEQA 4HLEA 1U4QA 2X38A 3UUXA 4P0AA 5ENPD 3BK9A 4HWFA 2BEDA 3HVEA 3S7BA 1TJFA 4EGWA 4JLEA 2HE0A 3AG3E 2KM4A 4YTPA 4UWHA 3UMVA 1Z0PA 2E5VA 4QH5A 2W0GA 2XQ5A 2VQET 2HPLA 5CRUA 5FQ8A 4H9SE 1IBMT 2VVNA 3T8KA 3CKDA 3HHMA 2V7LA 4J2CA 2E5LT 3ASFA 4J6IA 3LK3B 3FBLA 1BI8B 3PS6A 3ABME 5CEDB 3P1UA 4CRWA 4ME2A 4LCTA 5KJMA 1W9RA 2ETAA 1AP7A 4CDNA 5FQ6A 4GMLA 4DX1A 3RX6A 2M6IA 5CMYA 3BQOA 4DUIA 2H89A 4AJWA 4ZI3C 4MLKA 5FJYA 2B0OE 3UIPC 5HXHA 1IXVA 2K3WA 1HS6A 1MIYA 4B3RT 4FA6A 2VTBB 2FULA 4NXMT 2GRNB 2C0SA 2EHOA 2HM8A 4IDOA 3NZPA 4CZ2D 4J8EA 4H63V 2XM1A 4ZI2C 1O3XA 1H6PA 1MMAA 1OWNA 1OEDE 2BS3A 2J09A 4B0ZA 5JH7E 4IE0A 2J08A 2A5EA 2LOSA 3RC8A 4CYMD 3FHNA 3VTXA 4CCAA 3SO8A 2A2FX 3KDSE 1KT1A 2OV9A 4XZCA 2H6IA 4HRMB 3R9MA 4JL0A 3UU4A 4DR5T 4AXHA 4ILAA 2WY2A 1N33T 1KT0A 4BJNA 4DLQA 3BUAA 3TGOA 4ZZBA 4OAVB 2OV8A 2VSXE 5EYPF 2XAGB 5JDFA 2V5QC 2P9LG 3SBTB 5AJLA 4BT9A 3F57A 3AAAC 4GU5A 3Q9DA 2GRMA 2XQ0A 4DO0A 2XJ7A 4KBMB 3APDA 1YQ4A 5ENSD 3SOLA 4DV2T 4GTVA 3V79K 3FUFA 4UQZA 3LVQE 5AQBA 2IY0C 1XDOA 4E6HA 4QFVA 2H7OA 4IYPA 3VR9A 4E85A 2JRKA 4LMJA 4XI0A 2LM2A 3FP3A 2PBIA 2C0MA 4GZ3A 3D9JA 3U3WA 3D9LA 3ZN3A 3BG0B 4WNGA 2WBLA 2UXCT 3G2SA 4G2VA 3CVUA 3VHLA 1OCRE 1INZA 1ELWA 3NZSA 5A7DB 4P1NA 4CQIA 2P2CP 4JI8T 4AEZC 5FY7A 5M4YA 2VSNA 2WCAA 1SUMB 5AQSB 2CLYC 5FT9A 2CHXA 2E8IA 2PM6A 3DSSA 5LCWJ 3KV6A 3FTXA 2ACXA 4I9EA 4UIGA 1W0AA 4UI9C 4XKBA 3CGHA 2K48A 4EZHA 5HCMA 2BF0X 4ATZD 2CWYA 2E9XB 4GK5E 2E0IA 2WS3A 2LOPA 3EDUA 3W15B 5H6QB 4JI0T 3F31A 1W3BA 1AJ3A 3LKUA 2DNXA 1V55E 3IV0A 1SA4A 3HKDE 1SW6A 2V7KA 1BR1A 4EQFA 2WXOA 4LRZA 3ZYQA 5AENA 3SS1A 4ASKA 4FLHA 3SFYA 2GROB 3QOUA 5EZYE 2KXPC 2XQYA 4UWLA 2HO1A 4AQGA 2NOXA 4XEIG 4N3AA 3R6NA 1FJGT 2GK9A 4A97A 4F6RC 2AXUA 3NRYA 4JEHB 4NXNT 4B8CB 1QLBA 5FXZA 3IXEA 2ODUA 3LPZA 1S35A 2ACZA 3LXUX 4JXTA 3W9FA 4N78D 2KZTA 3CQCB 2QGSA 4LSZE 1S94A 3DJBA 3WG7E 4DR2T 1I94T 4B94A 2WZIA 5KJKA 3UQ3A 1SVXA 3UUBA 3O4XE 3ML9A 5ETWA 3JC6D 5AQNB 1NFIE 1TNUA 5JDLA 2OLTA 4M3OA 3PZDA 5CHEE 3PEVB 5CERB 3OTOT 3PZ2A 1QBQA 4UWGA 1E8WA 4IT4A 3C3QA 4J8YA 3ZU7B 2PQNA 3ASOE 2LSUA 4DI3A 2F0YA 3FZLB 1U5PA 3ZJ2A 5LP0A 4K5CA 2FBNA 3PU8A 4K0UA 5LFAA 3ABKE 1IQUA 5FZQA 4UVCB 2R2LA 2YHCA 3FU3A 4L9PA 4JVSA 3CVQA 5KNGA 4FI5A 1OWOA 3ENEA 3ZW3A 3NQPA 5G55A 5KWDA 3R84B 4YVOA 2WAUA 4YXDA 4JYAT 4BTBA 1ZU2A 4OK0A 3L39A 2WB5A 5ABEA 5E75A 5ABFA 3CQGB 5ANRA 3TWUA 1OEDC 4LF6T 3EIJA 3TLWA 3AE9A 1FT1A 4N2SA 1H7CA 2BG9E 2EIJE 2VL8A 2R05A 3MJWA 4TV9E 2N1GA 3NB2A 2RA1A 2DVWA 4JBWF 5HWXA 3ONLC 5L4EA 1IAPA 5CRVA 3J5PA 4OFZA 2WXFA 4PS8A 2JIWA 2DWGA 4DR7T 4O2AE 1E7PA 2RPAA 3UKRG 4GK0E 2VTBA 1NP7A 1X79A 3K8PC 5FKYA 3PUXF 4EEBA 4X8QA 3OXLA 3OTNA 3PE3A 1YCSB 3TL5A 4HORA 2XPKA 4G63A 3B7RL 3EHMA 5AFUL 1BR0A 1IJ5A 2V0PA 4EB6E 3CHMA 1YMPA 2XGSA 2XEHA 4QX7B 3ASDA 2WXMA 4H7XA 4DK5A 4TXRA 3FHEA 2QA7A 2ZGGA 2RFAA 3E32A 2ZM8A 2IW5B 4CN6A 4Y6CA 5DBKA 1XDPA 3CKCA 1LD8A 5KX5E 4GB9A 4EYUA 4EHMA 2VSYA 3KV5A 2MTQA 3AE1A 3FTYA 2YDQA 4HOQA 1KEYA 5C1DA 3G06A 4IGUA 4ZHBA 2XQAA 2MRIA 3WI3A 2H6FA 4X20E 3QAQA 4JI7T 5JR9B 4EZLA 3VLDA 2WXLA 1N52A 2ONDA 3FUMA 4ANXA 3QARA 3VKHA 1B7TA 1FPPA 2QYJA 4I43B 3ZPJA 1HNZT 1Y01A 3GZ1A 1HE8A 4NQ0A 3MV2B 3AAEB 3CIAA 4B8AA 3UT7A 4I17A 2VSOE 1G8XA 3R9AB 3CKBA 2WP9A 3TWWA 4FADA 3JAEA 3L13A 5AQPB 3CV0A 4GPMA 5KNHD 4MALA 5HQ8A 2H7VC 3EHNA 1TNYA 3APFA 4LNGA 3L22A 4ABNA 4K0KT 4IRUA 3FUEA 4HS2A 3D9PA 4GTOA 4K5AB 2HHHT 3ASNE 4LG6A 2I59A 2D5UA 4U31A 4Z90A 3FUHA 3GN5B 3TWVA 1OEDA 2CCQA 5AQHB 3L82A 3MKRA 4DV7T 3UFEA 3K3QC 1ELKA 2DBAA 3PVLA 4K03A 4ILBA 2BDEA 2RKKA 3RIAA 4IE7A 3PURA 3TLUA 3LCAA 5KDMC 2Y1LE 3ZXSA 5FZSA 3ZJ1A 2ZXWE 1CUNA 2CBIA 2NR4A 4X66T 3KVAA 3TXNA 1NL4A 2UUAT 5IUXA 2XQ7A 2LAHA 2IAKA 4GTQA 5IHYA 2QZAA 3K3OA 4ZHQE 1VCSA 2X9YA 3O1HA 3KAEA 3QWWA 4L0RA 1KZPA 4UQXA 3ZFWA 4I6GA 3LVRE 5JDMA 3O48A 3DXKG 2CA5A 2XY8B 2WXQA 1E1HB 3QKYA 1CHUA 3ANWB 4DR4T 1Q2ZA 2ES0A 4DX5D 2YU2A 1N4QA 3JUEA 2XAFB 2MOWA 4Q96A 2WXRA 2XRZA 5HYAA 4U7IA 1K1AA 4TUMA 2PJQA 2DIWA 4APFA 3RQUA 2DCFA 3CK7A 1E7UA 3ZUVB 4O4JE 2PL2A 5DQWA 3RQWA 2BKNA 3HKEE 4TNWA 3PUQA 4ZXLA 3ONJA 1UN8A 2XPIA 2QC9A 4QXCB 3RO3A 2FJEA 4KX6A 3ULQA 4JI2T 3JXIA 3AVRA 2KINB 4XX5A 3AG2E 4H9PC 3AEFA 3UT4A 1O5MA 5T3RA 3MACA 3ZT6A 4BESA 1QUUA 4PK6A 2NW8A 4MLPA 1HTJF 3T1HT 3AE2A 4A56A 2LUHA 4I6EA 4DV5T 3ZIMA 5AQFB 1XNFA 3LEWA 5EK4A 4UV8B 1HS7A 4NUUA 1JCQA 3B7UX 4KVMA 3EU9A 3RIBA 3AS5A 2RFMA 3RSEG 2WXIA 4QHOA 3UUNA 3VKGA 4O4HE 4FHJA 3UU8A 3AE3A 1WAO1 4L1BA 1N32T 4KBQA 3IEGA 3DPDA 3I9WA 4GZ5A 2Y0BG 3UQ7A 1EZ3A 4E7ZA 2HH7A 2KMFA 4LMKA 3RRMB 3AG1E 2LKGA 1T8BA 3PJAJ 1NAFA 4CGVA 3N9LA 3ETVA 3FTVA 2OEVA 4I2ZA 1XZYA 2BKOA 3AS8A 3ZEFB 1ZHCA 1MMGA 4XZ4A 2W61A 3I1AA 3SFEA 1TJCA 2L6JA 2CBJA 1N11A 3CVXA 5ENTD 2X6FA 2I0MA 2X6JA 4G23A 5L4HA 1KNPA 1H2TC 3N9QA 5AQTB 5HXRA 4EAHA 3CVLA 2JMHA 3C3OA 4F6RD 2WDRA 3N9PA 2BUGA 1FMWA 5LXTE 5AQGB 4ZFHA 2WQ7A 2DHRA 4JI5T 2Y6XA 2L9BA 2BBHA 3G2TA 1D1CA 5LNKA 1JPLA 3FDHA 3KBTA 2X0YA 2KWIB 3MKDA 3N71A 3DBSA 4WZXA 1BU9A 2BVMA 2EINE 2J9QA 4IE4A 4WWPA 3EUHA 4H9OC 4CEMA 4CN4A 3UU6A 5ENOD 3KV4A 5FTPA 4A98A 3SWHA 2VQFT 3PE0A 5BXOA 2DYSE 5ADXL 3D9HA 3Q75A 2IC6A 1U3CA 2WVIA 2OA5A 5JR9A 3Q49B 1WR6A 3B57A 2M6BA 3NWIA 4UVAB 3RRNB 3JCKC 5FIOA 3ONXA 3GWHA 2GRRB 5HI7A 5JDNA 5HS0A 3KBUA 1TEZA 5FVKA 1MZCA 2AJAA 4FJYA 1HF8A 4I1MA 3TAXA 1J1JA 2AXZA 4U07A 2RD0A 3PV0F 5J2TE 2XGMA 1NENA 4DUZT 1QNFA 2CG3A 2AVPA 2HPJA 3ABVA 3ABLE 3ZYKA 5LJNA 3H3MA 5J2UE 2XCCA 3VLEA 3C50A 5ABGA 4G2AA 2X66A 3LY8A 2LHRA 4KMCA 3NZUA 3PUJA 3PRZA 2C5KT 4RVBA 3FZFB 2SPCA 3ZN1B 3UM0A 5LG3A 2Y4UA 2BTDA 3AU5A 4TXQA 2QRXA 3UINC 3NF1A 1OUVA 1IHBA 3C4ZA 3N5LA 2IC9A 2X6HA 4YDWA 4KI0F 4JI4T 3RO2A 3V5SA 3ULEG 1HG5A 4YFSA 3FWVA 1W0BA 1H6KA 3HVEB 3Q79A 2WWVA 1FVHA 4N5QA 3ZSSA 3HXDA 4GZ6A 1OXZA 1MIVA 2CMRA 2CXFA 5C3JA 3Q7AA 4PJNA 2JQKA 1IBLT 3B5MA 2WPVA 1N94A 5EK2A 4UELA 4BY6A 4L7TA 5AQLB 4PK4A 2R59A 4HWDA 3ZMVB 4ZEYA 4TXPA 4NIKA 3CSFA 2CRBA 3CIRA 2JJ9A 4IIJE 4D10C 3CHRA 4O2BE 3C98B 3CWZB 4ZS2A 4HB5A 3HR0A 2G0UA 2XZDG 2DZOA 4YJ2E 2D0TA 1X81A 4B89A 1HCIA 4CGWA 3Q5XA 2XQ8A 4W9RA 5JHBA 2A9UA 3OXFA 3DEOA 1OT8A 3L16A 2IMLA 3QWVA 1Y8MA 1WM5A 2EHOB 4DJAA 3N2KE 3MA5A 4C9BB 4BFRA 3ZT5A 5CBOA 2IJGX 3O1JA 4ILHB 2A3DA 2W66A 3MYVA 1LF8A 3C51A 4HFCA 1IHGA 3VRBA 4ILIA 4N5CA 2NW9A 1IBKT 2CWOA 3UUXB 1PY1A 4GTRA 3TLVA 4GYWA 1E8YA 4CT4A 5JQGE 1JCRA 2ETCA 2XPZA 2FO7A 2L8KA 3LDZA 2BS4A 2Y3AA 1LRZA 4UI9K 2IF4A 3ZGQA 3PUKA 3QJZA 3V31A 2P9PG 4O1OA 5EKQD 3UU5A 4JEUA 2JQ9A 3Q2MA 1JWGA 3K1SA 5A6CA 1TYQG 2UUBT 4ANVA 5CMWA 1XMOT 4HBDA 3ZT7A 1HX8A 4UF0A 4HRNA 3D0TA 5JA4D 4R7LA 3FBZA 2CM0A 2FBWA 2WU5A 3TWTA 4NIQA 3CX6B 3IF8B 3ESKA 2K24A 4L2YA 3PUVF 4I6JA 4CI2B 3OVUA 1QQEA 3L09A 4X64T 3FUKA 3LS8A 4AM9A 1IZNB 4KYOB 2P58C 3ZHEB 4GCNA 3FFLA 2JEKA 1RZ4A 2OEWA 4ACLA 3KFWX 2DZNA 2DCPA 3ASGA 4YJ3E 3ETUA 2V6YA 2J62A 3FTSA 2FJDA 4FU3A 3D9MA 4JI1T 1D0XA 3HL6A 4U8HA 3IBPA 3P8CD 4DR1T 4FJZA 2VL0A 5HAXA 2CE7A 4TWHA 5EX0A 3Q7FA 2FEZA 4C48B 3FXDB 4PFOA 4AQYT 5F5WA 1TN6A 3HXEA 3E0ZA 1IYGA 1LKXA 2VB6A 4PJJA 5DJQC 3DPYA 1PC2A 3LG7A 4HWIB 3QB5A 3O1IA 3I4GA 5HXSA 4DR3T 2J4DA 4BTAA 2B76A 4KT6B 3RH3A 1WRDA 3ZNGA 3D9IA 1XMQT 4UUCA 5LHGB 2W63A 3PEUB 4AVXA 3VTYA 3CVWA 4MKTA 1WCRA 2W4XA 2H88A 3ZHEA 5KCMA 1WYBA 4JI6T 5EDSA 3X2QE 3EU5A 4AKLA 3FH8A 4KHPT 4ILGA 4U04A 1E8XA 3JQ0A 2JQQA 3AEAA 3S7DA 4KZ0A 4KUMB 2DI4A 4NACA 5EYLA 1OCOE 5CB4E 2XS1A 4GYYA 5FWQA 4ERRA 1Y6IA 2KCVA 3GA8A 1HFAA 2I1JA 5L3DB 4HFBA 3NVOA 1MIWA 4JEHA 3SRZA 5LX8A 2L0IA 2F8XK 3ZYMA 4GMJA 5FZRA 3FUNA 3TG5A 3H3AA 4OYSA 2XAQB 3UFGA 1N54A 3CLJA 4B93B 5F3JA 1FVFA 2ZM0A 1WG0A 3PDNA 5DIZA 4E7SA 4BSZB 2EILE 2DYRE 3LYAA 4UWKA 2UU9T 3J7Yq 4LFBT 4LNUD 2XQ6A 2JQHA 5FY1A 3FUDA 3RIFA 4O4IE 4DI4A 4BWRA 1HR0T 4RQIA 1ZEEA 3P7IA 3L3PA 4IDNA 5IY5E 5FXVA 3UU3A 4YTMA 4L9IA 4AQFA 2Q7FA 3I3NA 3UPVA 1MMNA 3HKBE 1OCCE 2VGXB 2BG9A 1EYHA 5HEUA 1N0RA 3MXZA 5AQJB 2D9DA 4JI3T 2MYSA 3MK7C 2BBJA 1V9DA 2ETBA 4X5TA 3C72A 2WXHA 4DPRA 4MS6A 4JHKA 5AQ7A 4MHCA 1WYCA 5HEOA 4A3VA 1D8EA 4V1Av 1WDYA 1SA0E 3LY7A 3RYIE 3Q5MA 4M1PA 4JPSA 2PTFA 3P4WA 4AKIA 5J1GA 4EXTA 5JRCB 3CVRA 5FP3A 5HXCA 3HXCA 2XEVA 2OCCE 1OCZE 4BA9A 1D1AA 4HOTA 2LSKA 3APCA 4Z91A 4A55A 2NTYA 4J7WA 2DL1A 2YNQA 3EHQA 2X0LB 5ENQD 4EPZA 5A1LA 4HXIA 3SFZA 2IEJA 2X0HA 4AV7A 4L5GA 3C64A 3CR3A 1HNWT 3P2BA 5AN8A 4AKRB 4DNDA 4JA7A 4N3CA 4PNIA 2Z6EA 3RU0A 1OEDB 4X1IE 1N4PA 4U74A 4LUNU 5L47A 5LCWC 4APOA 4DMVA 3FU6A 3UIOC 3FEYA 5AAOA 4CXXA 3EAMA 3IHRA 1UJKA 2R02A 2I2OA 3ZRHA 3AA1B 3UQ4A 3P4RA 4CXWA 3D9NA 5CEAA 1BD8A 1S64A 4GOUA 3EI0A 1IKND 1B89A 3TWRA 3OKQA 2Y48B 5AYWD 2KLQA 3QC9A 3VU7H 3DSWA 1FT2A 5AQUB 2KXPB 2P9KG 1FIOA 3AE5A 2M63A 3KEAA 3P4SA 2XENA 1S63A 1HX1B 4HE8A 2NWBA 2KWHA 1UJJA 3ZLIA 4XI9A 1N4SA 4Y6WA 2EQXA 4O6FA 2A72A 3SF4A 4HKAA 4HOSA 1YD8G 5JR9C 1KNZA 3R7RA 5D66A 1OXJA 2EIKE 2HYZA 1L0VA 2NTXA 2BKPA 3E30A 1VRBA 3PE4A 3TJPA 4K5BA 5CCMA 5BNWA 5T4YA 1NZNA 4EYYR 5AQKB 3AECA 3JUIA 1OWPA 2BS2A 2VVSA 4A1SA 2EHOC 1E90A 3MJXA 3RIUC 4M7CA 1S70B 1JUQA 1MX4A 4JA9A 5JJTA 2BG9C 5AQQB 3DWLG 2Q9QB 3DSVA 4YSXA 3IEEA 2YDRA 2UY1A 3KV9A 4TRQA 3RRWA 3IKOB 4Q94A 3PUGA 4U0SA 3UT8A 3ULYA 2JMKA 4LF4T 4X62T 3HXBA 3EDTB 1HU3A 1KNRA 1GQEA 4XKCA 2GRPB 4U96D 3EABA 1O1SA 4A63B 1KPSB 2CFUA 3RAUA 4GMRA 2DLRA 4PS3A 4IL9A 2VYIA 3CVPA 5CECB 4GA2A 1ZKEA 2KBXA 1WY6A 5JREA 4C91A 4QH1A 2ZU6B 3E34A 4HOUA 3FH7A 2XEEA 5LCYA 2W2UA 3NAWA 3RHWA 2VKOA 2VJ8A 3LFMA 2WQ6A 5G2NA 3G2VA 4EBAA 3DXMG 3MEKA 3D9OA 3CK6A 1SQMA 4CI1B 2P9UG 5L3FB 1DU2A 1MHQA 3CVVA 2X9HA 2ZLYA 1HH8A 3MV3B 3H37A 4V3IA 4A1GA 4RLYA 1A17A 2F4VT 1IJ6A 3QNUA 3LJNA 4FHKA 4OYJA 4K0RA 4YNDA 4YDYA 1TN8A 2Y8DA 5ABFB 1D0YA 1MNEA 4FLBA 2GRLA 4NRHB 1T98A 3W9GA 1RW2A 4GPKA 2X3MA 3UM3A 3RLFF 3QUJA 3ML8A 5AQRB 3E22E 4EECA 1HNXT 3SY2A 3AB3B 4IE6A 3HDXA 2FI7A 2ZIRA 4ISTA 3QDNA 4I1OB 3QB2A 2LHNA 2PM7A 3FY4A 3AXJA 4EBAG 4AI6A 2LE8A 2IOLA 4HTEA 3LJCA 3T5VA 2C2LA 3T8MA 3V2XA 4J0UA 1G73A 3NBXX 4YSYA 3GMIA 3RYCE 4NURA 1N4RA 4BETA 3AE4A 5KBAA 5FXXA 3C5RA 2IQCA 4GYSA 1ELRA 4XAXB 1YQ3A 3CVNA 4U63A 3KS2A 3UTKA 3I5PA 3ZCIA 4PS7A 2GRQB 1QYMA 3TG4A 4JV5T 3AA0B 1BR4A 3TLTA 1HG2A 2W00A 4I0UA 4KP3C 5JDQA 3SHFA 2PFVA 4IDZA 2GW1A 4OVVA 3N9MA 4EIWA 5LGTB 3KEZA 4LMLA 4OX9T 4GTTA 2DWKA 4U2YA 5AQOB 1N36T 4C0EA 2V8SV 4LF5T 5D0QD 1NA3A 3LJ3A 4GZCA 2AE9A 3AAIA 3RIUA 1VDYA 4DRXE 1UW4B 5BV1A 1YA0A 5L2LA 2H6HA 3CHQA 5ITZF 4Q69A 1DCEA 3ASHA 4ADZA 4F7AA 3HI2A 1FEWA 1TN7A 2GGFA 2QYWA 2E9XD 3OBVE 4HFEA 3VRAA 1MX2A 3AEGA 4HNAD 3MZKB 3AEDA 2NC9A 4GKJT 3FULA 2XTLA 3TWSA 2LXLA 5M72A 2XS8A 4COFA 3AVSA 2I6HA 4CDMA 2B1EA 1V54E 4X1YE 2V6XA 4P0BA 1LTXA 3U4TA 2KT9A 3RF1A 4DV3T 5HEJA 3WXXA 2NXPA 4HFGA 2JABA 2YHEA 4GIWA 5B1BE 2BVLA 4X1KE 3SI5A 2V4LA 5HRYA 2F8YA 2IONA 2C5IT 1S0PA 4GZDA 3WAJA 5LBMA 4PUCA 2YDSA 4H9RC 2NW7A 3VR8A 3ZCJA 2C5JA 5EIBE 4EZ4A 2LRKA 3GZSA 5DQVA 3M65A 4FULA 2WMOA 3UM2A 5LHIB 5L3GB 5BXUA 3RJVA 3RI5A 3L9TA 3HA4A 3NRXA 4TZ4C 3ZN0B 1DNPA 1BLXB 3GW4A 3Q78A 5LMNT 4B3MT 5J0ZA 4IREA 2DWZA 4ILCA 4I55E 2LLYA 3ONLA 3JADA 4WAFA 4G25A 1LD7A 2WDQA 3U3IA 3CHPA 3J5QB 3E08A 1MMDA 2CEAA 4HI9A 3K3NA 5EN5D 3CHSA 5AQIB 3AA6B 4JHRA 3Q5WA 3LBXB 4OHFA 3J9X1 2YOEA 5IWAT 1J5WA 1EPUA 4YVQC 3ZKRA 4CN1A 2Q9QA 4JC8A 1KK7A 1BI7B 4TV8E 2J49A 3L17A 5AIJA 1HZ4A 1DCQA 4QWNB 4X65T 3SZ7A 1HO8A 1EF1C 5EILA 3PNTB 1MX6A 2D0UA 2CPTA 1N0QA 4L2LA 2P9NG 1NI1A 2LRLA 3QNKA 3P50A 3SFDA 2J8SD 4WWNA 3FZMB 2E9XA 4HEAA 2YKSA 5KXJA 5BMVE 5CGMA 2FJAA 3WAKA 4EEDA 3P4PA 1WLXA 5JVDE 4GYRA 3T1YT 3EJNA 3OXGA 3O9XA 3RRUA 3IBEA 5JMND 3FZHB 2VWAA 3A5XA 4QKNA 2UXDT 3ZC1A 1M7KA 5L3EB 3OYXA 4HFDA 2A5UA 2CHZA 4U0ZA 4MBGA 4U72A 4GCOA 4MBQA 2XZTG 4AY6A 3LY9A 1SHZC 4Q25A 4C90A 2LEHA 1FMVA 4L23A 3ZMTB 2I9CA 1VOMA 3MCXA 1UX5A 5A23A 2N2NA 4TN7B 5CCLA 2E2EA 4GTMA 4HWCA 2LNIA 4UWFA 3ZYLA 3EHZA 4AKHA 4AY5A 3UTMA 3AE8A 3ZEFA 3ZXPA 5BUZA 4UEMA 3Q9UC 2KATA 4F3VA 4QX8B 3N9NA 4YT0A 1ZBPA 2CG2A 3Q47B 4HGAA 5AQMB 3PREA 3UXGA 4LF9T 3QWPA 2LT3A 1YXRA 2V5CA 3LK42 1EDUA 3JXJA 3DP7A 4WNDA 4C0MA 4URKA 3KINB 4JHJA 2UUCT 3L8RA 3CX8B 2R5SA 4DBRA 4LERA 4U95D 4HI8A 4LF7T 4ANWA 4DUYT 1D8DA 4UVBB 2ZMAA 3A7MA 5JDHA 2J1DG 3JAFA 2VKHA 3PZ3A 3I0OA 2LAIA 2AXVA 5FMNA 2YK0A 4H9QC 1K3ZD 4G8LA 1D1BA 3IA3A 4HRLA 4LFCT 4H9NC 2VASA 1TNBA 2EIME 4HN9A 4U33A 4WNFA 3BU8A 2XHEA 1BPOA 1SZ9A 4YY3T 3PUWF 3QOFA 3PUSA 2PQRA 5JJ7A 5JTGA 4YSZA 2MHKA 3HG0D 4TUUA 4JUYA 4TV3A 3NOGD 2AWIA 5HCJA 5LB7B 2K5BB 1K1BA 2WMNA 2IHR1 3T9KA 4O1PA 4FJOA 2JPFA 4UXNB 5BR8T 3UUMA 1O1RA 3FH5A 5LMUT 3V30A 3CPZA 4CZZB 2RG8A 5KMGP 5J08A 3EHRA 2XCBA 4F1SA 3PJAA 3CSTA 1TR4A 4EOZB 3UX4A 1BR2A 4DMWA 3V5UA 4AIUA 4DR6T 4RG6A 3U66A 5LOZA 5EK3A 2MYOA 1OWAA 1UCUA 1N9AA 2OVFA 4F1PA 2H6GA 2X6KA 3UULA 1YYHA 1H19A 2E9XC 4I9CA 4GTSA 1KZOA 1E96B 2I1KA 3KVBA 1X9BA 4WWOA 2CFZA 4EZJA 2FJBA 2IO2C 4WUYA 2XM2A 2YINA 3Q15A 3TLSA 1US7B 1WFDA 3Q4AB 3U78A 2ODVA 3L6AA 3RYFE 1ZP0A 2BKKB 3O4ZA 4YHJA 1N95A 2OOEA 4WNKA 1YKHB 4AXPA 2V7JA 2IU1A 1Z3XA 4H7YA 1Z3YA 2KCLA 2X51A 2VQ2A 3GZ2A 4G11A 1SE7A 2ZGDA 4I43A 4U7YA 3E37A 4QH4A 4N39A 3Q5EA 2QVAA 4MRUA 5G05C 3AEBA 5BT1A 3BQLA 4HFHA 4N3BA 4ZI2D 3I9YA 1NWMX 5FYMA 5FL0A 4ZI3D 4DV1T 3EIQC 1GW6A 4BSXA 2L3LA 1XNQT 4AQFC 2XPYA 3IHYA 3KD7A 2IUBA 3FU5A 2LSIA 3OYZA 2R03A 4YDOA 4BX8A 3HXFA 3ZKJA 1IQRA 3MKQA 4JZYA 2KC7A 5ENNA 3HIZA 3UI2A 5JJ6A 3RYHE 5FNVE 1Z8UA 3PUAA 2WXJA 2V6YB 2W62A 3B95A 2WB2A 1T7SA 3OJAA 4UV9B 5HXEA 1WR0A 3TWQA 3AE7A 1D9SA 4KZCA 3JC6C 2PZIA 4O4LE 2WXPA 4QXHB 4A5XA 1KF6A 5CBNA 2VGYA 4BERA 1OWMA 4PJLA 2KZTB 1J5ET 5C2YA 5AARA 4BX9A 2WM9A 4J8SA 1H2VC 4PW8A 4B3ST 3VLFA 5G05J 3C3RA 3ESLA 4Z8XA 4PAGA 3D9KA 5FINA 1UOHA 5JHAA 4JEUB 5H6RB 4LEUA 4KVOA 3GN5A 4DV4T 4HVBA 3RGLA 1H2UA 1JCSA 5BV0A 2V5DA 3C4WA 4ILUA 4QQIA 1LVKA 3I4RB 1T72A 2XASB 4I2WA 3ZSTA 3PDYA 5LOVE 4CXYA 5BPPA 1MJ0A 5ARGA 1XNRT 4FP7A 2R17C 4P09A 1NEKA 3LK2B 4G1TA 4YTNA 2XZEA 5C2TA 2PG8A 3N9OA 3JYSA 5H7PA 3PUZF 3E4BA 3OPCA 5LHHB 4WBNE 1UN9A 4ANUA 4NUVA 2D2SA 4BJMA 5JRCA 3LDQB 4ACKA 2XQ3A 4TWFA 4ZZCA 2CXLA 4H63H 4DVDA 3AU4A 4UF0B 2QY7A 1UGOA 4IDQA 3CX7B 4BEPA 2UXNB 1ZOYA 3TKLB 2V26A 1I6ZA 2LKHA 2HR2A 2WXGA 4G24A 4O60A 3ZPOA 1XWMA 2L6BA 2BKGA 1MQSA 5F8PA 2CHWA 4KMOA 3MX3A 4JD2G 4OVUA 4OYKA 5GONE 1G3NB 3N2OA 1U3DA 2FUPA 3DSTA 2V5FA 4GA0A 3FEXA 4U7EB 2J07A 2ILRA 4J8FA 4HWHA 2VGXA 4AIFA 2KCKA 3ZC0A 2RP4A 5LYJE 5ANLA 3HRAA 5ARFA 3BQIA 3RRCA 1R8IA 3NZQA 4PK5A 3X1DA 2YU1A 3V2OA 4U3CA 2CXDA 3QK0A 4JW1A 5CA1E 3FB2A 2UXXB 2LXMA 1OWLA 2UWJG 5HKPA 2LSVA 3MZLB 3DEPA 2MBGA 2KSRA 3HKCE 4BAYB 2VK9A 4I1AA 3T8OA 5T8IA 1E7VA 4P29A 1D0ZA 1E8ZA 5E0OA 2AXDS 4U8VD 2CHOA 3G2WA 2WXNA 5HEGA 4AISA 3UT5E 2X6IA 2XSBA 2J4GA 2M67A 4B6XA 5FL1A 3PNLB 1YKEB 4A3TA 2XSAA 2XGOA 4XIFA 4BT8A 4DBQA 3G2UA 1AWCB 3AXJB 3GYZA 4IE5A 3CHOA 5L3BB 2LSJA 3A8YC 4I50E 4UI9J 1A5EA 2XQ9A 4YHHT 5FQ4A 2J47A 3Q5DA 1U2VG 3M3ZB 4TNVA 3EVYA 2V7IA 2QFCA 4AOFA 3D3MA 4N2QA 2NYJA 3FTWA 2W67A 4G26A 5LA6E 3C4XA 4PFPA 3MA9A 4LFAT 1X5BA 1Z5SC 3B7BA 5KJNA 4DX7D 3ZMUB 2BZBA 4ZS3A 5LBQB 3PU3A 2UY1B 2BG9B 3CK8A 2Q9QC 5ENRD 4YLHA 1L5JA 3CVYA 3L08A 4G8KA 1ZB1A 4TX5A 1H0AA 2ZISA 4EV6A 3S2AA 2R6GF 3N2GE 5AJDA 3AJIA 2X67A 1XGWA 3RC3A 3R7QA 4EZKA 3URZA 5C8YE 2IFUA 1N34T 4U2ZA 4DV6T 3LSVA 2MPKA 3S7FA 2ZM6T 2XAHB 1QSDA 4ATGA 5HEHA 3IHVA 4IULA 4DLOA 3HYMB 3FU0A 1NA0A 2YN6A 2Q9QD 3FZKB 1Z6TA 2PNNA 3FTUA 3Q73A 3MKQB 5B1AE 4DX2A 2X9XA 5CJ5A 2N9DA 5E76A 3QB5K 2E2AA 2IDOB 5LGUB 2F37A 3CQXC 2X68A 3CMLA 3F2EA 4WW0A 4GKKT 4GYOA 3F6QA 2P9IG 3DRAA 4QXBB 5D2MC 2V4HC 3PUYF 3KSQA 5AQAA 1DC2A 5CFBA 2MAWA 4JB8P 3B13A 2XQ4A 5LP6E 3B7SA 1SZAA 5L3CB 2LM9A 3CK9A 3FXEB 1SA5A 3AG4E 2IO3C 4AP2A 5J90A 3L54A 3DSUA 3SFXA 3NBNB 4UQYA 1W09A 3ZMZB 2NSZA 5BW8C 1TNZA 4HQDA 1E2AA 3KSLA 2VGEA 4Z68A 3E33A 3Q9NC 1DVPA 3U64A 4HFIA 4DIDB 4NPPA 2L9QA 2XUEA 5EX3A 4RSYA 4KXKB 4HLLA 3RKGA 5EIDA 2WQYA 5FY0A 4GTPA 2X9WA 3ONKA 3QK6A 1UK5A 3S4UA 1P5QA 1HXIA 3BQKA 3B7TA 4PJMA 4FC8A 3AEEA 2XRYA 3ISMC 2WDVA 5IYZE 3SNXA 3I0QA 2UXBT 2FO1E 3NKZA 1M62A 1UUSA 5LGNB 3ZMSB 4RG9A 2IOSA 3SGHA 2VKJA 4AKGA 3BG1B 3OAWA 2KZ7B 2FF4A 2WQHA 3RK6A 4GA1A 3PTRB 1UURA 5LJMA 3ZVVA 4IHJE 2IIUA 2XAJB 2VURA 5AQ9A 2WSSV 2NP9A 4WNEA 2WZHA 2HN2A 4PDXA 4F53A 1FCHA 3C98A 3EUVA 2V1DB 2KNDA 3P4QA 1TNOA 4OAUC 1OY3D 3K9IA 4B3TT 2Y4TA 3DTOA 4LNBA 3AAAB 2C0LA 2L0TB 4ZOLE 4ISSA 4HFVA 4IL4A 4DX6D 2EHOD 3EDVA 2YQ8A 1UX4A 1O1TA 3FUJA 2P9BA 3AE6A 4CI3B 4J8DA 4GAAA 3ANWA 2V8SE 4WBOA 5HWYA 3QC1A 4LF8T 4IDPA 3TWXA 2VKDA 2K9AA 1JWFA 2MOZA 2CHNA 5G04J 2OVBA 4TWDA 3RPUA 4U8YD 2QYUA 4ANJA 4PH4B 3AS4A 3S7JA 5FQ7A 3SQVA 5ABHA 3TXMA 4TUYE 4WYVA 4F8HA 1VCTA 3T5XA 2ZM2A 1ZV4X 3PH0C 2CLYB 2YEVC 5TAOA 4YDEA 3U9WA 3SD5A 5KJLA 5CA0E 3PZ4A 4DV0T 1KLXA 3DSXA 3RKOA 2LJLA 2AW6A 3FUIA 4CDRA 3MGBA 4UR9A 2LSGA 3LBXA 4O8SA 3JCFA 5FXWA 1UG3A 2H3RA 3PZ1A 1YW0A 1JNRA 2WU2A 1MYOA 1MNDA 4MFRA 5LG4A 5AQVB 2A4ZA 1H6OA 2Y69E 4IN3B 3SBSA 3UM1A 4XE0A 4ZI7E 3AA7B 2P9SG 2WWUA 5G04C 3JQ1A 2LSYA 2HN1A 2J4BA 2B6CA 3BEEA 4XBFB 4KHZF 3RKVA 1PAQA 2WXKA 3FTZA 5B3SE 4U0UA 1JNZA 4CT0A 5FVLA 4I4TE 5D0OD 2LO6A 1QZ2A 5JDGA
chains in the Genus database with same CATH topology
1Y64B 5DABA 2V7MA 1LVFA 2XHEB 2JLBA 3CEQA 4HLEA 1U4QA 2X38A 3UUXA 4P0AA 3BK9A 3HVEA 3S7BA 1TJFA 4JLEA 2KM4A 4UWHA 3UMVA 1Z0PA 2W0GA 2HPLA 5FQ8A 4H9SE 3CKDA 3HHMA 2V7LA 4J2CA 3ASFA 4J6IA 3LK3B 3FBLA 3PS6A 3P1UA 4CRWA 4ME2A 4LCTA 5KJMA 4CDNA 5FQ6A 4GMLA 3RX6A 5CMYA 4AJWA 4ZI3C 4MLKA 5FJYA 5HXHA 1HS6A 1MIYA 4FA6A 2VTBB 2FULA 2C0SA 2EHOA 2HM8A 3NZPA 4J8EA 4H63V 4ZI2C 1O3XA 1MMAA 1OWNA 2J09A 4B0ZA 5JH7E 4IE0A 2J08A 2LOSA 3RC8A 3FHNA 3VTXA 4CCAA 2A2FX 3KDSE 1KT1A 4XZCA 4JL0A 4AXHA 1KT0A 4BJNA 4DLQA 3TGOA 2OV8A 2VSXE 2XAGB 5JDFA 3SBTB 5AJLA 4BT9A 3F57A 4GU5A 3Q9DA 2GRMA 2XQ0A 4DO0A 4KBMB 3APDA 3SOLA 3FUFA 4UQZA 3LVQE 4E6HA 4QFVA 2H7OA 4IYPA 4E85A 2JRKA 4XI0A 3FP3A 2PBIA 2C0MA 4GZ3A 3D9JA 3U3WA 3D9LA 3ZN3A 3BG0B 4WNGA 2WBLA 4G2VA 3G2SA 3CVUA 3VHLA 1INZA 1ELWA 3NZSA 5A7DB 4CQIA 4AEZC 5FY7A 5M4YA 2VSNA 2CLYC 5FT9A 2CHXA 2E8IA 2PM6A 5LCWJ 3KV6A 3FTXA 2ACXA 4I9EA 4UIGA 4UI9C 4XKBA 3CGHA 2K48A 4EZHA 2BF0X 2CWYA 2E9XB 4GK5E 2E0IA 2LOPA 3EDUA 3W15B 5H6QB 3F31A 1W3BA 1AJ3A 3LKUA 2DNXA 3IV0A 3HKDE 2V7KA 1BR1A 4EQFA 2WXOA 4LRZA 3ZYQA 5AENA 3SS1A 4ASKA 4FLHA 3QOUA 5EZYE 2XQYA 4UWLA 2HO1A 4AQGA 2NOXA 4N3AA 3R6NA 2GK9A 4F6RC 2AXUA 3NRYA 4JEHB 4B8CB 5FXZA 2ODUA 3LPZA 1S35A 3LXUX 4JXTA 4N78D 2KZTA 3CQCB 2QGSA 1S94A 3DJBA 4B94A 5KJKA 3UQ3A 3O4XE 3ML9A 5ETWA 3JC6D 5JDLA 4M3OA 3PZDA 5CHEE 3PEVB 4UWGA 1E8WA 2PQNA 2LSUA 4DI3A 1U5PA 3ZJ2A 5LP0A 2FBNA 3PU8A 4K0UA 5LFAA 1IQUA 5FZQA 4UVCB 3FU3A 2YHCA 4JVSA 3CVQA 4FI5A 1OWOA 3ENEA 3ZW3A 3NQPA 5G55A 3R84B 4YVOA 2WAUA 4BTBA 1ZU2A 4OK0A 5E75A 3CQGB 5ANRA 3EIJA 4N2SA 1H7CA 2VL8A 3MJWA 4TV9E 2N1GA 2RA1A 5HWXA 1IAPA 4OFZA 2WXFA 4PS8A 2DWGA 4O2AE 4GK0E 2VTBA 1NP7A 1X79A 3K8PC 3OXLA 3OTNA 3PE3A 3TL5A 4HORA 4G63A 3B7RL 3EHMA 5AFUL 1BR0A 1IJ5A 2V0PA 4EB6E 3CHMA 2XGSA 4QX7B 3ASDA 2WXMA 4H7XA 4DK5A 3FHEA 2QA7A 2ZM8A 2IW5B 4Y6CA 5DBKA 3CKCA 5KX5E 4GB9A 4EYUA 2VSYA 3KV5A 2MTQA 3FTYA 4HOQA 5C1DA 4IGUA 2MRIA 3WI3A 4X20E 3QAQA 5JR9B 4EZLA 3VLDA 2WXLA 1N52A 2ONDA 3FUMA 4ANXA 3QARA 3VKHA 1B7TA 4I43B 3ZPJA 3GZ1A 1HE8A 4NQ0A 3MV2B 3AAEB 3CIAA 4B8AA 3UT7A 4I17A 2VSOE 1G8XA 3R9AB 3CKBA 4FADA 3L13A 3CV0A 5HQ8A 4MALA 2H7VC 3EHNA 3APFA 3L22A 4ABNA 4IRUA 3FUEA 4HS2A 3D9PA 2I59A 2D5UA 3FUHA 3GN5B 2CCQA 3MKRA 3UFEA 3K3QC 1ELKA 2DBAA 3PVLA 4K03A 2BDEA 4IE7A 3PURA 3LCAA 5KDMC 3ZXSA 5FZSA 3ZJ1A 1CUNA 3KVAA 3TXNA 2LAHA 2IAKA 5IHYA 3QWWA 3K3OA 4ZHQE 3O1HA 2X9YA 3KAEA 4L0RA 4UQXA 3ZFWA 4I6GA 3LVRE 5JDMA 3O48A 2CA5A 2WXQA 1E1HB 3QKYA 3ANWB 2ES0A 2YU2A 2XAFB 2MOWA 4Q96A 2WXRA 2XRZA 5HYAA 2PJQA 2DIWA 4APFA 2DCFA 3CK7A 1E7UA 4O4JE 2PL2A 5DQWA 3HKEE 3PUQA 1UN8A 2XPIA 4QXCB 3RO3A 3ULQA 3AVRA 2KINB 4XX5A 4H9PC 3UT4A 5T3RA 3MACA 1QUUA 4PK6A 2NW8A 4MLPA 1HTJF 4A56A 4I6EA 3ZIMA 1XNFA 3LEWA 5EK4A 4UV8B 1HS7A 4NUUA 3B7UX 4KVMA 3RIBA 3AS5A 2WXIA 4QHOA 3UUNA 3VKGA 4O4HE 4FHJA 1WAO1 4L1BA 4KBQA 3IEGA 3DPDA 3I9WA 4GZ5A 1EZ3A 4E7ZA 2HH7A 2KMFA 3RRMB 1NAFA 4CGVA 3N9LA 3ETVA 3FTVA 4I2ZA 3AS8A 3ZEFB 1ZHCA 1MMGA 4XZ4A 2W61A 3I1AA 1TJCA 2L6JA 3CVXA 2X6FA 2X6JA 4G23A 1H2TC 3N9QA 5HXRA 4EAHA 3CVLA 2JMHA 3N9PA 2BUGA 1FMWA 5LXTE 2WQ7A 2DHRA 2Y6XA 2L9BA 3G2TA 1D1CA 5LNKA 1JPLA 3FDHA 3KBTA 2KWIB 3MKDA 3N71A 3DBSA 2BVMA 2J9QA 4IE4A 4WWPA 3EUHA 4H9OC 4CEMA 3KV4A 5FTPA 3SWHA 3PE0A 5ADXL 2IC6A 1U3CA 2WVIA 2OA5A 5JR9A 3Q49B 1WR6A 3B57A 4UVAB 3RRNB 3JCKC 3ONXA 3GWHA 5HI7A 5JDNA 3KBUA 1TEZA 4FJYA 1HF8A 4I1MA 3TAXA 2AXZA 4U07A 2RD0A 5J2TE 2XGMA 1QNFA 2CG3A 2AVPA 2HPJA 3ZYKA 5LJNA 5J2UE 2XCCA 3VLEA 3C50A 4G2AA 2X66A 3LY8A 2LHRA 4KMCA 3NZUA 3PUJA 3PRZA 2C5KT 4RVBA 2SPCA 3ZN1B 2Y4UA 2BTDA 3AU5A 3NF1A 1OUVA 3C4ZA 3N5LA 2IC9A 2X6HA 3RO2A 3V5SA 1HG5A 4YFSA 3FWVA 3HVEB 1H6KA 1FVHA 4GZ6A 1OXZA 1MIVA 2CMRA 2CXFA 4PJNA 2WPVA 5EK2A 4UELA 4BY6A 4L7TA 4PK4A 2R59A 3ZMVB 3CSFA 4D10C 2JJ9A 4IIJE 3CHRA 4O2BE 3C98B 3CWZB 4ZS2A 3HR0A 2G0UA 4B89A 4YJ2E 2D0TA 1HCIA 4CGWA 3Q5XA 5JHBA 4W9RA 3OXFA 3L16A 3QWVA 1Y8MA 1WM5A 2EHOB 4DJAA 3N2KE 3MA5A 4C9BB 4BFRA 2IJGX 3O1JA 4ILHB 2A3DA 3MYVA 1LF8A 3C51A 1IHGA 4ILIA 4N5CA 2NW9A 2CWOA 3UUXB 1PY1A 4GYWA 1E8YA 4CT4A 5JQGE 2XPZA 3LDZA 2FO7A 2L8KA 2Y3AA 1LRZA 4UI9K 2IF4A 3ZGQA 3PUKA 3QJZA 5EKQD 4JEUA 3Q2MA 1JWGA 5A6CA 4ANVA 5CMWA 1HX8A 4UF0A 3D0TA 4R7LA 3FBZA 2CM0A 3CX6B 3IF8B 3ESKA 2K24A 4L2YA 4I6JA 4CI2B 1QQEA 3L09A 3FUKA 3LS8A 4AM9A 1IZNB 4KYOB 2P58C 3ZHEB 4GCNA 3FFLA 2JEKA 4ACLA 3KFWX 2DCPA 3ASGA 4YJ3E 3ETUA 3FTSA 4FU3A 3D9MA 1D0XA 3HL6A 4U8HA 3IBPA 3P8CD 4FJZA 5HAXA 2CE7A 5EX0A 2FEZA 3FXDB 4PFOA 3E0ZA 1IYGA 1LKXA 2VB6A 4PJJA 5DJQC 1PC2A 3LG7A 3O1IA 3I4GA 5HXSA 2J4DA 4BTAA 4KT6B 3RH3A 1WRDA 3D9IA 5LHGB 2W63A 3PEUB 4AVXA 3VTYA 3CVWA 4MKTA 3ZHEA 5KCMA 1WYBA 5EDSA 4AKLA 3FH8A 4ILGA 4U04A 1E8XA 3JQ0A 2JQQA 3S7DA 4KZ0A 4KUMB 2DI4A 4NACA 4GYYA 5CB4E 5FWQA 4ERRA 1Y6IA 2KCVA 3GA8A 1HFAA 2I1JA 5L3DB 1MIWA 4JEHA 3SRZA 5LX8A 2L0IA 3ZYMA 4GMJA 5FZRA 3FUNA 3TG5A 3H3AA 4OYSA 2XAQB 1N54A 3CLJA 5F3JA 1FVFA 2ZM0A 3PDNA 5DIZA 4E7SA 3LYAA 4UWKA 3J7Yq 5FY1A 3FUDA 4O4IE 4DI4A 4BWRA 1ZEEA 3P7IA 3L3PA 5FXVA 2Q7FA 4L9IA 4AQFA 3I3NA 3UPVA 1MMNA 3HKBE 2VGXB 1EYHA 3MXZA 2MYSA 3MK7C 1V9DA 2WXHA 4DPRA 4MS6A 4JHKA 4MHCA 1WYCA 4A3VA 4V1Av 1SA0E 3LY7A 3RYIE 3Q5MA 4M1PA 4JPSA 4AKIA 5J1GA 5JRCB 3CVRA 4EXTA 5FP3A 5HXCA 2XEVA 4BA9A 1D1AA 4HOTA 2LSKA 3APCA 4A55A 2NTYA 2YNQA 2X0LB 4EPZA 5A1LA 4HXIA 4AV7A 4L5GA 3C64A 3CR3A 3P2BA 4AKRB 4DNDA 4JA7A 4N3CA 4PNIA 2Z6EA 3RU0A 4X1IE 4U74A 4LUNU 5LCWC 4APOA 4DMVA 3FU6A 3FEYA 4CXXA 3IHRA 1UJKA 2I2OA 3ZRHA 3AA1B 4CXWA 3D9NA 4GOUA 1B89A 3OKQA 2Y48B 5AYWD 2KLQA 3QC9A 3VU7H 2KXPB 1FIOA 2M63A 4HE8A 2NWBA 2KWHA 1UJJA 3ZLIA 4XI9A 4Y6WA 2EQXA 4O6FA 2A72A 3SF4A 4HKAA 4HOSA 1YD8G 5JR9C 1KNZA 3R7RA 2HYZA 2NTXA 3PE4A 1VRBA 3TJPA 5CCMA 5BNWA 5T4YA 1NZNA 4EYYR 3JUIA 1OWPA 4A1SA 2EHOC 1E90A 3MJXA 1JUQA 4JA9A 5JJTA 2Q9QB 3IEEA 2UY1A 3KV9A 4TRQA 3RRWA 3IKOB 4Q94A 3PUGA 4U0SA 3UT8A 2JMKA 3EDTB 1HU3A 4XKCA 2CFUA 2DLRA 4PS3A 2VYIA 3CVPA 4GA2A 1ZKEA 1WY6A 5JREA 4C91A 2ZU6B 4HOUA 3FH7A 5LCYA 2VKOA 2VJ8A 3LFMA 2WQ6A 5G2NA 3G2VA 4EBAA 3MEKA 3D9OA 1SQMA 4CI1B 5L3FB 1MHQA 3CVVA 2X9HA 2ZLYA 1HH8A 3MV3B 3H37A 4V3IA 4A1GA 1A17A 1IJ6A 4FHKA 4OYJA 4K0RA 4YNDA 2Y8DA 1D0YA 1MNEA 4FLBA 2GRLA 4NRHB 1T98A 4GPKA 2X3MA 3QUJA 3ML8A 3E22E 4EECA 3AB3B 4IE6A 3HDXA 2FI7A 4I1OB 4ISTA 3QDNA 3QB2A 2LHNA 2PM7A 3FY4A 4EBAG 4AI6A 2LE8A 2IOLA 4HTEA 3LJCA 3T5VA 2C2LA 3T8MA 4J0UA 1G73A 3NBXX 3GMIA 3RYCE 4NURA 5FXXA 2IQCA 4GYSA 1ELRA 4XAXB 3CVNA 4U63A 3KS2A 3UTKA 3I5PA 3ZCIA 4PS7A 3TG4A 3AA0B 1BR4A 1HG2A 2W00A 4KP3C 5JDQA 3SHFA 2PFVA 4IDZA 2GW1A 4OVVA 3N9MA 4EIWA 5LGTB 3KEZA 2DWKA 4C0EA 5D0QD 1NA3A 3LJ3A 4GZCA 3AAIA 1VDYA 1UW4B 5BV1A 1YA0A 5L2LA 3CHQA 4Q69A 3ASHA 4ADZA 4F7AA 3HI2A 1FEWA 2GGFA 2E9XD 3OBVE 3MZKB 2NC9A 3FULA 2XTLA 5M72A 3AVSA 2I6HA 4CDMA 2B1EA 4X1YE 4P0BA 3U4TA 2KT9A 3WXXA 2NXPA 4HFGA 2YHEA 4GIWA 2BVLA 4X1KE 3SI5A 2V4LA 2IONA 2C5IT 1S0PA 4GZDA 3WAJA 5LBMA 4PUCA 4H9RC 2NW7A 3ZCJA 2C5JA 4EZ4A 3GZSA 5DQVA 3M65A 4FULA 2WMOA 5LHIB 5L3GB 3RJVA 3HA4A 3NRXA 4TZ4C 3ZN0B 1DNPA 3GW4A 4I55E 3ONLA 4WAFA 4G25A 3U3IA 3CHPA 3E08A 1MMDA 2CEAA 3K3NA 3CHSA 3AA6B 4JHRA 3Q5WA 3LBXB 4OHFA 3J9X1 1EPUA 4YVQC 2Q9QA 4JC8A 1KK7A 4TV8E 2J49A 3L17A 5AIJA 1HZ4A 3SZ7A 4QWNB 1HO8A 1EF1C 3PNTB 2D0UA 4L2LA 3QNKA 4WWNA 2E9XA 4HEAA 5BMVE 3WAKA 1WLXA 5JVDE 4GYRA 3EJNA 3OXGA 3O9XA 3RRUA 3IBEA 2VWAA 3A5XA 4QKNA 3ZC1A 5L3EB 2CHZA 3OYXA 2A5UA 4U0ZA 4U72A 4GCOA 4MBQA 4AY6A 3LY9A 1SHZC 4C90A 2LEHA 1FMVA 4L23A 3ZMTB 2I9CA 1VOMA 3MCXA 1UX5A 5A23A 2N2NA 4TN7B 5CCLA 2E2EA 2LNIA 4UWFA 3ZYLA 4AKHA 4AY5A 3ZEFA 5BUZA 4UEMA 2KATA 4F3VA 4QX8B 3N9NA 1ZBPA 2CG2A 3Q47B 4HGAA 3PREA 3QWPA 2LT3A 3LK42 1EDUA 4URKA 3DP7A 4WNDA 4C0MA 3KINB 4JHJA 3CX8B 2R5SA 4DBRA 4LERA 4ANWA 4UVBB 2ZMAA 5JDHA 2J1DG 2VKHA 3I0OA 2LAIA 2AXVA 5FMNA 2YK0A 4H9QC 1D1BA 4H9NC 2VASA 4HN9A 4WNFA 2XHEA 1BPOA 1SZ9A 3PUSA 2PQRA 5JJ7A 2MHKA 4TUUA 4JUYA 4TV3A 2AWIA 2K5BB 2WMNA 4FJOA 2JPFA 4UXNB 3UUMA 3FH5A 3CPZA 4CZZB 2RG8A 5KMGP 5J08A 2XCBA 4F1SA 3CSTA 3UX4A 4EOZB 1BR2A 4DMWA 3V5UA 3U66A 4RG6A 5LOZA 5EK3A 1OWAA 1UCUA 2OVFA 2X6KA 3UULA 1H19A 2E9XC 4I9CA 1E96B 2I1KA 3KVBA 4WWOA 2CFZA 4EZJA 4WUYA 2YINA 3Q15A 1US7B 3Q4AB 3U78A 2ODVA 3L6AA 3RYFE 3O4ZA 4YHJA 2OOEA 4WNKA 1YKHB 4AXPA 2V7JA 2IU1A 1Z3XA 4H7YA 1Z3YA 2KCLA 2X51A 2VQ2A 3GZ2A 4G11A 4I43A 3SFZA 4N39A 4MRUA 5G05C 5BT1A 3BQLA 4N3BA 4ZI2D 3I9YA 1NWMX 5FYMA 4ZI3D 3EIQC 1GW6A 4BSXA 2L3LA 4AQFC 2XPYA 3IHYA 3KD7A 3FU5A 2LSIA 3OYZA 4BX8A 1IQRA 3MKQA 4JZYA 2KC7A 5ENNA 3HIZA 5JJ6A 3RYHE 5FNVE 3PUAA 2WXJA 2W62A 2WB2A 3OJAA 4UV9B 5HXEA 4KZCA 3JC6C 2PZIA 4O4LE 2WXPA 4QXHB 2VGYA 1OWMA 4PJLA 2KZTB 5C2YA 4BX9A 2WM9A 4J8SA 1H2VC 4PW8A 3VLFA 5G05J 3ESLA 4Z8XA 4PAGA 3D9KA 5JHAA 4JEUB 5H6RB 4LEUA 4KVOA 3GN5A 4HVBA 1H2UA 5BV0A 3C4WA 4ILUA 1LVKA 3I4RB 2XASB 4I2WA 3PDYA 5LOVE 4CXYA 5BPPA 5ARGA 4FP7A 2R17C 4P09A 3LK2B 4G1TA 2PG8A 3N9OA 3JYSA 3E4BA 5LHHB 4WBNE 1UN9A 4ANUA 4NUVA 2D2SA 4BJMA 5JRCA 4ACKA 2CXLA 4H63H 4DVDA 3AU4A 4UF0B 2QY7A 3CX7B 2UXNB 3TKLB 2V26A 2HR2A 2WXGA 4G24A 3ZPOA 1MQSA 5F8PA 2CHWA 4KMOA 3MX3A 4OVUA 4OYKA 5GONE 3N2OA 1U3DA 2V5FA 4GA0A 3FEXA 2J07A 2ILRA 4J8FA 2VGXA 4AIFA 2KCKA 3ZC0A 2RP4A 5LYJE 5ANLA 5ARFA 3BQIA 3RRCA 3NZQA 4PK5A 2YU1A 2CXDA 3QK0A 4JW1A 5CA1E 3FB2A 2UXXB 1OWLA 2UWJG 2LSVA 3MZLB 2MBGA 3HKCE 4BAYB 2VK9A 4I1AA 3T8OA 5T8IA 1E7VA 4P29A 1D0ZA 1E8ZA 5E0OA 3G2WA 2WXNA 3UT5E 2X6IA 2M67A 4B6XA 3PNLB 1YKEB 4A3TA 2XGOA 4XIFA 4BT8A 4DBQA 3G2UA 3GYZA 4IE5A 3CHOA 5L3BB 2LSJA 4I50E 4UI9J 5FQ4A 3EVYA 2V7IA 2QFCA 4AOFA 3D3MA 4N2QA 3FTWA 4G26A 5LA6E 3C4XA 4PFPA 3MA9A 1X5BA 5KJNA 3ZMUB 2BZBA 4ZS3A 5LBQB 3PU3A 2UY1B 3CK8A 2Q9QC 4YLHA 1L5JA 3CVYA 3L08A 4TX5A 1H0AA 3S2AA 3N2GE 5AJDA 2X67A 1XGWA 3RC3A 3R7QA 4EZKA 3URZA 5C8YE 2IFUA 3S7FA 2XAHB 1QSDA 4ATGA 3IHVA 4IULA 4DLOA 3HYMB 3FU0A 1NA0A 2Q9QD 1Z6TA 3FTUA 3MKQB 2X9XA 2N9DA 5E76A 5LGUB 3CQXC 2X68A 3CMLA 3F2EA 4WW0A 4GYOA 4QXBB 3B13A 5LP6E 3B7SA 1SZAA 5L3CB 2LM9A 3CK9A 3FXEB 4AP2A 5J90A 3L54A 4UQYA 3ZMZB 2NSZA 5BW8C 1DVPA 3U64A 2L9QA 2XUEA 5EX3A 4RSYA 4KXKB 5FY0A 2X9WA 3ONKA 3QK6A 3S4UA 1P5QA 1HXIA 3BQKA 3B7TA 4PJMA 4FC8A 2XRYA 5IYZE 3SNXA 3I0QA 5LGNB 3ZMSB 4RG9A 2IOSA 3SGHA 2VKJA 4AKGA 3BG1B 3OAWA 2KZ7B 2FF4A 2WQHA 3RK6A 4GA1A 3PTRB 5LJMA 3ZVVA 4IHJE 2XAJB 2WSSV 2NP9A 4WNEA 4F53A 4PDXA 1FCHA 3C98A 2V1DB 2KNDA 3K9IA 2Y4TA 3DTOA 3AAAB 2C0LA 2L0TB 4ZOLE 4ISSA 4HFVA 2EHOD 3EDVA 2YQ8A 1UX4A 3FUJA 2P9BA 4CI3B 4J8DA 4GAAA 3ANWA 2V8SE 4WBOA 5HWYA 3QC1A 2VKDA 2K9AA 1JWFA 2MOZA 5G04J 2OVBA 3RPUA 4ANJA 4PH4B 3AS4A 3S7JA 5FQ7A 3TXMA 4TUYE 3T5XA 2ZM2A 1ZV4X 3PH0C 2CLYB 2YEVC 5TAOA 3U9WA 3SD5A 5KJLA 5CA0E 1KLXA 3RKOA 2LJLA 2AW6A 3FUIA 4CDRA 3MGBA 2LSGA 3LBXA 4O8SA 5FXWA 1UG3A 2H3RA 1YW0A 1MNDA 4MFRA 5LG4A 2A4ZA 3SBSA 4IN3B 4XE0A 4ZI7E 3AA7B 5G04C 2WWUA 3JQ1A 2LSYA 2J4BA 3BEEA 4XBFB 3RKVA 1PAQA 2WXKA 3FTZA 4U0UA 4CT0A 4I4TE 5D0OD 2LO6A 1QZ2A 5JDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLB A;  3G2W A;  2L0T B;  1HG5 A;  2DCP A;  1ELK A;  5CMW A;  1EYH A;  3G2V A;  1X5B A;  3ZYK A;  4GZC A;  1HX8 A;  4FU3 A;  1LF8 A;  2DIW A;  1UJJ A;  1VDY A;  1UJK A;  3D9O A;  3D9K A;  3D9M A;  4JXT A;  4NAC A;  3ZYQ A;  3G2T A;  3ONK A;  5J08 A;  3D9N A;  1SZ9 A;  1HG2 A;  3D9J A;  1EDU A;  1PY1 A;  1JPL A;  1HFA A;  3D9I A;  3D9L A;  3G2U A;  4HFG A;  2V8S E;  1MHQ A;  3G2S A;  5LP0 A;  3D9P A;  1SZA A;  3LDZ A;  4AVX A;  1INZ A;  3RRU A;  1JUQ A;  2BF0 X;  5LOZ A;  1JWF A;  2KM4 A;  2L0I A;  3ZYM A;  1H0A A;  2MOW A;  4Q96 A;  5CMY A;  3ZYL A;  1HF8 A;  2QY7 A;  2LO6 A;  4GZD A;  4Q94 A;  3CLJ A;  3ONL A;  1DVP A;  1JWG A;  1XGW A; 
#chains in the Genus database with same CATH topology
 3UKU G;  1Y64 B;  5DAB A;  1KFY A;  1K8K G;  2V7M A;  1LVF A;  3NOC D;  2XHE B;  2JLB A;  3CEQ A;  4HLE A;  1U4Q A;  2X38 A;  3UUX A;  4P0A A;  5ENP D;  3BK9 A;  4HWF A;  2BED A;  3HVE A;  3S7B A;  1TJF A;  4EGW A;  4JLE A;  2HE0 A;  3AG3 E;  2KM4 A;  4YTP A;  4UWH A;  3UMV A;  1Z0P A;  2E5V A;  4QH5 A;  2W0G A;  2XQ5 A;  2VQE T;  2HPL A;  5CRU A;  5FQ8 A;  4H9S E;  1IBM T;  2VVN A;  3T8K A;  3CKD A;  3HHM A;  2V7L A;  4J2C A;  2E5L T;  3ASF A;  4J6I A;  3LK3 B;  3FBL A;  1BI8 B;  3PS6 A;  3ABM E;  5CED B;  3P1U A;  4CRW A;  4ME2 A;  4LCT A;  5KJM A;  1W9R A;  2ETA A;  1AP7 A;  4CDN A;  5FQ6 A;  4GML A;  4DX1 A;  3RX6 A;  2M6I A;  5CMY A;  3BQO A;  4DUI A;  2H89 A;  4AJW A;  4ZI3 C;  4MLK A;  5FJY A;  2B0O E;  3UIP C;  5HXH A;  1IXV A;  2K3W A;  1HS6 A;  1MIY A;  4B3R T;  4FA6 A;  2VTB B;  2FUL A;  4NXM T;  2GRN B;  2C0S A;  2EHO A;  2HM8 A;  4IDO A;  3NZP A;  4CZ2 D;  4J8E A;  4H63 V;  2XM1 A;  4ZI2 C;  1O3X A;  1H6P A;  1MMA A;  1OWN A;  1OED E;  2BS3 A;  2J09 A;  4B0Z A;  5JH7 E;  4IE0 A;  2J08 A;  2A5E A;  2LOS A;  3RC8 A;  4CYM D;  3FHN A;  3VTX A;  4CCA A;  3SO8 A;  2A2F X;  3KDS E;  1KT1 A;  2OV9 A;  4XZC A;  2H6I A;  4HRM B;  3R9M A;  4JL0 A;  3UU4 A;  4DR5 T;  4AXH A;  4ILA A;  2WY2 A;  1N33 T;  1KT0 A;  4BJN A;  4DLQ A;  3BUA A;  3TGO A;  4ZZB A;  4OAV B;  2OV8 A;  2VSX E;  5EYP F;  2XAG B;  5JDF A;  2V5Q C;  2P9L G;  3SBT B;  5AJL A;  4BT9 A;  3F57 A;  3AAA C;  4GU5 A;  3Q9D A;  2GRM A;  2XQ0 A;  4DO0 A;  2XJ7 A;  4KBM B;  3APD A;  1YQ4 A;  5ENS D;  3SOL A;  4DV2 T;  4GTV A;  3V79 K;  3FUF A;  4UQZ A;  3LVQ E;  5AQB A;  2IY0 C;  1XDO A;  4E6H A;  4QFV A;  2H7O A;  4IYP A;  3VR9 A;  4E85 A;  2JRK A;  4LMJ A;  4XI0 A;  2LM2 A;  3FP3 A;  2PBI A;  2C0M A;  4GZ3 A;  3D9J A;  3U3W A;  3D9L A;  3ZN3 A;  3BG0 B;  4WNG A;  2WBL A;  2UXC T;  3G2S A;  4G2V A;  3CVU A;  3VHL A;  1OCR E;  1INZ A;  1ELW A;  3NZS A;  5A7D B;  4P1N A;  4CQI A;  2P2C P;  4JI8 T;  4AEZ C;  5FY7 A;  5M4Y A;  2VSN A;  2WCA A;  1SUM B;  5AQS B;  2CLY C;  5FT9 A;  2CHX A;  2E8I A;  2PM6 A;  3DSS A;  5LCW J;  3KV6 A;  3FTX A;  2ACX A;  4I9E A;  4UIG A;  1W0A A;  4UI9 C;  4XKB A;  3CGH A;  2K48 A;  4EZH A;  5HCM A;  2BF0 X;  4ATZ D;  2CWY A;  2E9X B;  4GK5 E;  2E0I A;  2WS3 A;  2LOP A;  3EDU A;  3W15 B;  5H6Q B;  4JI0 T;  3F31 A;  1W3B A;  1AJ3 A;  3LKU A;  2DNX A;  1V55 E;  3IV0 A;  1SA4 A;  3HKD E;  1SW6 A;  2V7K A;  1BR1 A;  4EQF A;  2WXO A;  4LRZ A;  3ZYQ A;  5AEN A;  3SS1 A;  4ASK A;  4FLH A;  3SFY A;  2GRO B;  3QOU A;  5EZY E;  2KXP C;  2XQY A;  4UWL A;  2HO1 A;  4AQG A;  2NOX A;  4XEI G;  4N3A A;  3R6N A;  1FJG T;  2GK9 A;  4A97 A;  4F6R C;  2AXU A;  3NRY A;  4JEH B;  4NXN T;  4B8C B;  1QLB A;  5FXZ A;  3IXE A;  2ODU A;  3LPZ A;  1S35 A;  2ACZ A;  3LXU X;  4JXT A;  3W9F A;  4N78 D;  2KZT A;  3CQC B;  2QGS A;  4LSZ E;  1S94 A;  3DJB A;  3WG7 E;  4DR2 T;  1I94 T;  4B94 A;  2WZI A;  5KJK A;  3UQ3 A;  1SVX A;  3UUB A;  3O4X E;  3ML9 A;  5ETW A;  3JC6 D;  5AQN B;  1NFI E;  1TNU A;  5JDL A;  2OLT A;  4M3O A;  3PZD A;  5CHE E;  3PEV B;  5CER B;  3OTO T;  3PZ2 A;  1QBQ A;  4UWG A;  1E8W A;  4IT4 A;  3C3Q A;  4J8Y A;  3ZU7 B;  2PQN A;  3ASO E;  2LSU A;  4DI3 A;  2F0Y A;  3FZL B;  1U5P A;  3ZJ2 A;  5LP0 A;  4K5C A;  2FBN A;  3PU8 A;  4K0U A;  5LFA A;  3ABK E;  1IQU A;  5FZQ A;  4UVC B;  2R2L A;  2YHC A;  3FU3 A;  4L9P A;  4JVS A;  3CVQ A;  5KNG A;  4FI5 A;  1OWO A;  3ENE A;  3ZW3 A;  3NQP A;  5G55 A;  5KWD A;  3R84 B;  4YVO A;  2WAU A;  4YXD A;  4JYA T;  4BTB A;  1ZU2 A;  4OK0 A;  3L39 A;  2WB5 A;  5ABE A;  5E75 A;  5ABF A;  3CQG B;  5ANR A;  3TWU A;  1OED C;  4LF6 T;  3EIJ A;  3TLW A;  3AE9 A;  1FT1 A;  4N2S A;  1H7C A;  2BG9 E;  2EIJ E;  2VL8 A;  2R05 A;  3MJW A;  4TV9 E;  2N1G A;  3NB2 A;  2RA1 A;  2DVW A;  4JBW F;  5HWX A;  3ONL C;  5L4E A;  1IAP A;  5CRV A;  3J5P A;  4OFZ A;  2WXF A;  4PS8 A;  2JIW A;  2DWG A;  4DR7 T;  4O2A E;  1E7P A;  2RPA A;  3UKR G;  4GK0 E;  2VTB A;  1NP7 A;  1X79 A;  3K8P C;  5FKY A;  3PUX F;  4EEB A;  4X8Q A;  3OXL A;  3OTN A;  3PE3 A;  1YCS B;  3TL5 A;  4HOR A;  2XPK A;  4G63 A;  3B7R L;  3EHM A;  5AFU L;  1BR0 A;  1IJ5 A;  2V0P A;  4EB6 E;  3CHM A;  1YMP A;  2XGS A;  2XEH A;  4QX7 B;  3ASD A;  2WXM A;  4H7X A;  4DK5 A;  4TXR A;  3FHE A;  2QA7 A;  2ZGG A;  2RFA A;  3E32 A;  2ZM8 A;  2IW5 B;  4CN6 A;  4Y6C A;  5DBK A;  1XDP A;  3CKC A;  1LD8 A;  5KX5 E;  4GB9 A;  4EYU A;  4EHM A;  2VSY A;  3KV5 A;  2MTQ A;  3AE1 A;  3FTY A;  2YDQ A;  4HOQ A;  1KEY A;  5C1D A;  3G06 A;  4IGU A;  4ZHB A;  2XQA A;  2MRI A;  3WI3 A;  2H6F A;  4X20 E;  3QAQ A;  4JI7 T;  5JR9 B;  4EZL A;  3VLD A;  2WXL A;  1N52 A;  2OND A;  3FUM A;  4ANX A;  3QAR A;  3VKH A;  1B7T A;  1FPP A;  2QYJ A;  4I43 B;  3ZPJ A;  1HNZ T;  1Y01 A;  3GZ1 A;  1HE8 A;  4NQ0 A;  3MV2 B;  3AAE B;  3CIA A;  4B8A A;  3UT7 A;  4I17 A;  2VSO E;  1G8X A;  3R9A B;  3CKB A;  2WP9 A;  3TWW A;  4FAD A;  3JAE A;  3L13 A;  5AQP B;  3CV0 A;  4GPM A;  5KNH D;  4MAL A;  5HQ8 A;  2H7V C;  3EHN A;  1TNY A;  3APF A;  4LNG A;  3L22 A;  4ABN A;  4K0K T;  4IRU A;  3FUE A;  4HS2 A;  3D9P A;  4GTO A;  4K5A B;  2HHH T;  3ASN E;  4LG6 A;  2I59 A;  2D5U A;  4U31 A;  4Z90 A;  3FUH A;  3GN5 B;  3TWV A;  1OED A;  2CCQ A;  5AQH B;  3L82 A;  3MKR A;  4DV7 T;  3UFE A;  3K3Q C;  1ELK A;  2DBA A;  3PVL A;  4K03 A;  4ILB A;  2BDE A;  2RKK A;  3RIA A;  4IE7 A;  3PUR A;  3TLU A;  3LCA A;  5KDM C;  2Y1L E;  3ZXS A;  5FZS A;  3ZJ1 A;  2ZXW E;  1CUN A;  2CBI A;  2NR4 A;  4X66 T;  3KVA A;  3TXN A;  1NL4 A;  2UUA T;  5IUX A;  2XQ7 A;  2LAH A;  2IAK A;  4GTQ A;  5IHY A;  2QZA A;  3K3O A;  4ZHQ E;  1VCS A;  2X9Y A;  3O1H A;  3KAE A;  3QWW A;  4L0R A;  1KZP A;  4UQX A;  3ZFW A;  4I6G A;  3LVR E;  5JDM A;  3O48 A;  3DXK G;  2CA5 A;  2XY8 B;  2WXQ A;  1E1H B;  3QKY A;  1CHU A;  3ANW B;  4DR4 T;  1Q2Z A;  2ES0 A;  4DX5 D;  2YU2 A;  1N4Q A;  3JUE A;  2XAF B;  2MOW A;  4Q96 A;  2WXR A;  2XRZ A;  5HYA A;  4U7I A;  1K1A A;  4TUM A;  2PJQ A;  2DIW A;  4APF A;  3RQU A;  2DCF A;  3CK7 A;  1E7U A;  3ZUV B;  4O4J E;  2PL2 A;  5DQW A;  3RQW A;  2BKN A;  3HKE E;  4TNW A;  3PUQ A;  4ZXL A;  3ONJ A;  1UN8 A;  2XPI A;  2QC9 A;  4QXC B;  3RO3 A;  2FJE A;  4KX6 A;  3ULQ A;  4JI2 T;  3JXI A;  3AVR A;  2KIN B;  4XX5 A;  3AG2 E;  4H9P C;  3AEF A;  3UT4 A;  1O5M A;  5T3R A;  3MAC A;  3ZT6 A;  4BES A;  1QUU A;  4PK6 A;  2NW8 A;  4MLP A;  1HTJ F;  3T1H T;  3AE2 A;  4A56 A;  2LUH A;  4I6E A;  4DV5 T;  3ZIM A;  5AQF B;  1XNF A;  3LEW A;  5EK4 A;  4UV8 B;  1HS7 A;  4NUU A;  1JCQ A;  3B7U X;  4KVM A;  3EU9 A;  3RIB A;  3AS5 A;  2RFM A;  3RSE G;  2WXI A;  4QHO A;  3UUN A;  3VKG A;  4O4H E;  4FHJ A;  3UU8 A;  3AE3 A;  1WAO 1;  4L1B A;  1N32 T;  4KBQ A;  3IEG A;  3DPD A;  3I9W A;  4GZ5 A;  2Y0B G;  3UQ7 A;  1EZ3 A;  4E7Z A;  2HH7 A;  2KMF A;  4LMK A;  3RRM B;  3AG1 E;  2LKG A;  1T8B A;  3PJA J;  1NAF A;  4CGV A;  3N9L A;  3ETV A;  3FTV A;  2OEV A;  4I2Z A;  1XZY A;  2BKO A;  3AS8 A;  3ZEF B;  1ZHC A;  1MMG A;  4XZ4 A;  2W61 A;  3I1A A;  3SFE A;  1TJC A;  2L6J A;  2CBJ A;  1N11 A;  3CVX A;  5ENT D;  2X6F A;  2I0M A;  2X6J A;  4G23 A;  5L4H A;  1KNP A;  1H2T C;  3N9Q A;  5AQT B;  5HXR A;  4EAH A;  3CVL A;  2JMH A;  3C3O A;  4F6R D;  2WDR A;  3N9P A;  2BUG A;  1FMW A;  5LXT E;  5AQG B;  4ZFH A;  2WQ7 A;  2DHR A;  4JI5 T;  2Y6X A;  2L9B A;  2BBH A;  3G2T A;  1D1C A;  5LNK A;  1JPL A;  3FDH A;  3KBT A;  2X0Y A;  2KWI B;  3MKD A;  3N71 A;  3DBS A;  4WZX A;  1BU9 A;  2BVM A;  2EIN E;  2J9Q A;  4IE4 A;  4WWP A;  3EUH A;  4H9O C;  4CEM A;  4CN4 A;  3UU6 A;  5ENO D;  3KV4 A;  5FTP A;  4A98 A;  3SWH A;  2VQF T;  3PE0 A;  5BXO A;  2DYS E;  5ADX L;  3D9H A;  3Q75 A;  2IC6 A;  1U3C A;  2WVI A;  2OA5 A;  5JR9 A;  3Q49 B;  1WR6 A;  3B57 A;  2M6B A;  3NWI A;  4UVA B;  3RRN B;  3JCK C;  5FIO A;  3ONX A;  3GWH A;  2GRR B;  5HI7 A;  5JDN A;  5HS0 A;  3KBU A;  1TEZ A;  5FVK A;  1MZC A;  2AJA A;  4FJY A;  1HF8 A;  4I1M A;  3TAX A;  1J1J A;  2AXZ A;  4U07 A;  2RD0 A;  3PV0 F;  5J2T E;  2XGM A;  1NEN A;  4DUZ T;  1QNF A;  2CG3 A;  2AVP A;  2HPJ A;  3ABV A;  3ABL E;  3ZYK A;  5LJN A;  3H3M A;  5J2U E;  2XCC A;  3VLE A;  3C50 A;  5ABG A;  4G2A A;  2X66 A;  3LY8 A;  2LHR A;  4KMC A;  3NZU A;  3PUJ A;  3PRZ A;  2C5K T;  4RVB A;  3FZF B;  2SPC A;  3ZN1 B;  3UM0 A;  5LG3 A;  2Y4U A;  2BTD A;  3AU5 A;  4TXQ A;  2QRX A;  3UIN C;  3NF1 A;  1OUV A;  1IHB A;  3C4Z A;  3N5L A;  2IC9 A;  2X6H A;  4YDW A;  4KI0 F;  4JI4 T;  3RO2 A;  3V5S A;  3ULE G;  1HG5 A;  4YFS A;  3FWV A;  1W0B A;  1H6K A;  3HVE B;  3Q79 A;  2WWV A;  1FVH A;  4N5Q A;  3ZSS A;  3HXD A;  4GZ6 A;  1OXZ A;  1MIV A;  2CMR A;  2CXF A;  5C3J A;  3Q7A A;  4PJN A;  2JQK A;  1IBL T;  3B5M A;  2WPV A;  1N94 A;  5EK2 A;  4UEL A;  4BY6 A;  4L7T A;  5AQL B;  4PK4 A;  2R59 A;  4HWD A;  3ZMV B;  4ZEY A;  4TXP A;  4NIK A;  3CSF A;  2CRB A;  3CIR A;  2JJ9 A;  4IIJ E;  4D10 C;  3CHR A;  4O2B E;  3C98 B;  3CWZ B;  4ZS2 A;  4HB5 A;  3HR0 A;  2G0U A;  2XZD G;  2DZO A;  4YJ2 E;  2D0T A;  1X81 A;  4B89 A;  1HCI A;  4CGW A;  3Q5X A;  2XQ8 A;  4W9R A;  5JHB A;  2A9U A;  3OXF A;  3DEO A;  1OT8 A;  3L16 A;  2IML A;  3QWV A;  1Y8M A;  1WM5 A;  2EHO B;  4DJA A;  3N2K E;  3MA5 A;  4C9B B;  4BFR A;  3ZT5 A;  5CBO A;  2IJG X;  3O1J A;  4ILH B;  2A3D A;  2W66 A;  3MYV A;  1LF8 A;  3C51 A;  4HFC A;  1IHG A;  3VRB A;  4ILI A;  4N5C A;  2NW9 A;  1IBK T;  2CWO A;  3UUX B;  1PY1 A;  4GTR A;  3TLV A;  4GYW A;  1E8Y A;  4CT4 A;  5JQG E;  1JCR A;  2ETC A;  2XPZ A;  2FO7 A;  2L8K A;  3LDZ A;  2BS4 A;  2Y3A A;  1LRZ A;  4UI9 K;  2IF4 A;  3ZGQ A;  3PUK A;  3QJZ A;  3V31 A;  2P9P G;  4O1O A;  5EKQ D;  3UU5 A;  4JEU A;  2JQ9 A;  3Q2M A;  1JWG A;  3K1S A;  5A6C A;  1TYQ G;  2UUB T;  4ANV A;  5CMW A;  1XMO T;  4HBD A;  3ZT7 A;  1HX8 A;  4UF0 A;  4HRN A;  3D0T A;  5JA4 D;  4R7L A;  3FBZ A;  2CM0 A;  2FBW A;  2WU5 A;  3TWT A;  4NIQ A;  3CX6 B;  3IF8 B;  3ESK A;  2K24 A;  4L2Y A;  3PUV F;  4I6J A;  4CI2 B;  3OVU A;  1QQE A;  3L09 A;  4X64 T;  3FUK A;  3LS8 A;  4AM9 A;  1IZN B;  4KYO B;  2P58 C;  3ZHE B;  4GCN A;  3FFL A;  2JEK A;  1RZ4 A;  2OEW A;  4ACL A;  3KFW X;  2DZN A;  2DCP A;  3ASG A;  4YJ3 E;  3ETU A;  2V6Y A;  2J62 A;  3FTS A;  2FJD A;  4FU3 A;  3D9M A;  4JI1 T;  1D0X A;  3HL6 A;  4U8H A;  3IBP A;  3P8C D;  4DR1 T;  4FJZ A;  2VL0 A;  5HAX A;  2CE7 A;  4TWH A;  5EX0 A;  3Q7F A;  2FEZ A;  4C48 B;  3FXD B;  4PFO A;  4AQY T;  5F5W A;  1TN6 A;  3HXE A;  3E0Z A;  1IYG A;  1LKX A;  2VB6 A;  4PJJ A;  5DJQ C;  3DPY A;  1PC2 A;  3LG7 A;  4HWI B;  3QB5 A;  3O1I A;  3I4G A;  5HXS A;  4DR3 T;  2J4D A;  4BTA A;  2B76 A;  4KT6 B;  3RH3 A;  1WRD A;  3ZNG A;  3D9I A;  1XMQ T;  4UUC A;  5LHG B;  2W63 A;  3PEU B;  4AVX A;  3VTY A;  3CVW A;  4MKT A;  1WCR A;  2W4X A;  2H88 A;  3ZHE A;  5KCM A;  1WYB A;  4JI6 T;  5EDS A;  3X2Q E;  3EU5 A;  4AKL A;  3FH8 A;  4KHP T;  4ILG A;  4U04 A;  1E8X A;  3JQ0 A;  2JQQ A;  3AEA A;  3S7D A;  4KZ0 A;  4KUM B;  2DI4 A;  4NAC A;  5EYL A;  1OCO E;  5CB4 E;  2XS1 A;  4GYY A;  5FWQ A;  4ERR A;  1Y6I A;  2KCV A;  3GA8 A;  1HFA A;  2I1J A;  5L3D B;  4HFB A;  3NVO A;  1MIW A;  4JEH A;  3SRZ A;  5LX8 A;  2L0I A;  2F8X K;  3ZYM A;  4GMJ A;  5FZR A;  3FUN A;  3TG5 A;  3H3A A;  4OYS A;  2XAQ B;  3UFG A;  1N54 A;  3CLJ A;  4B93 B;  5F3J A;  1FVF A;  2ZM0 A;  1WG0 A;  3PDN A;  5DIZ A;  4E7S A;  4BSZ B;  2EIL E;  2DYR E;  3LYA A;  4UWK A;  2UU9 T;  3J7Y q;  4LFB T;  4LNU D;  2XQ6 A;  2JQH A;  5FY1 A;  3FUD A;  3RIF A;  4O4I E;  4DI4 A;  4BWR A;  1HR0 T;  4RQI A;  1ZEE A;  3P7I A;  3L3P A;  4IDN A;  5IY5 E;  5FXV A;  3UU3 A;  4YTM A;  4L9I A;  4AQF A;  2Q7F A;  3I3N A;  3UPV A;  1MMN A;  3HKB E;  1OCC E;  2VGX B;  2BG9 A;  1EYH A;  5HEU A;  1N0R A;  3MXZ A;  5AQJ B;  2D9D A;  4JI3 T;  2MYS A;  3MK7 C;  2BBJ A;  1V9D A;  2ETB A;  4X5T A;  3C72 A;  2WXH A;  4DPR A;  4MS6 A;  4JHK A;  5AQ7 A;  4MHC A;  1WYC A;  5HEO A;  4A3V A;  1D8E A;  4V1A v;  1WDY A;  1SA0 E;  3LY7 A;  3RYI E;  3Q5M A;  4M1P A;  4JPS A;  2PTF A;  3P4W A;  4AKI A;  5J1G A;  4EXT A;  5JRC B;  3CVR A;  5FP3 A;  5HXC A;  3HXC A;  2XEV A;  2OCC E;  1OCZ E;  4BA9 A;  1D1A A;  4HOT A;  2LSK A;  3APC A;  4Z91 A;  4A55 A;  2NTY A;  4J7W A;  2DL1 A;  2YNQ A;  3EHQ A;  2X0L B;  5ENQ D;  4EPZ A;  5A1L A;  4HXI A;  3SFZ A;  2IEJ A;  2X0H A;  4AV7 A;  4L5G A;  3C64 A;  3CR3 A;  1HNW T;  3P2B A;  5AN8 A;  4AKR B;  4DND A;  4JA7 A;  4N3C A;  4PNI A;  2Z6E A;  3RU0 A;  1OED B;  4X1I E;  1N4P A;  4U74 A;  4LUN U;  5L47 A;  5LCW C;  4APO A;  4DMV A;  3FU6 A;  3UIO C;  3FEY A;  5AAO A;  4CXX A;  3EAM A;  3IHR A;  1UJK A;  2R02 A;  2I2O A;  3ZRH A;  3AA1 B;  3UQ4 A;  3P4R A;  4CXW A;  3D9N A;  5CEA A;  1BD8 A;  1S64 A;  4GOU A;  3EI0 A;  1IKN D;  1B89 A;  3TWR A;  3OKQ A;  2Y48 B;  5AYW D;  2KLQ A;  3QC9 A;  3VU7 H;  3DSW A;  1FT2 A;  5AQU B;  2KXP B;  2P9K G;  1FIO A;  3AE5 A;  2M63 A;  3KEA A;  3P4S A;  2XEN A;  1S63 A;  1HX1 B;  4HE8 A;  2NWB A;  2KWH A;  1UJJ A;  3ZLI A;  4XI9 A;  1N4S A;  4Y6W A;  2EQX A;  4O6F A;  2A72 A;  3SF4 A;  4HKA A;  4HOS A;  1YD8 G;  5JR9 C;  1KNZ A;  3R7R A;  5D66 A;  1OXJ A;  2EIK E;  2HYZ A;  1L0V A;  2NTX A;  2BKP A;  3E30 A;  1VRB A;  3PE4 A;  3TJP A;  4K5B A;  5CCM A;  5BNW A;  5T4Y A;  1NZN A;  4EYY R;  5AQK B;  3AEC A;  3JUI A;  1OWP A;  2BS2 A;  2VVS A;  4A1S A;  2EHO C;  1E90 A;  3MJX A;  3RIU C;  4M7C A;  1S70 B;  1JUQ A;  1MX4 A;  4JA9 A;  5JJT A;  2BG9 C;  5AQQ B;  3DWL G;  2Q9Q B;  3DSV A;  4YSX A;  3IEE A;  2YDR A;  2UY1 A;  3KV9 A;  4TRQ A;  3RRW A;  3IKO B;  4Q94 A;  3PUG A;  4U0S A;  3UT8 A;  3ULY A;  2JMK A;  4LF4 T;  4X62 T;  3HXB A;  3EDT B;  1HU3 A;  1KNR A;  1GQE A;  4XKC A;  2GRP B;  4U96 D;  3EAB A;  1O1S A;  4A63 B;  1KPS B;  2CFU A;  3RAU A;  4GMR A;  2DLR A;  4PS3 A;  4IL9 A;  2VYI A;  3CVP A;  5CEC B;  4GA2 A;  1ZKE A;  2KBX A;  1WY6 A;  5JRE A;  4C91 A;  4QH1 A;  2ZU6 B;  3E34 A;  4HOU A;  3FH7 A;  2XEE A;  5LCY A;  2W2U A;  3NAW A;  3RHW A;  2VKO A;  2VJ8 A;  3LFM A;  2WQ6 A;  5G2N A;  3G2V A;  4EBA A;  3DXM G;  3MEK A;  3D9O A;  3CK6 A;  1SQM A;  4CI1 B;  2P9U G;  5L3F B;  1DU2 A;  1MHQ A;  3CVV A;  2X9H A;  2ZLY A;  1HH8 A;  3MV3 B;  3H37 A;  4V3I A;  4A1G A;  4RLY A;  1A17 A;  2F4V T;  1IJ6 A;  3QNU A;  3LJN A;  4FHK A;  4OYJ A;  4K0R A;  4YND A;  4YDY A;  1TN8 A;  2Y8D A;  5ABF B;  1D0Y A;  1MNE A;  4FLB A;  2GRL A;  4NRH B;  1T98 A;  3W9G A;  1RW2 A;  4GPK A;  2X3M A;  3UM3 A;  3RLF F;  3QUJ A;  3ML8 A;  5AQR B;  3E22 E;  4EEC A;  1HNX T;  3SY2 A;  3AB3 B;  4IE6 A;  3HDX A;  2FI7 A;  2ZIR A;  4IST A;  3QDN A;  4I1O B;  3QB2 A;  2LHN A;  2PM7 A;  3FY4 A;  3AXJ A;  4EBA G;  4AI6 A;  2LE8 A;  2IOL A;  4HTE A;  3LJC A;  3T5V A;  2C2L A;  3T8M A;  3V2X A;  4J0U A;  1G73 A;  3NBX X;  4YSY A;  3GMI A;  3RYC E;  4NUR A;  1N4R A;  4BET A;  3AE4 A;  5KBA A;  5FXX A;  3C5R A;  2IQC A;  4GYS A;  1ELR A;  4XAX B;  1YQ3 A;  3CVN A;  4U63 A;  3KS2 A;  3UTK A;  3I5P A;  3ZCI A;  4PS7 A;  2GRQ B;  1QYM A;  3TG4 A;  4JV5 T;  3AA0 B;  1BR4 A;  3TLT A;  1HG2 A;  2W00 A;  4I0U A;  4KP3 C;  5JDQ A;  3SHF A;  2PFV A;  4IDZ A;  2GW1 A;  4OVV A;  3N9M A;  4EIW A;  5LGT B;  3KEZ A;  4LML A;  4OX9 T;  4GTT A;  2DWK A;  4U2Y A;  5AQO B;  1N36 T;  4C0E A;  2V8S V;  4LF5 T;  5D0Q D;  1NA3 A;  3LJ3 A;  4GZC A;  2AE9 A;  3AAI A;  3RIU A;  1VDY A;  4DRX E;  1UW4 B;  5BV1 A;  1YA0 A;  5L2L A;  2H6H A;  3CHQ A;  5ITZ F;  4Q69 A;  1DCE A;  3ASH A;  4ADZ A;  4F7A A;  3HI2 A;  1FEW A;  1TN7 A;  2GGF A;  2QYW A;  2E9X D;  3OBV E;  4HFE A;  3VRA A;  1MX2 A;  3AEG A;  4HNA D;  3MZK B;  3AED A;  2NC9 A;  4GKJ T;  3FUL A;  2XTL A;  3TWS A;  2LXL A;  5M72 A;  2XS8 A;  4COF A;  3AVS A;  2I6H A;  4CDM A;  2B1E A;  1V54 E;  4X1Y E;  2V6X A;  4P0B A;  1LTX A;  3U4T A;  2KT9 A;  3RF1 A;  4DV3 T;  5HEJ A;  3WXX A;  2NXP A;  4HFG A;  2JAB A;  2YHE A;  4GIW A;  5B1B E;  2BVL A;  4X1K E;  3SI5 A;  2V4L A;  5HRY A;  2F8Y A;  2ION A;  2C5I T;  1S0P A;  4GZD A;  3WAJ A;  5LBM A;  4PUC A;  2YDS A;  4H9R C;  2NW7 A;  3VR8 A;  3ZCJ A;  2C5J A;  5EIB E;  4EZ4 A;  2LRK A;  3GZS A;  5DQV A;  3M65 A;  4FUL A;  2WMO A;  3UM2 A;  5LHI B;  5L3G B;  5BXU A;  3RJV A;  3RI5 A;  3L9T A;  3HA4 A;  3NRX A;  4TZ4 C;  3ZN0 B;  1DNP A;  1BLX B;  3GW4 A;  3Q78 A;  5LMN T;  4B3M T;  5J0Z A;  4IRE A;  2DWZ A;  4ILC A;  4I55 E;  2LLY A;  3ONL A;  3JAD A;  4WAF A;  4G25 A;  1LD7 A;  2WDQ A;  3U3I A;  3CHP A;  3J5Q B;  3E08 A;  1MMD A;  2CEA A;  4HI9 A;  3K3N A;  5EN5 D;  3CHS A;  5AQI B;  3AA6 B;  4JHR A;  3Q5W A;  3LBX B;  4OHF A;  3J9X 1;  2YOE A;  5IWA T;  1J5W A;  1EPU A;  4YVQ C;  3ZKR A;  4CN1 A;  2Q9Q A;  4JC8 A;  1KK7 A;  1BI7 B;  4TV8 E;  2J49 A;  3L17 A;  5AIJ A;  1HZ4 A;  1DCQ A;  4QWN B;  4X65 T;  3SZ7 A;  1HO8 A;  1EF1 C;  5EIL A;  3PNT B;  1MX6 A;  2D0U A;  2CPT A;  1N0Q A;  4L2L A;  2P9N G;  1NI1 A;  2LRL A;  3QNK A;  3P50 A;  3SFD A;  2J8S D;  4WWN A;  3FZM B;  2E9X A;  4HEA A;  2YKS A;  5KXJ A;  5BMV E;  5CGM A;  2FJA A;  3WAK A;  4EED A;  3P4P A;  1WLX A;  5JVD E;  4GYR A;  3T1Y T;  3EJN A;  3OXG A;  3O9X A;  3RRU A;  3IBE A;  5JMN D;  3FZH B;  2VWA A;  3A5X A;  4QKN A;  2UXD T;  3ZC1 A;  1M7K A;  5L3E B;  3OYX A;  4HFD A;  2A5U A;  2CHZ A;  4U0Z A;  4MBG A;  4U72 A;  4GCO A;  4MBQ A;  2XZT G;  4AY6 A;  3LY9 A;  1SHZ C;  4Q25 A;  4C90 A;  2LEH A;  1FMV A;  4L23 A;  3ZMT B;  2I9C A;  1VOM A;  3MCX A;  1UX5 A;  5A23 A;  2N2N A;  4TN7 B;  5CCL A;  2E2E A;  4GTM A;  4HWC A;  2LNI A;  4UWF A;  3ZYL A;  3EHZ A;  4AKH A;  4AY5 A;  3UTM A;  3AE8 A;  3ZEF A;  3ZXP A;  5BUZ A;  4UEM A;  3Q9U C;  2KAT A;  4F3V A;  4QX8 B;  3N9N A;  4YT0 A;  1ZBP A;  2CG2 A;  3Q47 B;  4HGA A;  5AQM B;  3PRE A;  3UXG A;  4LF9 T;  3QWP A;  2LT3 A;  1YXR A;  2V5C A;  3LK4 2;  1EDU A;  3JXJ A;  3DP7 A;  4WND A;  4C0M A;  4URK A;  3KIN B;  4JHJ A;  2UUC T;  3L8R A;  3CX8 B;  2R5S A;  4DBR A;  4LER A;  4U95 D;  4HI8 A;  4LF7 T;  4ANW A;  4DUY T;  1D8D A;  4UVB B;  2ZMA A;  3A7M A;  5JDH A;  2J1D G;  3JAF A;  2VKH A;  3PZ3 A;  3I0O A;  2LAI A;  2AXV A;  5FMN A;  2YK0 A;  4H9Q C;  1K3Z D;  4G8L A;  1D1B A;  3IA3 A;  4HRL A;  4LFC T;  4H9N C;  2VAS A;  1TNB A;  2EIM E;  4HN9 A;  4U33 A;  4WNF A;  3BU8 A;  2XHE A;  1BPO A;  1SZ9 A;  4YY3 T;  3PUW F;  3QOF A;  3PUS A;  2PQR A;  5JJ7 A;  5JTG A;  4YSZ A;  2MHK A;  3HG0 D;  4TUU A;  4JUY A;  4TV3 A;  3NOG D;  2AWI A;  5HCJ A;  5LB7 B;  2K5B B;  1K1B A;  2WMN A;  2IHR 1;  3T9K A;  4O1P A;  4FJO A;  2JPF A;  4UXN B;  5BR8 T;  3UUM A;  1O1R A;  3FH5 A;  5LMU T;  3V30 A;  3CPZ A;  4CZZ B;  2RG8 A;  5KMG P;  5J08 A;  3EHR A;  2XCB A;  4F1S A;  3PJA A;  3CST A;  1TR4 A;  4EOZ B;  3UX4 A;  1BR2 A;  4DMW A;  3V5U A;  4AIU A;  4DR6 T;  4RG6 A;  3U66 A;  5LOZ A;  5EK3 A;  2MYO A;  1OWA A;  1UCU A;  1N9A A;  2OVF A;  4F1P A;  2H6G A;  2X6K A;  3UUL A;  1YYH A;  1H19 A;  2E9X C;  4I9C A;  4GTS A;  1KZO A;  1E96 B;  2I1K A;  3KVB A;  1X9B A;  4WWO A;  2CFZ A;  4EZJ A;  2FJB A;  2IO2 C;  4WUY A;  2XM2 A;  2YIN A;  3Q15 A;  3TLS A;  1US7 B;  1WFD A;  3Q4A B;  3U78 A;  2ODV A;  3L6A A;  3RYF E;  1ZP0 A;  2BKK B;  3O4Z A;  4YHJ A;  1N95 A;  2OOE A;  4WNK A;  1YKH B;  4AXP A;  2V7J A;  2IU1 A;  1Z3X A;  4H7Y A;  1Z3Y A;  2KCL A;  2X51 A;  2VQ2 A;  3GZ2 A;  4G11 A;  1SE7 A;  2ZGD A;  4I43 A;  4U7Y A;  3E37 A;  4QH4 A;  4N39 A;  3Q5E A;  2QVA A;  4MRU A;  5G05 C;  3AEB A;  5BT1 A;  3BQL A;  4HFH A;  4N3B A;  4ZI2 D;  3I9Y A;  1NWM X;  5FYM A;  5FL0 A;  4ZI3 D;  4DV1 T;  3EIQ C;  1GW6 A;  4BSX A;  2L3L A;  1XNQ T;  4AQF C;  2XPY A;  3IHY A;  3KD7 A;  2IUB A;  3FU5 A;  2LSI A;  3OYZ A;  2R03 A;  4YDO A;  4BX8 A;  3HXF A;  3ZKJ A;  1IQR A;  3MKQ A;  4JZY A;  2KC7 A;  5ENN A;  3HIZ A;  3UI2 A;  5JJ6 A;  3RYH E;  5FNV E;  1Z8U A;  3PUA A;  2WXJ A;  2V6Y B;  2W62 A;  3B95 A;  2WB2 A;  1T7S A;  3OJA A;  4UV9 B;  5HXE A;  1WR0 A;  3TWQ A;  3AE7 A;  1D9S A;  4KZC A;  3JC6 C;  2PZI A;  4O4L E;  2WXP A;  4QXH B;  4A5X A;  1KF6 A;  5CBN A;  2VGY A;  4BER A;  1OWM A;  4PJL A;  2KZT B;  1J5E T;  5C2Y A;  5AAR A;  4BX9 A;  2WM9 A;  4J8S A;  1H2V C;  4PW8 A;  4B3S T;  3VLF A;  5G05 J;  3C3R A;  3ESL A;  4Z8X A;  4PAG A;  3D9K A;  5FIN A;  1UOH A;  5JHA A;  4JEU B;  5H6R B;  4LEU A;  4KVO A;  3GN5 A;  4DV4 T;  4HVB A;  3RGL A;  1H2U A;  1JCS A;  5BV0 A;  2V5D A;  3C4W A;  4ILU A;  4QQI A;  1LVK A;  3I4R B;  1T72 A;  2XAS B;  4I2W A;  3ZST A;  3PDY A;  5LOV E;  4CXY A;  5BPP A;  1MJ0 A;  5ARG A;  1XNR T;  4FP7 A;  2R17 C;  4P09 A;  1NEK A;  3LK2 B;  4G1T A;  4YTN A;  2XZE A;  5C2T A;  2PG8 A;  3N9O A;  3JYS A;  5H7P A;  3PUZ F;  3E4B A;  3OPC A;  5LHH B;  4WBN E;  1UN9 A;  4ANU A;  4NUV A;  2D2S A;  4BJM A;  5JRC A;  3LDQ B;  4ACK A;  2XQ3 A;  4TWF A;  4ZZC A;  2CXL A;  4H63 H;  4DVD A;  3AU4 A;  4UF0 B;  2QY7 A;  1UGO A;  4IDQ A;  3CX7 B;  4BEP A;  2UXN B;  1ZOY A;  3TKL B;  2V26 A;  1I6Z A;  2LKH A;  2HR2 A;  2WXG A;  4G24 A;  4O60 A;  3ZPO A;  1XWM A;  2L6B A;  2BKG A;  1MQS A;  5F8P A;  2CHW A;  4KMO A;  3MX3 A;  4JD2 G;  4OVU A;  4OYK A;  5GON E;  1G3N B;  3N2O A;  1U3D A;  2FUP A;  3DST A;  2V5F A;  4GA0 A;  3FEX A;  4U7E B;  2J07 A;  2ILR A;  4J8F A;  4HWH A;  2VGX A;  4AIF A;  2KCK A;  3ZC0 A;  2RP4 A;  5LYJ E;  5ANL A;  3HRA A;  5ARF A;  3BQI A;  3RRC A;  1R8I A;  3NZQ A;  4PK5 A;  3X1D A;  2YU1 A;  3V2O A;  4U3C A;  2CXD A;  3QK0 A;  4JW1 A;  5CA1 E;  3FB2 A;  2UXX B;  2LXM A;  1OWL A;  2UWJ G;  5HKP A;  2LSV A;  3MZL B;  3DEP A;  2MBG A;  2KSR A;  3HKC E;  4BAY B;  2VK9 A;  4I1A A;  3T8O A;  5T8I A;  1E7V A;  4P29 A;  1D0Z A;  1E8Z A;  5E0O A;  2AXD S;  4U8V D;  2CHO A;  3G2W A;  2WXN A;  5HEG A;  4AIS A;  3UT5 E;  2X6I A;  2XSB A;  2J4G A;  2M67 A;  4B6X A;  5FL1 A;  3PNL B;  1YKE B;  4A3T A;  2XSA A;  2XGO A;  4XIF A;  4BT8 A;  4DBQ A;  3G2U A;  1AWC B;  3AXJ B;  3GYZ A;  4IE5 A;  3CHO A;  5L3B B;  2LSJ A;  3A8Y C;  4I50 E;  4UI9 J;  1A5E A;  2XQ9 A;  4YHH T;  5FQ4 A;  2J47 A;  3Q5D A;  1U2V G;  3M3Z B;  4TNV A;  3EVY A;  2V7I A;  2QFC A;  4AOF A;  3D3M A;  4N2Q A;  2NYJ A;  3FTW A;  2W67 A;  4G26 A;  5LA6 E;  3C4X A;  4PFP A;  3MA9 A;  4LFA T;  1X5B A;  1Z5S C;  3B7B A;  5KJN A;  4DX7 D;  3ZMU B;  2BZB A;  4ZS3 A;  5LBQ B;  3PU3 A;  2UY1 B;  2BG9 B;  3CK8 A;  2Q9Q C;  5ENR D;  4YLH A;  1L5J A;  3CVY A;  3L08 A;  4G8K A;  1ZB1 A;  4TX5 A;  1H0A A;  2ZIS A;  4EV6 A;  3S2A A;  2R6G F;  3N2G E;  5AJD A;  3AJI A;  2X67 A;  1XGW A;  3RC3 A;  3R7Q A;  4EZK A;  3URZ A;  5C8Y E;  2IFU A;  1N34 T;  4U2Z A;  4DV6 T;  3LSV A;  2MPK A;  3S7F A;  2ZM6 T;  2XAH B;  1QSD A;  4ATG A;  5HEH A;  3IHV A;  4IUL A;  4DLO A;  3HYM B;  3FU0 A;  1NA0 A;  2YN6 A;  2Q9Q D;  3FZK B;  1Z6T A;  2PNN A;  3FTU A;  3Q73 A;  3MKQ B;  5B1A E;  4DX2 A;  2X9X A;  5CJ5 A;  2N9D A;  5E76 A;  3QB5 K;  2E2A A;  2IDO B;  5LGU B;  2F37 A;  3CQX C;  2X68 A;  3CML A;  3F2E A;  4WW0 A;  4GKK T;  4GYO A;  3F6Q A;  2P9I G;  3DRA A;  4QXB B;  5D2M C;  2V4H C;  3PUY F;  3KSQ A;  5AQA A;  1DC2 A;  5CFB A;  2MAW A;  4JB8 P;  3B13 A;  2XQ4 A;  5LP6 E;  3B7S A;  1SZA A;  5L3C B;  2LM9 A;  3CK9 A;  3FXE B;  1SA5 A;  3AG4 E;  2IO3 C;  4AP2 A;  5J90 A;  3L54 A;  3DSU A;  3SFX A;  3NBN B;  4UQY A;  1W09 A;  3ZMZ B;  2NSZ A;  5BW8 C;  1TNZ A;  4HQD A;  1E2A A;  3KSL A;  2VGE A;  4Z68 A;  3E33 A;  3Q9N C;  1DVP A;  3U64 A;  4HFI A;  4DID B;  4NPP A;  2L9Q A;  2XUE A;  5EX3 A;  4RSY A;  4KXK B;  4HLL A;  3RKG A;  5EID A;  2WQY A;  5FY0 A;  4GTP A;  2X9W A;  3ONK A;  3QK6 A;  1UK5 A;  3S4U A;  1P5Q A;  1HXI A;  3BQK A;  3B7T A;  4PJM A;  4FC8 A;  3AEE A;  2XRY A;  3ISM C;  2WDV A;  5IYZ E;  3SNX A;  3I0Q A;  2UXB T;  2FO1 E;  3NKZ A;  1M62 A;  1UUS A;  5LGN B;  3ZMS B;  4RG9 A;  2IOS A;  3SGH A;  2VKJ A;  4AKG A;  3BG1 B;  3OAW A;  2KZ7 B;  2FF4 A;  2WQH A;  3RK6 A;  4GA1 A;  3PTR B;  1UUR A;  5LJM A;  3ZVV A;  4IHJ E;  2IIU A;  2XAJ B;  2VUR A;  5AQ9 A;  2WSS V;  2NP9 A;  4WNE A;  2WZH A;  2HN2 A;  4PDX A;  4F53 A;  1FCH A;  3C98 A;  3EUV A;  2V1D B;  2KND A;  3P4Q A;  1TNO A;  4OAU C;  1OY3 D;  3K9I A;  4B3T T;  2Y4T A;  3DTO A;  4LNB A;  3AAA B;  2C0L A;  2L0T B;  4ZOL E;  4ISS A;  4HFV A;  4IL4 A;  4DX6 D;  2EHO D;  3EDV A;  2YQ8 A;  1UX4 A;  1O1T A;  3FUJ A;  2P9B A;  3AE6 A;  4CI3 B;  4J8D A;  4GAA A;  3ANW A;  2V8S E;  4WBO A;  5HWY A;  3QC1 A;  4LF8 T;  4IDP A;  3TWX A;  2VKD A;  2K9A A;  1JWF A;  2MOZ A;  2CHN A;  5G04 J;  2OVB A;  4TWD A;  3RPU A;  4U8Y D;  2QYU A;  4ANJ A;  4PH4 B;  3AS4 A;  3S7J A;  5FQ7 A;  3SQV A;  5ABH A;  3TXM A;  4TUY E;  4WYV A;  4F8H A;  1VCT A;  3T5X A;  2ZM2 A;  1ZV4 X;  3PH0 C;  2CLY B;  2YEV C;  5TAO A;  4YDE A;  3U9W A;  3SD5 A;  5KJL A;  5CA0 E;  3PZ4 A;  4DV0 T;  1KLX A;  3DSX A;  3RKO A;  2LJL A;  2AW6 A;  3FUI A;  4CDR A;  3MGB A;  4UR9 A;  2LSG A;  3LBX A;  4O8S A;  3JCF A;  5FXW A;  1UG3 A;  2H3R A;  3PZ1 A;  1YW0 A;  1JNR A;  2WU2 A;  1MYO A;  1MND A;  4MFR A;  5LG4 A;  5AQV B;  2A4Z A;  1H6O A;  2Y69 E;  4IN3 B;  3SBS A;  3UM1 A;  4XE0 A;  4ZI7 E;  3AA7 B;  2P9S G;  2WWU A;  5G04 C;  3JQ1 A;  2LSY A;  2HN1 A;  2J4B A;  2B6C A;  3BEE A;  4XBF B;  4KHZ F;  3RKV A;  1PAQ A;  2WXK A;  3FTZ A;  5B3S E;  4U0U A;  1JNZ A;  4CT0 A;  5FVL A;  4I4T E;  5D0O D;  2LO6 A;  1QZ2 A;  5JDG A; 
#chains in the Genus database with same CATH homology
 1Y64 B;  5DAB A;  2V7M A;  1LVF A;  2XHE B;  2JLB A;  3CEQ A;  4HLE A;  1U4Q A;  2X38 A;  3UUX A;  4P0A A;  3BK9 A;  3HVE A;  3S7B A;  1TJF A;  4JLE A;  2KM4 A;  4UWH A;  3UMV A;  1Z0P A;  2W0G A;  2HPL A;  5FQ8 A;  4H9S E;  3CKD A;  3HHM A;  2V7L A;  4J2C A;  3ASF A;  4J6I A;  3LK3 B;  3FBL A;  3PS6 A;  3P1U A;  4CRW A;  4ME2 A;  4LCT A;  5KJM A;  4CDN A;  5FQ6 A;  4GML A;  3RX6 A;  5CMY A;  4AJW A;  4ZI3 C;  4MLK A;  5FJY A;  5HXH A;  1HS6 A;  1MIY A;  4FA6 A;  2VTB B;  2FUL A;  2C0S A;  2EHO A;  2HM8 A;  3NZP A;  4J8E A;  4H63 V;  4ZI2 C;  1O3X A;  1MMA A;  1OWN A;  2J09 A;  4B0Z A;  5JH7 E;  4IE0 A;  2J08 A;  2LOS A;  3RC8 A;  3FHN A;  3VTX A;  4CCA A;  2A2F X;  3KDS E;  1KT1 A;  4XZC A;  4JL0 A;  4AXH A;  1KT0 A;  4BJN A;  4DLQ A;  3TGO A;  2OV8 A;  2VSX E;  2XAG B;  5JDF A;  3SBT B;  5AJL A;  4BT9 A;  3F57 A;  4GU5 A;  3Q9D A;  2GRM A;  2XQ0 A;  4DO0 A;  4KBM B;  3APD A;  3SOL A;  3FUF A;  4UQZ A;  3LVQ E;  4E6H A;  4QFV A;  2H7O A;  4IYP A;  4E85 A;  2JRK A;  4XI0 A;  3FP3 A;  2PBI A;  2C0M A;  4GZ3 A;  3D9J A;  3U3W A;  3D9L A;  3ZN3 A;  3BG0 B;  4WNG A;  2WBL A;  4G2V A;  3G2S A;  3CVU A;  3VHL A;  1INZ A;  1ELW A;  3NZS A;  5A7D B;  4CQI A;  4AEZ C;  5FY7 A;  5M4Y A;  2VSN A;  2CLY C;  5FT9 A;  2CHX A;  2E8I A;  2PM6 A;  5LCW J;  3KV6 A;  3FTX A;  2ACX A;  4I9E A;  4UIG A;  4UI9 C;  4XKB A;  3CGH A;  2K48 A;  4EZH A;  2BF0 X;  2CWY A;  2E9X B;  4GK5 E;  2E0I A;  2LOP A;  3EDU A;  3W15 B;  5H6Q B;  3F31 A;  1W3B A;  1AJ3 A;  3LKU A;  2DNX A;  3IV0 A;  3HKD E;  2V7K A;  1BR1 A;  4EQF A;  2WXO A;  4LRZ A;  3ZYQ A;  5AEN A;  3SS1 A;  4ASK A;  4FLH A;  3QOU A;  5EZY E;  2XQY A;  4UWL A;  2HO1 A;  4AQG A;  2NOX A;  4N3A A;  3R6N A;  2GK9 A;  4F6R C;  2AXU A;  3NRY A;  4JEH B;  4B8C B;  5FXZ A;  2ODU A;  3LPZ A;  1S35 A;  3LXU X;  4JXT A;  4N78 D;  2KZT A;  3CQC B;  2QGS A;  1S94 A;  3DJB A;  4B94 A;  5KJK A;  3UQ3 A;  3O4X E;  3ML9 A;  5ETW A;  3JC6 D;  5JDL A;  4M3O A;  3PZD A;  5CHE E;  3PEV B;  4UWG A;  1E8W A;  2PQN A;  2LSU A;  4DI3 A;  1U5P A;  3ZJ2 A;  5LP0 A;  2FBN A;  3PU8 A;  4K0U A;  5LFA A;  1IQU A;  5FZQ A;  4UVC B;  3FU3 A;  2YHC A;  4JVS A;  3CVQ A;  4FI5 A;  1OWO A;  3ENE A;  3ZW3 A;  3NQP A;  5G55 A;  3R84 B;  4YVO A;  2WAU A;  4BTB A;  1ZU2 A;  4OK0 A;  5E75 A;  3CQG B;  5ANR A;  3EIJ A;  4N2S A;  1H7C A;  2VL8 A;  3MJW A;  4TV9 E;  2N1G A;  2RA1 A;  5HWX A;  1IAP A;  4OFZ A;  2WXF A;  4PS8 A;  2DWG A;  4O2A E;  4GK0 E;  2VTB A;  1NP7 A;  1X79 A;  3K8P C;  3OXL A;  3OTN A;  3PE3 A;  3TL5 A;  4HOR A;  4G63 A;  3B7R L;  3EHM A;  5AFU L;  1BR0 A;  1IJ5 A;  2V0P A;  4EB6 E;  3CHM A;  2XGS A;  4QX7 B;  3ASD A;  2WXM A;  4H7X A;  4DK5 A;  3FHE A;  2QA7 A;  2ZM8 A;  2IW5 B;  4Y6C A;  5DBK A;  3CKC A;  5KX5 E;  4GB9 A;  4EYU A;  2VSY A;  3KV5 A;  2MTQ A;  3FTY A;  4HOQ A;  5C1D A;  4IGU A;  2MRI A;  3WI3 A;  4X20 E;  3QAQ A;  5JR9 B;  4EZL A;  3VLD A;  2WXL A;  1N52 A;  2OND A;  3FUM A;  4ANX A;  3QAR A;  3VKH A;  1B7T A;  4I43 B;  3ZPJ A;  3GZ1 A;  1HE8 A;  4NQ0 A;  3MV2 B;  3AAE B;  3CIA A;  4B8A A;  3UT7 A;  4I17 A;  2VSO E;  1G8X A;  3R9A B;  3CKB A;  4FAD A;  3L13 A;  3CV0 A;  5HQ8 A;  4MAL A;  2H7V C;  3EHN A;  3APF A;  3L22 A;  4ABN A;  4IRU A;  3FUE A;  4HS2 A;  3D9P A;  2I59 A;  2D5U A;  3FUH A;  3GN5 B;  2CCQ A;  3MKR A;  3UFE A;  3K3Q C;  1ELK A;  2DBA A;  3PVL A;  4K03 A;  2BDE A;  4IE7 A;  3PUR A;  3LCA A;  5KDM C;  3ZXS A;  5FZS A;  3ZJ1 A;  1CUN A;  3KVA A;  3TXN A;  2LAH A;  2IAK A;  5IHY A;  3QWW A;  3K3O A;  4ZHQ E;  3O1H A;  2X9Y A;  3KAE A;  4L0R A;  4UQX A;  3ZFW A;  4I6G A;  3LVR E;  5JDM A;  3O48 A;  2CA5 A;  2WXQ A;  1E1H B;  3QKY A;  3ANW B;  2ES0 A;  2YU2 A;  2XAF B;  2MOW A;  4Q96 A;  2WXR A;  2XRZ A;  5HYA A;  2PJQ A;  2DIW A;  4APF A;  2DCF A;  3CK7 A;  1E7U A;  4O4J E;  2PL2 A;  5DQW A;  3HKE E;  3PUQ A;  1UN8 A;  2XPI A;  4QXC B;  3RO3 A;  3ULQ A;  3AVR A;  2KIN B;  4XX5 A;  4H9P C;  3UT4 A;  5T3R A;  3MAC A;  1QUU A;  4PK6 A;  2NW8 A;  4MLP A;  1HTJ F;  4A56 A;  4I6E A;  3ZIM A;  1XNF A;  3LEW A;  5EK4 A;  4UV8 B;  1HS7 A;  4NUU A;  3B7U X;  4KVM A;  3RIB A;  3AS5 A;  2WXI A;  4QHO A;  3UUN A;  3VKG A;  4O4H E;  4FHJ A;  1WAO 1;  4L1B A;  4KBQ A;  3IEG A;  3DPD A;  3I9W A;  4GZ5 A;  1EZ3 A;  4E7Z A;  2HH7 A;  2KMF A;  3RRM B;  1NAF A;  4CGV A;  3N9L A;  3ETV A;  3FTV A;  4I2Z A;  3AS8 A;  3ZEF B;  1ZHC A;  1MMG A;  4XZ4 A;  2W61 A;  3I1A A;  1TJC A;  2L6J A;  3CVX A;  2X6F A;  2X6J A;  4G23 A;  1H2T C;  3N9Q A;  5HXR A;  4EAH A;  3CVL A;  2JMH A;  3N9P A;  2BUG A;  1FMW A;  5LXT E;  2WQ7 A;  2DHR A;  2Y6X A;  2L9B A;  3G2T A;  1D1C A;  5LNK A;  1JPL A;  3FDH A;  3KBT A;  2KWI B;  3MKD A;  3N71 A;  3DBS A;  2BVM A;  2J9Q A;  4IE4 A;  4WWP A;  3EUH A;  4H9O C;  4CEM A;  3KV4 A;  5FTP A;  3SWH A;  3PE0 A;  5ADX L;  2IC6 A;  1U3C A;  2WVI A;  2OA5 A;  5JR9 A;  3Q49 B;  1WR6 A;  3B57 A;  4UVA B;  3RRN B;  3JCK C;  3ONX A;  3GWH A;  5HI7 A;  5JDN A;  3KBU A;  1TEZ A;  4FJY A;  1HF8 A;  4I1M A;  3TAX A;  2AXZ A;  4U07 A;  2RD0 A;  5J2T E;  2XGM A;  1QNF A;  2CG3 A;  2AVP A;  2HPJ A;  3ZYK A;  5LJN A;  5J2U E;  2XCC A;  3VLE A;  3C50 A;  4G2A A;  2X66 A;  3LY8 A;  2LHR A;  4KMC A;  3NZU A;  3PUJ A;  3PRZ A;  2C5K T;  4RVB A;  2SPC A;  3ZN1 B;  2Y4U A;  2BTD A;  3AU5 A;  3NF1 A;  1OUV A;  3C4Z A;  3N5L A;  2IC9 A;  2X6H A;  3RO2 A;  3V5S A;  1HG5 A;  4YFS A;  3FWV A;  3HVE B;  1H6K A;  1FVH A;  4GZ6 A;  1OXZ A;  1MIV A;  2CMR A;  2CXF A;  4PJN A;  2WPV A;  5EK2 A;  4UEL A;  4BY6 A;  4L7T A;  4PK4 A;  2R59 A;  3ZMV B;  3CSF A;  4D10 C;  2JJ9 A;  4IIJ E;  3CHR A;  4O2B E;  3C98 B;  3CWZ B;  4ZS2 A;  3HR0 A;  2G0U A;  4B89 A;  4YJ2 E;  2D0T A;  1HCI A;  4CGW A;  3Q5X A;  5JHB A;  4W9R A;  3OXF A;  3L16 A;  3QWV A;  1Y8M A;  1WM5 A;  2EHO B;  4DJA A;  3N2K E;  3MA5 A;  4C9B B;  4BFR A;  2IJG X;  3O1J A;  4ILH B;  2A3D A;  3MYV A;  1LF8 A;  3C51 A;  1IHG A;  4ILI A;  4N5C A;  2NW9 A;  2CWO A;  3UUX B;  1PY1 A;  4GYW A;  1E8Y A;  4CT4 A;  5JQG E;  2XPZ A;  3LDZ A;  2FO7 A;  2L8K A;  2Y3A A;  1LRZ A;  4UI9 K;  2IF4 A;  3ZGQ A;  3PUK A;  3QJZ A;  5EKQ D;  4JEU A;  3Q2M A;  1JWG A;  5A6C A;  4ANV A;  5CMW A;  1HX8 A;  4UF0 A;  3D0T A;  4R7L A;  3FBZ A;  2CM0 A;  3CX6 B;  3IF8 B;  3ESK A;  2K24 A;  4L2Y A;  4I6J A;  4CI2 B;  1QQE A;  3L09 A;  3FUK A;  3LS8 A;  4AM9 A;  1IZN B;  4KYO B;  2P58 C;  3ZHE B;  4GCN A;  3FFL A;  2JEK A;  4ACL A;  3KFW X;  2DCP A;  3ASG A;  4YJ3 E;  3ETU A;  3FTS A;  4FU3 A;  3D9M A;  1D0X A;  3HL6 A;  4U8H A;  3IBP A;  3P8C D;  4FJZ A;  5HAX A;  2CE7 A;  5EX0 A;  2FEZ A;  3FXD B;  4PFO A;  3E0Z A;  1IYG A;  1LKX A;  2VB6 A;  4PJJ A;  5DJQ C;  1PC2 A;  3LG7 A;  3O1I A;  3I4G A;  5HXS A;  2J4D A;  4BTA A;  4KT6 B;  3RH3 A;  1WRD A;  3D9I A;  5LHG B;  2W63 A;  3PEU B;  4AVX A;  3VTY A;  3CVW A;  4MKT A;  3ZHE A;  5KCM A;  1WYB A;  5EDS A;  4AKL A;  3FH8 A;  4ILG A;  4U04 A;  1E8X A;  3JQ0 A;  2JQQ A;  3S7D A;  4KZ0 A;  4KUM B;  2DI4 A;  4NAC A;  4GYY A;  5CB4 E;  5FWQ A;  4ERR A;  1Y6I A;  2KCV A;  3GA8 A;  1HFA A;  2I1J A;  5L3D B;  1MIW A;  4JEH A;  3SRZ A;  5LX8 A;  2L0I A;  3ZYM A;  4GMJ A;  5FZR A;  3FUN A;  3TG5 A;  3H3A A;  4OYS A;  2XAQ B;  1N54 A;  3CLJ A;  5F3J A;  1FVF A;  2ZM0 A;  3PDN A;  5DIZ A;  4E7S A;  3LYA A;  4UWK A;  3J7Y q;  5FY1 A;  3FUD A;  4O4I E;  4DI4 A;  4BWR A;  1ZEE A;  3P7I A;  3L3P A;  5FXV A;  2Q7F A;  4L9I A;  4AQF A;  3I3N A;  3UPV A;  1MMN A;  3HKB E;  2VGX B;  1EYH A;  3MXZ A;  2MYS A;  3MK7 C;  1V9D A;  2WXH A;  4DPR A;  4MS6 A;  4JHK A;  4MHC A;  1WYC A;  4A3V A;  4V1A v;  1SA0 E;  3LY7 A;  3RYI E;  3Q5M A;  4M1P A;  4JPS A;  4AKI A;  5J1G A;  5JRC B;  3CVR A;  4EXT A;  5FP3 A;  5HXC A;  2XEV A;  4BA9 A;  1D1A A;  4HOT A;  2LSK A;  3APC A;  4A55 A;  2NTY A;  2YNQ A;  2X0L B;  4EPZ A;  5A1L A;  4HXI A;  4AV7 A;  4L5G A;  3C64 A;  3CR3 A;  3P2B A;  4AKR B;  4DND A;  4JA7 A;  4N3C A;  4PNI A;  2Z6E A;  3RU0 A;  4X1I E;  4U74 A;  4LUN U;  5LCW C;  4APO A;  4DMV A;  3FU6 A;  3FEY A;  4CXX A;  3IHR A;  1UJK A;  2I2O A;  3ZRH A;  3AA1 B;  4CXW A;  3D9N A;  4GOU A;  1B89 A;  3OKQ A;  2Y48 B;  5AYW D;  2KLQ A;  3QC9 A;  3VU7 H;  2KXP B;  1FIO A;  2M63 A;  4HE8 A;  2NWB A;  2KWH A;  1UJJ A;  3ZLI A;  4XI9 A;  4Y6W A;  2EQX A;  4O6F A;  2A72 A;  3SF4 A;  4HKA A;  4HOS A;  1YD8 G;  5JR9 C;  1KNZ A;  3R7R A;  2HYZ A;  2NTX A;  3PE4 A;  1VRB A;  3TJP A;  5CCM A;  5BNW A;  5T4Y A;  1NZN A;  4EYY R;  3JUI A;  1OWP A;  4A1S A;  2EHO C;  1E90 A;  3MJX A;  1JUQ A;  4JA9 A;  5JJT A;  2Q9Q B;  3IEE A;  2UY1 A;  3KV9 A;  4TRQ A;  3RRW A;  3IKO B;  4Q94 A;  3PUG A;  4U0S A;  3UT8 A;  2JMK A;  3EDT B;  1HU3 A;  4XKC A;  2CFU A;  2DLR A;  4PS3 A;  2VYI A;  3CVP A;  4GA2 A;  1ZKE A;  1WY6 A;  5JRE A;  4C91 A;  2ZU6 B;  4HOU A;  3FH7 A;  5LCY A;  2VKO A;  2VJ8 A;  3LFM A;  2WQ6 A;  5G2N A;  3G2V A;  4EBA A;  3MEK A;  3D9O A;  1SQM A;  4CI1 B;  5L3F B;  1MHQ A;  3CVV A;  2X9H A;  2ZLY A;  1HH8 A;  3MV3 B;  3H37 A;  4V3I A;  4A1G A;  1A17 A;  1IJ6 A;  4FHK A;  4OYJ A;  4K0R A;  4YND A;  2Y8D A;  1D0Y A;  1MNE A;  4FLB A;  2GRL A;  4NRH B;  1T98 A;  4GPK A;  2X3M A;  3QUJ A;  3ML8 A;  3E22 E;  4EEC A;  3AB3 B;  4IE6 A;  3HDX A;  2FI7 A;  4I1O B;  4IST A;  3QDN A;  3QB2 A;  2LHN A;  2PM7 A;  3FY4 A;  4EBA G;  4AI6 A;  2LE8 A;  2IOL A;  4HTE A;  3LJC A;  3T5V A;  2C2L A;  3T8M A;  4J0U A;  1G73 A;  3NBX X;  3GMI A;  3RYC E;  4NUR A;  5FXX A;  2IQC A;  4GYS A;  1ELR A;  4XAX B;  3CVN A;  4U63 A;  3KS2 A;  3UTK A;  3I5P A;  3ZCI A;  4PS7 A;  3TG4 A;  3AA0 B;  1BR4 A;  1HG2 A;  2W00 A;  4KP3 C;  5JDQ A;  3SHF A;  2PFV A;  4IDZ A;  2GW1 A;  4OVV A;  3N9M A;  4EIW A;  5LGT B;  3KEZ A;  2DWK A;  4C0E A;  5D0Q D;  1NA3 A;  3LJ3 A;  4GZC A;  3AAI A;  1VDY A;  1UW4 B;  5BV1 A;  1YA0 A;  5L2L A;  3CHQ A;  4Q69 A;  3ASH A;  4ADZ A;  4F7A A;  3HI2 A;  1FEW A;  2GGF A;  2E9X D;  3OBV E;  3MZK B;  2NC9 A;  3FUL A;  2XTL A;  5M72 A;  3AVS A;  2I6H A;  4CDM A;  2B1E A;  4X1Y E;  4P0B A;  3U4T A;  2KT9 A;  3WXX A;  2NXP A;  4HFG A;  2YHE A;  4GIW A;  2BVL A;  4X1K E;  3SI5 A;  2V4L A;  2ION A;  2C5I T;  1S0P A;  4GZD A;  3WAJ A;  5LBM A;  4PUC A;  4H9R C;  2NW7 A;  3ZCJ A;  2C5J A;  4EZ4 A;  3GZS A;  5DQV A;  3M65 A;  4FUL A;  2WMO A;  5LHI B;  5L3G B;  3RJV A;  3HA4 A;  3NRX A;  4TZ4 C;  3ZN0 B;  1DNP A;  3GW4 A;  4I55 E;  3ONL A;  4WAF A;  4G25 A;  3U3I A;  3CHP A;  3E08 A;  1MMD A;  2CEA A;  3K3N A;  3CHS A;  3AA6 B;  4JHR A;  3Q5W A;  3LBX B;  4OHF A;  3J9X 1;  1EPU A;  4YVQ C;  2Q9Q A;  4JC8 A;  1KK7 A;  4TV8 E;  2J49 A;  3L17 A;  5AIJ A;  1HZ4 A;  3SZ7 A;  4QWN B;  1HO8 A;  1EF1 C;  3PNT B;  2D0U A;  4L2L A;  3QNK A;  4WWN A;  2E9X A;  4HEA A;  5BMV E;  3WAK A;  1WLX A;  5JVD E;  4GYR A;  3EJN A;  3OXG A;  3O9X A;  3RRU A;  3IBE A;  2VWA A;  3A5X A;  4QKN A;  3ZC1 A;  5L3E B;  2CHZ A;  3OYX A;  2A5U A;  4U0Z A;  4U72 A;  4GCO A;  4MBQ A;  4AY6 A;  3LY9 A;  1SHZ C;  4C90 A;  2LEH A;  1FMV A;  4L23 A;  3ZMT B;  2I9C A;  1VOM A;  3MCX A;  1UX5 A;  5A23 A;  2N2N A;  4TN7 B;  5CCL A;  2E2E A;  2LNI A;  4UWF A;  3ZYL A;  4AKH A;  4AY5 A;  3ZEF A;  5BUZ A;  4UEM A;  2KAT A;  4F3V A;  4QX8 B;  3N9N A;  1ZBP A;  2CG2 A;  3Q47 B;  4HGA A;  3PRE A;  3QWP A;  2LT3 A;  3LK4 2;  1EDU A;  4URK A;  3DP7 A;  4WND A;  4C0M A;  3KIN B;  4JHJ A;  3CX8 B;  2R5S A;  4DBR A;  4LER A;  4ANW A;  4UVB B;  2ZMA A;  5JDH A;  2J1D G;  2VKH A;  3I0O A;  2LAI A;  2AXV A;  5FMN A;  2YK0 A;  4H9Q C;  1D1B A;  4H9N C;  2VAS A;  4HN9 A;  4WNF A;  2XHE A;  1BPO A;  1SZ9 A;  3PUS A;  2PQR A;  5JJ7 A;  2MHK A;  4TUU A;  4JUY A;  4TV3 A;  2AWI A;  2K5B B;  2WMN A;  4FJO A;  2JPF A;  4UXN B;  3UUM A;  3FH5 A;  3CPZ A;  4CZZ B;  2RG8 A;  5KMG P;  5J08 A;  2XCB A;  4F1S A;  3CST A;  3UX4 A;  4EOZ B;  1BR2 A;  4DMW A;  3V5U A;  3U66 A;  4RG6 A;  5LOZ A;  5EK3 A;  1OWA A;  1UCU A;  2OVF A;  2X6K A;  3UUL A;  1H19 A;  2E9X C;  4I9C A;  1E96 B;  2I1K A;  3KVB A;  4WWO A;  2CFZ A;  4EZJ A;  4WUY A;  2YIN A;  3Q15 A;  1US7 B;  3Q4A B;  3U78 A;  2ODV A;  3L6A A;  3RYF E;  3O4Z A;  4YHJ A;  2OOE A;  4WNK A;  1YKH B;  4AXP A;  2V7J A;  2IU1 A;  1Z3X A;  4H7Y A;  1Z3Y A;  2KCL A;  2X51 A;  2VQ2 A;  3GZ2 A;  4G11 A;  4I43 A;  3SFZ A;  4N39 A;  4MRU A;  5G05 C;  5BT1 A;  3BQL A;  4N3B A;  4ZI2 D;  3I9Y A;  1NWM X;  5FYM A;  4ZI3 D;  3EIQ C;  1GW6 A;  4BSX A;  2L3L A;  4AQF C;  2XPY A;  3IHY A;  3KD7 A;  3FU5 A;  2LSI A;  3OYZ A;  4BX8 A;  1IQR A;  3MKQ A;  4JZY A;  2KC7 A;  5ENN A;  3HIZ A;  5JJ6 A;  3RYH E;  5FNV E;  3PUA A;  2WXJ A;  2W62 A;  2WB2 A;  3OJA A;  4UV9 B;  5HXE A;  4KZC A;  3JC6 C;  2PZI A;  4O4L E;  2WXP A;  4QXH B;  2VGY A;  1OWM A;  4PJL A;  2KZT B;  5C2Y A;  4BX9 A;  2WM9 A;  4J8S A;  1H2V C;  4PW8 A;  3VLF A;  5G05 J;  3ESL A;  4Z8X A;  4PAG A;  3D9K A;  5JHA A;  4JEU B;  5H6R B;  4LEU A;  4KVO A;  3GN5 A;  4HVB A;  1H2U A;  5BV0 A;  3C4W A;  4ILU A;  1LVK A;  3I4R B;  2XAS B;  4I2W A;  3PDY A;  5LOV E;  4CXY A;  5BPP A;  5ARG A;  4FP7 A;  2R17 C;  4P09 A;  3LK2 B;  4G1T A;  2PG8 A;  3N9O A;  3JYS A;  3E4B A;  5LHH B;  4WBN E;  1UN9 A;  4ANU A;  4NUV A;  2D2S A;  4BJM A;  5JRC A;  4ACK A;  2CXL A;  4H63 H;  4DVD A;  3AU4 A;  4UF0 B;  2QY7 A;  3CX7 B;  2UXN B;  3TKL B;  2V26 A;  2HR2 A;  2WXG A;  4G24 A;  3ZPO A;  1MQS A;  5F8P A;  2CHW A;  4KMO A;  3MX3 A;  4OVU A;  4OYK A;  5GON E;  3N2O A;  1U3D A;  2V5F A;  4GA0 A;  3FEX A;  2J07 A;  2ILR A;  4J8F A;  2VGX A;  4AIF A;  2KCK A;  3ZC0 A;  2RP4 A;  5LYJ E;  5ANL A;  5ARF A;  3BQI A;  3RRC A;  3NZQ A;  4PK5 A;  2YU1 A;  2CXD A;  3QK0 A;  4JW1 A;  5CA1 E;  3FB2 A;  2UXX B;  1OWL A;  2UWJ G;  2LSV A;  3MZL B;  2MBG A;  3HKC E;  4BAY B;  2VK9 A;  4I1A A;  3T8O A;  5T8I A;  1E7V A;  4P29 A;  1D0Z A;  1E8Z A;  5E0O A;  3G2W A;  2WXN A;  3UT5 E;  2X6I A;  2M67 A;  4B6X A;  3PNL B;  1YKE B;  4A3T A;  2XGO A;  4XIF A;  4BT8 A;  4DBQ A;  3G2U A;  3GYZ A;  4IE5 A;  3CHO A;  5L3B B;  2LSJ A;  4I50 E;  4UI9 J;  5FQ4 A;  3EVY A;  2V7I A;  2QFC A;  4AOF A;  3D3M A;  4N2Q A;  3FTW A;  4G26 A;  5LA6 E;  3C4X A;  4PFP A;  3MA9 A;  1X5B A;  5KJN A;  3ZMU B;  2BZB A;  4ZS3 A;  5LBQ B;  3PU3 A;  2UY1 B;  3CK8 A;  2Q9Q C;  4YLH A;  1L5J A;  3CVY A;  3L08 A;  4TX5 A;  1H0A A;  3S2A A;  3N2G E;  5AJD A;  2X67 A;  1XGW A;  3RC3 A;  3R7Q A;  4EZK A;  3URZ A;  5C8Y E;  2IFU A;  3S7F A;  2XAH B;  1QSD A;  4ATG A;  3IHV A;  4IUL A;  4DLO A;  3HYM B;  3FU0 A;  1NA0 A;  2Q9Q D;  1Z6T A;  3FTU A;  3MKQ B;  2X9X A;  2N9D A;  5E76 A;  5LGU B;  3CQX C;  2X68 A;  3CML A;  3F2E A;  4WW0 A;  4GYO A;  4QXB B;  3B13 A;  5LP6 E;  3B7S A;  1SZA A;  5L3C B;  2LM9 A;  3CK9 A;  3FXE B;  4AP2 A;  5J90 A;  3L54 A;  4UQY A;  3ZMZ B;  2NSZ A;  5BW8 C;  1DVP A;  3U64 A;  2L9Q A;  2XUE A;  5EX3 A;  4RSY A;  4KXK B;  5FY0 A;  2X9W A;  3ONK A;  3QK6 A;  3S4U A;  1P5Q A;  1HXI A;  3BQK A;  3B7T A;  4PJM A;  4FC8 A;  2XRY A;  5IYZ E;  3SNX A;  3I0Q A;  5LGN B;  3ZMS B;  4RG9 A;  2IOS A;  3SGH A;  2VKJ A;  4AKG A;  3BG1 B;  3OAW A;  2KZ7 B;  2FF4 A;  2WQH A;  3RK6 A;  4GA1 A;  3PTR B;  5LJM A;  3ZVV A;  4IHJ E;  2XAJ B;  2WSS V;  2NP9 A;  4WNE A;  4F53 A;  4PDX A;  1FCH A;  3C98 A;  2V1D B;  2KND A;  3K9I A;  2Y4T A;  3DTO A;  3AAA B;  2C0L A;  2L0T B;  4ZOL E;  4ISS A;  4HFV A;  2EHO D;  3EDV A;  2YQ8 A;  1UX4 A;  3FUJ A;  2P9B A;  4CI3 B;  4J8D A;  4GAA A;  3ANW A;  2V8S E;  4WBO A;  5HWY A;  3QC1 A;  2VKD A;  2K9A A;  1JWF A;  2MOZ A;  5G04 J;  2OVB A;  3RPU A;  4ANJ A;  4PH4 B;  3AS4 A;  3S7J A;  5FQ7 A;  3TXM A;  4TUY E;  3T5X A;  2ZM2 A;  1ZV4 X;  3PH0 C;  2CLY B;  2YEV C;  5TAO A;  3U9W A;  3SD5 A;  5KJL A;  5CA0 E;  1KLX A;  3RKO A;  2LJL A;  2AW6 A;  3FUI A;  4CDR A;  3MGB A;  2LSG A;  3LBX A;  4O8S A;  5FXW A;  1UG3 A;  2H3R A;  1YW0 A;  1MND A;  4MFR A;  5LG4 A;  2A4Z A;  3SBS A;  4IN3 B;  4XE0 A;  4ZI7 E;  3AA7 B;  5G04 C;  2WWU A;  3JQ1 A;  2LSY A;  2J4B A;  3BEE A;  4XBF B;  3RKV A;  1PAQ A;  2WXK A;  3FTZ A;  4U0U A;  4CT0 A;  4I4T E;  5D0O D;  2LO6 A;  1QZ2 A;  5JDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...