1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
3D9NA 1HF8A 2DCPA 3ZYQA 1SZAA 2LO6A 1SZ9A 3G2WA 1JUQA 3ONLA 1JWGA 1HG5A 3D9KA 3D9LA 2L0IA 1DVPA 4GZDA 1H0AA 1HG2A 1HFAA 1UJJA 1JWFA 5J08A 4FLBA 1VDYA 1MHQA 3D9OA 3ZYLA 4Q96A 4JXTA 3CLJA 3ZYKA 2QY7A 3D9MA 4FU3A 2DIWA 3D9IA 5LP0A 2BF0X 3RRUA 3G2VA 3D9JA 4Q94A 5CMYA 1EYHA 2L0TB 4NACA 1X5BA 1ELKA 2MOWA 3D9PA 3G2SA 3LDZA 5LOZA 1PY1A 1INZA 1JPLA 1EDUA 2KM4A 3G2UA 4HFGA 1UJKA 2V8SE 5CMWA 3G2TA 3ONKA 4AVXA 1HX8A 1XGWA 4GZCA 1LF8A 3ZYMA
chains in the Genus database with same CATH superfamily
2JJ9A 3HKBE 3LSVA 4EZHA 5EZYE 2AW6A 2JQQA 5ANRA 3CSFA 3NZQA 5JREA 1UK5A 1UN8A 3BU8A 4BX8A 1MHQA 4PFOA 3SY2A 4HWIB 4EHMA 3AS8A 1HNWT 5LP0A 1ZHCA 4BT8A 2YN6A 4ANWA 3X2QE 3E08A 1HR0T 4XEIG 1U4QA 3LVRE 1MYOA 2HN2A 4U0SA 1MMGA 1WR0A 3N2KE 5G04J 3C51A 1AWCB 1WDYA 4YDWA 2XQ5A 1OWPA 2H7OA 2UXCT 1Z3XA 2XHEB 2F4VT 1J1JA 4HWCA 2IAKA 1TNYA 2WXIA 3AB3B 3MX3A 3HDXA 1VDYA 3K3NA 4ABNA 2BEDA 3C3QA 2ONDA 3GW4A 2ZMAA 5HXRA 5AQPB 2HHHT 1OXZA 3O4XE 4ZXLA 3SWHA 3UX4A 4I50E 2I0MA 1E7VA 3UU8A 4YXDA 2VKDA 2W4XA 3ZMSB 3Q73A 1HX8A 4GZCA 2IOSA 4I6JA 1IKND 4EIWA 2WZHA 2BVLA 4WNDA 4TUYE 3MKQA 2HR2A 5C2TA 4U33A 3EHRA 3QARA 3TKLB 1IYGA 2DLRA 1QQEA 3EABA 2KLQA 3OJAA 2ZIRA 4I9EA 4JXTA 4JI2T 4DX2A 4O4IE 3HRAA 3I1AA 3ZMUB 2V7IA 4L2YA 5M72A 2WSSV 4ISTA 3UM0A 4LFCT 1Z8UA 5AQQB 3R6NA 4UEMA 1V55E 4ACKA 5G55A 3PUZF 3OTOT 1EPUA 1MQSA 4EBAA 1N4RA 3IKOB 3DSWA 4LCTA 2L9BA 2NW7A 2X51A 4HFBA 1NWMX 5JMND 2JEKA 2YKSA 1K3ZD 1WYCA 4FJZA 4IULA 4EECA 2QFCA 4AY6A 1V54E 1OY3D 2YDRA 2AWIA 4BTAA 2W0GA 3RQUA 3ZT5A 5ABGA 2PQRA 4XX5A 5EX0A 4QXBB 2NYJA 3E32A 4O2BE 4U7IA 4DJAA 3VLEA 1OEDC 5KJMA 5C2YA 4I2WA 4EZJA 3EIJA 3PEVB 3IEEA 2LNIA 2GRLA 4EZKA 4CZZB 3CX8B 3PJAJ 2CMRA 4KZCA 3AAAB 4Z68A 4TX5A 2BKNA 5LJNA 4IYPA 4M7CA 3FUNA 3LY9A 4ZFHA 4HFCA 4ATZD 4APOA 4TUMA 2CM0A 4XAXB 2K3WA 2XUEA 4QH4A 5C3JA 3RKGA 2WXJA 4PFPA 1JCQA 2X9WA 2XSBA 1QSDA 4UWFA 5LX8A 4G25A 5HXSA 2MTQA 2I9CA 3QAQA 3ZT7A 2VSXE 4HRLA 2DBAA 3TAXA 2KWIB 4HLEA 2I6HA 4ASKA 3SZ7A 1HF8A 4G2AA 2HM8A 4ME2A 2YU1A 3TJPA 5F5WA 4EV6A 3HVEA 3UM1A 1N4SA 3RYHE 1FVFA 5HYAA 4P09A 5JDFA 2J4GA 4BSXA 3M65A 5EK4A 4AM9A 4XKCA 1T72A 2IW5B 3URZA 4G8LA 3UT7A 4NPPA 3ZC1A 3KEZA 3CVLA 2PG8A 2P9KG 3J7Yq 4DV3T 2VSYA 3EI0A 1I94T 3PZ1A 4AKIA 4GMJA 3DSTA 2J07A 5FJYA 1X81A 3CHRA 4GB9A 3RC3A 3FEXA 2B76A 5AQSB 3DWLG 3HKEE 2WXPA 4FLBA 1SQMA 1UURA 2VL0A 3FTUA 3MCXA 4IE4A 2FF4A 2WB2A 2YEVC 4U8VD 5JJ6A 5LJMA 3MYVA 4PAGA 3NBXX 4XI9A 4X66T 1G73A 1S94A 5A1LA 5CGMA 4CI1B 3L17A 3QNUA 2V7KA 4H9PC 4GTOA 4CRWA 3EUVA 5LNKA 2P2CP 4J8EA 3AEEA 3S7JA 1HX1B 1Y64B 2XCBA 4H63V 1T98A 2IOLA 3VTYA 2C5JA 4UF0B 3ASHA 4X5TA 2C0LA 2KATA 5E75A 3TWWA 2JLBA 1XDOA 3H3AA 2CRBA 4XKBA 3S7FA 2DYSE 2GRPB 2VGXB 1NL4A 5AAOA 3JUIA 2BBJA 2ZU6B 3LY8A 2GRRB 3UKUG 4X1KE 3PE3A 2XPKA 5FMNA 4PDXA 3BK9A 4I43B 4OFZA 5ENNA 2JMHA 3W9FA 3GWHA 3ZEFA 4HFVA 2V5FA 4B6XA 5AJDA 2AXVA 4GZ5A 1IQRA 5EK2A 4Q94A 3PNLB 5AQKB 5JA4D 2CE7A 3CVRA 3OPCA 4ZS2A 3V30A 4HRMB 4DR4T 3CHPA 5H6QB 1QBQA 1NFIE 1FJGT 3JCFA 5ENSD 4CDRA 5AQGB 2PJQA 1SZAA 2LO6A 2CXLA 3GA8A 4C90A 2PNNA 4NIKA 4WAFA 3AE9A 3PU8A 2CCQA 5LHIB 3SFZA 3FY4A 5HQ8A 4K0RA 1HTJF 4CXXA 3E0ZA 2W2UA 3HXDA 5JDQA 2EIJE 3DEPA 3PJAA 1TYQG 4U8HA 2BKPA 2QYUA 1NZNA 5L3FB 3AA1B 3HL6A 2HH7A 4PJMA 3ML8A 1KZOA 5ENQD 3AU5A 3TG4A 3MK7C 4YDOA 2ES0A 4J8FA 3QWWA 2B6CA 4RQIA 3FBZA 3AAAC 4IDPA 2KC7A 2L6BA 5ITZF 1WFDA 2IF4A 3RYCE 5JRCA 1MX4A 3I4GA 3JCKC 1Y6IA 2X38A 3SBTB 1MIWA 2X0LB 1YQ3A 4GTSA 3AJIA 3AS4A 3MV3B 2XAHB 5D0OD 3UUMA 3ASGA 2GGFA 5IYZE 4ZI3D 2AXUA 1LVKA 4GA0A 5AN8A 5DQVA 4DUIA 2XGOA 1TJCA 2UY1B 2D5UA 4GMLA 4UELA 4UWGA 2LSJA 3V5SA 1N36T 1PAQA 1ZBPA 3CMLA 3LEWA 2A5EA 4BETA 3O9XA 3L6AA 1W0AA 1YCSB 5FXZA 3APDA 3ZHEA 2PZIA 4DV0T 4WYVA 1YYHA 4BJNA 3W9GA 5CCLA 4O4JE 3QB5K 1TJFA 1N11A 2Z6EA 4FP7A 4AISA 5HXEA 4OYSA 3BEEA 4OVUA 4J2CA 3ZYMA 5HKPA 2V7JA 1HNZT 3KS2A 3MKQB 5BXUA 3OTNA 1SVXA 4CQIA 2VKJA 2DZNA 4KMOA 3K1SA 3B7RL 3RYFE 2CXDA 1DNPA 2WDRA 2X9YA 1YW0A 3Q9NC 2XQ3A 3CPZA 4P29A 3J9X1 5JJTA 3Q7AA 2MPKA 3Q5EA 3QKYA 3DJBA 4JI8T 5HEOA 1VCSA 3ZCIA 1OWNA 3UUXA 2LLYA 3G2TA 3C4XA 4PJJA 3GMIA 5EKQD 5CHEE 3ZW3A 1UX5A 5IWAT 1JUQA 1AP7A 4ILBA 3EAMA 3ETVA 3IV0A 1N4PA 1UW4B 2YOEA 4HN9A 5HEHA 3KV4A 3UKRG 5HAXA 3HA4A 3T8OA 3CIAA 3CLJA 4DI3A 5L3EB 4G11A 3ABKE 4F53A 3DPYA 4A3TA 3FH5A 3OXFA 3PUXF 3G2SA 1M62A 3OXGA 1X79A 2N2NA 4U31A 4DIDB 4YSYA 1UX4A 1XMOT 4TV8E 3SRZA 4IDOA 2DHRA 4DMVA 1H6KA 5HEGA 2C5IT 2K24A 3RPUA 5LCWC 4HOUA 4AKHA 1H7CA 3OVUA 1MX6A 2E9XD 4L9IA 1E8ZA 4O8SA 4A1GA 3Q5WA 2JQKA 2XQ6A 4UVAB 1H6PA 4XI0A 5JDHA 2J08A 2EIKE 3R84B 3NQPA 4A55A 3E30A 4YJ3E 3IEGA 4OAUC 3C4WA 4N3CA 3FHEA 4IDZA 4X65T 1KNPA 1WLXA 5JTGA 3RU0A 2Y8DA 4COFA 5JDGA 4DLQA 3I0QA 4I17A 3E37A 5AQFB 1TEZA 4GYOA 2NTXA 4DRXE 2BKGA 2LSUA 2WB5A 3FXDB 5FQ7A 3DRAA 4W9RA 3CVQA 4ANUA 1W3BA 2PFVA 1KNRA 3UQ7A 2UUBT 3PZ4A 2KZTB 2Y69E 1WY6A 4HEAA 4N2QA 5L4HA 2RA1A 3PUQA 4F6RC 4YSXA 4EZ4A 2CWOA 3Q49B 5CMWA 3MZLB 3FTXA 3A5XA 2X9XA 3ENEA 4QHOA 5LHHB 3O48A 2R6GF 4HLLA 2LSYA 2JPFA 3UXGA 5J90A 3KD7A 3N9OA 4JVSA 2IUBA 4GYRA 4I0UA 3PUKA 1KFYA 4FHJA 2VGYA 2ZM8A 4XZCA 2RD0A 2CBJA 3PZDA 2LUHA 3HI2A 3LDZA 3KSLA 2W63A 2E2EA 4PS7A 2Y0BG 4U3CA 3N9LA 3NBNB 1H6OA 1N33T 4LEUA 4KZ0A 4QH5A 4PK6A 4GCOA 3UT8A 2L9QA 3RSEG 2HO1A 5A23A 2J8SD 5JH7E 1TNUA 1HFAA 2NR4A 1BR0A 3TLVA 2F0YA 4QXHB 2XEHA 4EGWA 5BV1A 3N5LA 4JLEA 5JRCB 3TWTA 3I0OA 3V5UA 4JC8A 2JIWA 2K5BB 3UIPC 4CI3B 4B3TT 3ANWB 4JEUB 3ZRHA 2HPJA 3UM3A 2X6HA 3HKCE 3NWIA 3FU6A 4AXPA 4HI9A 5ABFA 1OWOA 1MJ0A 2A3DA 4A97A 2WCAA 5C1DA 3DEOA 5BPPA 5FY0A 4J7WA 3KV5A 2ZM0A 4LF7T 4P0AA 1TN8A 3D9KA 2HYZA 1HG2A 1OEDA 1TN6A 1U2VG 1JWFA 2E9XB 3PVLA 2ZM2A 3MXZA 3B7UX 4MKTA 2V6XA 3LJNA 2DIWA 3C98B 3MJWA 2L3LA 1BR2A 4JHRA 4NUUA 2LT3A 4EEBA 5FVLA 5HCMA 3IHVA 2KCLA 3RI5A 1Z3YA 4DV5T 3UFGA 2VB6A 1D0ZA 3FZHB 3SNXA 3PNTB 2PTFA 3ZMTB 3L82A 3JQ0A 1HG5A 2IC9A 3TLUA 2VSNA 5FYMA 3UTKA 3UINC 3VTXA 2Y48B 5ARFA 5FXVA 3PUSA 4I43A 3UM2A 5HWYA 3T5XA 4IL4A 2DNXA 5AQ7A 3IA3A 3EHMA 2QYJA 4G1TA 3ABVA 1TNZA 2H6IA 4I6GA 4J8YA 4K5AB 1MNEA 2BKOA 3SHFA 4URKA 3ASFA 2Q9QA 4C48B 5L3DB 2UUAT 2NXPA 3MA5A 4U7YA 4DR3T 2WXQA 2LKHA 4CEMA 5EX3A 4GOUA 4O4LE 3UQ4A 1OCZE 4WWOA 3TWSA 4UV9B 4CZ2D 5EIDA 2M6IA 2BG9C 3ZGQA 5LCWJ 2LSIA 3QWVA 3ULEG 3FTSA 2CEAA 3LS8A 3JUEA 4N5QA 3K3OA 2XTLA 4LMKA 3FXEB 2V4HC 5AQJB 5H7PA 1G3NB 1X9BA 1HNXT 2NW8A 3ZFWA 5FNVE 4PUCA 2R2LA 1ZU2A 1DU2A 2X9HA 3PREA 1EF1C 3NVOA 3TLWA 5A7DB 4Z90A 4AVXA 5LCYA 4KT6B 2OVFA 4JA7A 1O3XA 3H3MA 3N9MA 4UR9A 1SZ9A 2CFZA 2PM7A 3ISMC 5L3CB 3OYXA 1D0YA 4X1YE 4HTEA 4DR1T 3KDSE 3ASDA 4QKNA 2XGSA 4BA9A 5JJ7A 4ANXA 2WXMA 5BV0A 4IDQA 2H3RA 2UXXB 4BSZB 2IDOB 2QZAA 4NACA 2ZLYA 5ABFB 2B0OE 1ZB1A 3RRWA 3UFEA 4LFBT 3C4ZA 2P9NG 5KMGP 3RYIE 3V2OA 3HXEA 2FJEA 2HN1A 3DSVA 4AEZC 3S4UA 2WXRA 3AS5A 2FO7A 2FJDA 3UPVA 2FUPA 3OXLA 3AVSA 5AQNB 5EYLA 3UMVA 2KT9A 2VKHA 1N94A 1JNRA 2P9SG 3D9MA 3AG2E 1O1TA 3RIUC 3LPZA 3QOFA 3UUXB 2IO3C 2KINB 2X6FA 4HKAA 3VKGA 1FIOA 5M4YA 4I1OB 2ZXWE 2DCPA 3SFYA 3MKDA 3DTOA 3FZLB 3MKRA 3RIAA 5LGNB 3ESLA 3ZXSA 2WQHA 3Q7FA 4KVMA 4CI2B 5L4EA 4DBQA 5FY1A 3UUNA 4ZHQE 3P4SA 4J6IA 1NA3A 5A6CA 3L22A 4OAVB 5AQOB 3RRNB 2Y6XA 3C64A 4JI3T 3AA0B 3FH8A 3Q75A 5CRVA 4DNDA 4EB6E 2FJBA 2CG3A 3Q5MA 4MHCA 3CK8A 4GU5A 5FZRA 4OK0A 3FTZA 2DL1A 3CQCB 2A4ZA 2WMOA 3G06A 2IIUA 2LAIA 3ZNGA 3NRYA 4EPZA 3LFMA 5FVKA 3R7QA 4AQYT 3V79K 3UQ3A 3Q5DA 2LRLA 1VCTA 4DV2T 3FH7A 1D1CA 3HHMA 2X66A 2PQNA 5FQ6A 2P58C 3B7TA 4WNFA 4YVOA 2P9IG 2LOSA 3P50A 4QXCB 4ZZCA 2A9UA 4AV7A 4A5XA 4ILHB 5B3SE 4TNVA 1N0RA 4I1MA 4ANJA 4A63B 3KSQA 1D1BA 5DBKA 1BR1A 3ZC0A 2XENA 1UOHA 2LXLA 4M1PA 3F57A 2QYWA 3AVRA 3WI3A 4TXQA 3MACA 2LOPA 3PV0F 1HH8A 5AARA 3T5VA 4ZEYA 5LXTE 3APCA 3S7BA 3C72A 3NOCD 4CXYA 2K48A 2I1JA 4UI9K 2EHOA 1QYMA 3KEAA 3DPDA 5EDSA 3EUHA 3AEDA 3VR9A 4OX9T 4A3VA 4YDEA 2BS4A 4BAYB 1W9RA 5G2NA 2E9XC 3AU4A 3LXUX 3IBEA 5LOZA 3CK6A 4R7LA 3KVBA 4DX5D 4U07A 3LK3B 4AQFA 3FP3A 4H63H 4UXNB 3B57A 2UWJG 4FI5A 3L54A 5CA1E 2W62A 1U5PA 4DR7T 5FL1A 1WM5A 2ZGDA 1NA0A 1H0AA 3R9AB 4CYMD 3P2BA 4N2SA 3K9IA 5JDMA 2E2AA 2FULA 4LRZA 1MIYA 3T9KA 3ZKRA 2XQ0A 2OEVA 5DIZA 4JI7T 2VSOE 4I6EA 2VVNA 2QGSA 3JXIA 2WY2A 5CRUA 3I9YA 1HU3A 4MBQA 1LD7A 2VL8A 5CJ5A 3PURA 2WQYA 2X6IA 4MS6A 3C3RA 1IBMT 4OYKA 4E6HA 2P9PG 4O1OA 1GQEA 3UT4A 3L8RA 2BKKB 2UU9T 2UXBT 2BS2A 1D8EA 4NQ0A 3MGBA 3FWVA 2ETBA 4G63A 3TWRA 2YK0A 4Q25A 4KUMB 3EDTB 4B3MT 2LSKA 3OAWA 1HCIA 2P9UG 2J62A 3FU0A 4GCNA 4P0BA 3RGLA 2E5LT 3ONLC 3VKHA 5ANLA 1YMPA 1UUSA 5AQIB 4BX9A 3LVQE 4G2VA 4TV3A 4HVBA 2CLYB 1LTXA 3APFA 2KZ7B 4DK5A 3L09A 2BTDA 2MAWA 4YLHA 2CHOA 4IE6A 2CPTA 1G8XA 3NRXA 1KK7A 2UXDT 4GTTA 4JB8P 4UIGA 4GPMA 4HE8A 2P9LG 4ZI3C 3PE4A 3QUJA 5FINA 4UWHA 1KNZA 5KWDA 4GTMA 1UN9A 4CCAA 5CEDB 3LYAA 3VRBA 3AE7A 5BMVE 2WZIA 1IJ5A 2IQCA 2F8XK 4DR5T 2J9QA 3GN5B 4K5CA 4DLOA 5JR9C 2E5VA 5JR9B 5LMUT 1IXVA 4E85A 3QK0A 4ANVA 5ETWA 4HFEA 4WNGA 1HXIA 4MRUA 3ZYLA 1XDPA 4YTNA 3FZMB 5ABEA 1MIVA 2XM2A 2VWAA 5AQUB 3RRCA 2OEWA 3DSXA 1JPLA 4FA6A 3L13A 1DC2A 2IO2C 3U3IA 3U4TA 4GK0E 1XGWA 4ZZBA 4WZXA 1RW2A 3PZ3A 5AJLA 4RVBA 5FTPA 3RKVA 3RK6A 2WAUA 2XQYA 4G26A 4V3IA 2BS3A 3CIRA 1O1RA 1QNFA 4A56A 2M63A 5KNHD 1A17A 4HOSA 2MRIA 5D2MC 3TGOA 4UQZA 3HXCA 2XZDG 3AE3A 2KCKA 1NAFA 3CHOA 3CKCA 5BR8T 3CWZB 4GIWA 3JXJA 3S2AA 2VQ2A 2MOWA 5AQHB 3AA6B 2PL2A 3PS6A 3SO8A 4HWHA 4HBDA 3KFWX 4AQGA 2M6BA 3G2UA 3ONKA 2EINE 2BBHA 2D2SA 3T1HT 2DWGA 2V5CA 1MMNA 2V5QC 3PUYF 5C8YE 4HGAA 1GW6A 5HEUA 3HVEB 3ZVVA 2VGEA 5FT9A 4DV7T 1TNBA 1KF6A 3HYMB 1A5EA 4H7YA 4APFA 3ESKA 3SFXA 5J2UE 2ODUA 1OWAA 3F2EA 2AXDS 5ADXL 4PK4A 4TRQA 1WR6A 2WP9A 4DI4A 4MLPA 2RKKA 4AXHA 2YNQA 1SW6A 3RO3A 5CBNA 2DWKA 2WDQA 5L3GB 4JEHA 3NB2A 5HI7A 1T8BA 3HR0A 5EK3A 3SI5A 2XRZA 2BG9E 2J09A 3Q47B 4KP3C 3M3ZB 2HPLA 4O60A 3SGHA 2C2LA 3SFDA 4GZ6A 1DCQA 4UQYA 3J5QB 3B95A 3FUFA 3QNKA 3CKDA 4A1SA 1QUUA 1YQ4A 4XIFA 3WXXA 3ANWA 2XEVA 4JEUA 5IY5E 1BI7B 2X0HA 5AFUL 2LJLA 4AJWA 3CX6B 3L39A 3QWPA 1OEDB 2VVSA 1OT8A 3CSTA 5BXOA 3AXJB 5FIOA 4L9PA 4AKLA 1FPPA 3ZU7B 4WBOA 2H89A 2WWVA 2QY7A 3UUBA 2ZISA 1FEWA 3D9JA 2XHEA 1ELKA 2WBLA 3ZMVB 2EHOB 4HFGA 4KBQA 3MJXA 2IEJA 4C9BB 3CVXA 1N4QA 1YKEB 2VJ8A 2ZGGA 3TWUA 4B3RT 4GZ3A 1E8YA 4JV5T 4DUZT 4LF6T 2KBXA 4BT9A 2RPAA 4LF8T 3E4BA 3RO2A 3ULYA 3Q2MA 3JAEA 1FMVA 5HCJA 3TLSA 2W66A 1N34T 3UU5A 4UUCA 3FEYA 4HRNA 4PNIA 4B0ZA 5DABA 1LKXA 4H9OC 2C0MA 2KWHA 1UG3A 4YTMA 4X20E 5BT1A 4I1AA 4MALA 4YSZA 4KX6A 4EOZB 3NAWA 5EYPF 3B5MA 4WBNE 2XASB 4PJLA 2QVAA 5CFBA 4JZYA 1WG0A 2KSRA 3S7DA 2BG9A 3OBVE 2X3MA 4TV9E 4Z91A 1PC2A 4U72A 2H6HA 4YTPA 5F8PA 1AJ3A 1O5MA 4LFAT 1SA4A 4B8CB 4DVDA 4JI0T 4BERA 1FT1A 3CHQA 3ONXA 4L7TA 2ZM6T 4C0EA 4L0RA 3Q79A 4EEDA 1OCCE 5LMNT 3DBSA 1MZCA 1UJKA 2GROB 4U74A 3P7IA 4YJ2E 2R5SA 2XAFB 2CHXA 5H6RB 2FO1E 3CHMA 4IHJE 4F6RD 1Y8MA 4NXNT 5J0ZA 5GONE 2CHZA 5FZQA 4GYSA 4YDYA 2XEEA 4IE0A 3D9OA 5B1BE 4YY3T 4TNWA 3RRUA 4WW0A 3RX6A 3NZPA 4WWPA 4D10C 2GK9A 2G0UA 1KZPA 4N5CA 3CVWA 3FB2A 4IE5A 2R59A 4NXMT 5G05C 1NENA 3AXJA 3MZKB 4PW8A 1WAO1 3ZEFB 3W15B 5J2TE 5HEJA 1U3CA 4UI9C 3ZN3A 3MA9A 3X1DA 3C98A 2ODVA 2WVIA 2XSAA 3GZ1A 3KBTA 5DJQC 4E7SA 2D0UA 3AG4E 2D0TA 3BG0B 1LRZA 2XQAA 3FUIA 5BUZA 4FU3A 4TZ4C 3CV0A 5AQVB 4HNAD 3ZHEB 1WCRA 2AVPA 2WXKA 4CDMA 4YNDA 5B1AE 1E7UA 3D9PA 3ML9A 1E8XA 3U66A 4JHJA 4L2LA 2KM4A 3P1UA 4LNUD 4CN4A 4JD2G 3ZYQA 3RF1A 3LK42 3QB5A 3MEKA 4X62T 4XE0A 2WQ7A 3FULA 3ZKJA 1J5WA 2AXZA 3WAKA 1W09A 3UU6A 3VRAA 3EHZA 1H2VC 3CVNA 1VRBA 4EAHA 3P4QA 4OHFA 2I2OA 2M67A 4GKKT 3ABME 2ACZA 5HWXA 2CHWA 1ZV4X 3RKOA 3AE1A 1VOMA 1LF8A 5CCMA 3QB2A 3QDNA 3T8KA 5KXJA 2WM9A 3CKBA 3PDYA 1OCOE 3AA7B 1KEYA 2BZBA 4LMJA 1N52A 3J5PA 5BNWA 5L47A 5CBOA 3AE2A 3VLDA 2WXGA 4GKJT 1KPSB 5E0OA 4FHKA 2WU2A 3P4PA 3UULA 1W0BA 2H7VC 2LAHA 2L8KA 3KVAA 1S0PA 4BFRA 4CGWA 3P8CD 5LBQB 4A98A 3B13A 1H19A 5T4YA 1LVFA 3HXBA 4BTBA 5AQLB 4ZI7E 3ZPOA 2AE9A 3CX7B 1N9AA 4BY6A 1FVHA 4O1PA 2QA7A 4TUUA 3D0TA 4JUYA 3TG5A 2GW1A 5ARGA 2XZEA 2KCVA 5AIJA 3HKDE 4JBWF 1UGOA 5EILA 1YKHB 2FBNA 3IHYA 2UUCT 2DI4A 3ZCJA 2GRNB 4I4TE 3FZKB 4Z8XA 2XQ4A 2EHOD 2SPCA 3LCAA 4IDNA 2DZOA 3GZSA 4KVOA 3RIBA 3UTMA 2ACXA 4AKRB 2KNDA 4ERRA 3NKZA 1TNOA 5ENTD 2WS3A 2V6YA 1UJJA 3SBSA 2J1DG 1MX2A 4GTRA 5AQBA 2Y1LE 5KJNA 2I1KA 4UQXA 2F37A 3PUVF 2LSVA 3SD5A 4ACLA 4I9CA 4ISSA 2VTBA 4AIUA 5LP6E 2XRYA 4IL9A 3K8PC 1L5JA 4DX6D 2RFMA 3RIFA 3AEGA 2R05A 3EIQC 1E96B 3CHSA 3TL5A 1K8KG 4FJYA 4LG6A 5KJKA 4U2ZA 4GYWA 1H2UA 2HE0A 3A7MA 2V6YB 2FEZA 3I3NA 4FC8A 1YXRA 4U8YD 1XWMA 4B3ST 3QC1A 3CK7A 3TXMA 1INZA 3PH0C 4NIQA 2ETCA 3GN5A 5FXWA 3TLTA 3PZ2A 2IC6A 4AIFA 5KJLA 2N1GA 2KXPC 1D8DA 5G04C 2EQXA 1BU9A 2LSGA 4WUYA 3HXFA 2VTBB 4LSZE 1ZOYA 3Q9UC 1SHZC 2X6JA 4EZLA 2XAJB 5JDLA 4PS3A 4JI4T 2OLTA 4ADZA 2L0IA 2R02A 3HG0D 5AQAA 4WNEA 5DQWA 4FADA 4AP2A 3OKQA 4RLYA 3PE0A 4AY5A 2LHNA 3AG3E 1IQUA 3JQ1A 4F7AA 4ATGA 1ELWA 3FUKA 3SQVA 3D9HA 5JHBA 4DPRA 4JI5T 5G05J 3B7BA 2V5DA 3CK9A 2KMFA 3IXEA 1OCRE 4U0UA 2WMNA 2XPIA 4UV8B 3LKUA 3D3MA 5LBMA 4E7ZA 3RRMB 4JL0A 5J1GA 1P5QA 5AENA 4HI8A 5BW8C 3ZUVB 2V0PA 2RP4A 4JPSA 4KMCA 1JNZA 2OOEA 2WXNA 4YVQC 1HZ4A 2QRXA 2NWBA 1NEKA 3BG1B 4DR6T 2VQFT 3Q15A 4CT4A 3O4ZA 4U2YA 2MYOA 4JA9A 5FY7A 5L2LA 5ENRD 3EU5A 3ETUA 2N9DA 4UVBB 3RJVA 3LJCA 3O1JA 3JAFA 3OYZA 3ZLIA 4YHHT 2NOXA 2BVMA 5FWQA 3FTWA 3EHNA 4U96D 3FUDA 1L0VA 3UU4A 3VLFA 5LG3A 4AOFA 3ZSSA 3BQLA 4X64T 1MMAA 2L0TB 5CECB 4ZOLE 4F3VA 1E7PA 3U9WA 4MBGA 5AQRB 5LYJE 3VU7H 2J47A 2CLYC 1IAPA 3FFLA 4ILAA 4LF4T 1IHBA 4X1IE 4TXRA 3TWVA 2UXNB 2EIME 5ENPD 3LY7A 1WRDA 4JI6T 3CVUA 2LM9A 4XBFB 4U04A 3AAEB 2VK9A 1ZP0A 2NP9A 4JEHB 1S70B 1D9SA 1U3DA 3EJNA 3RHWA 5ENOD 1LD8A 2J4BA 5CA0E 2K9AA 4AKGA 1CHUA 4CDNA 4UWKA 3TXNA 2IU1A 2J4DA 3LBXA 3UI2A 1T7SA 2JRKA 1S64A 5LG4A 4CN1A 3H37A 3ONJA 1BLXB 5T8IA 4H9RC 3ZN0B 4DX1A 3UU3A 4NUVA 5FKYA 1EYHA 3BQKA 3FUJA 2DVWA 5JR9A 2MHKA 3MV2B 3JC6C 2IY0C 5FL0A 3PRZA 3FUMA 1KT0A 4Y6WA 3WG7E 3V31A 2R03A 4JI1T 3CVYA 3SFEA 5IUXA 3Q4AB 2DYRE 5FQ8A 1V9DA 4WNKA 2OA5A 4UI9J 4L5GA 4BWRA 1IJ6A 4DV1T 2CG2A 4HXIA 2XY8B 3TWQA 3NOGD 1CUNA 2WXFA 3AE6A 2GRQB 4TWFA 1JCSA 4HB5A 4HFIA 2IFUA 1TR4A 3ZJ2A 4JHKA 1H2TC 3N71A 1Z6TA 4LMLA 2KXPB 3RLFF 4U7EB 5D66A 3ONLA 4IN3B 2C0SA 4GTPA 5EIBE 4B94A 4HORA 5AQMB 1EZ3A 4ZI2C 4LNBA 2OVBA 4DBRA 3R7RA 1HS7A 4YHJA 3PUJA 4CXWA 1HE8A 5LGTB 1RZ4A 3FUEA 1N95A 3G2VA 2EHOC 3P4RA 1S63A 2D9DA 1TN7A 3ZIMA 3LK2B 3N2OA 2FI7A 3ZJ1A 2IMLA 1US7B 4G23A 2MOZA 1OWMA 3FBLA 2H6FA 1B89A 3L3PA 1XNRT 4L23A 3Q78A 4IE7A 4G8KA 3NZSA 3ZXPA 1ELRA 2L6JA 4H9QC 2IHR1 3F31A 5TAOA 2YDSA 1QZ2A 4O2AE 2ILRA 3FUHA 3N2GE 1OUVA 3EU9A 2Y4UA 3U64A 1D1AA 1PY1A 2YINA 2XAQB 5E76A 5JHAA 2LXMA 2IJGX 2XM1A 2BUGA 1ZEEA 3NZUA 2VQET 2XCCA 4J8DA 4EBAG 3KINB 2GRMA 4AQFC 3AAIA 4OVVA 3IBPA 4QX8B 3E33A 4HQDA 3PEUB 2V26A 3RC8A 2XS8A 4Q69A 2YHCA 3RQWA 3A8YC 5KBAA 5HRYA 2XJ7A 3ULQA 3ZYKA 4MLKA 3AE8A 3DXMG 2Y3AA 4L1BA 3BQOA 1NP7A 4FJOA 4ZS3A 4C0MA 4B8AA 3SF4A 3O1HA 2CBIA 1ZKEA 2V7LA 3TWXA 4UF0A 4CT0A 4GAAA 4GMRA 2FJAA 2WWUA 2A2FX 4KHZF 3SOLA 2Y4TA 3IHRA 1N0QA 2C5KT 1OWLA 4O4HE 2VGXA 2CA5A 1IBLT 4QH1A 2H88A 4BJMA 3L08A 5JVDE 4ILUA 3CVPA 1SA0E 3ZMZB 5KCMA 2LE8A 4KI0F 2EILE 2XGMA 3LJ3A 5CERB 3L16A 4H9SE 3N9QA 2PM6A 2WDVA 1HO8A 3AEAA 2PBIA 2VKOA 2YQ8A 4QX7B 4DMWA 2F8YA 5T3RA 4EQFA 3Q9DA 4AI6A 1O1SA 4U0ZA 2CWYA 5F3JA 2NTYA 2XQ8A 3RIUA 4KHPT 3D9LA 2Q9QB 3FZFB 2NW9A 5FXXA 1BR4A 3JADA 3HIZA 1E2AA 3PU3A 2A5UA 4RSYA 5KNGA 2LKGA 1M7KA 4ZI2D 4V1Av 1Z5SC 4DO0A 1YA0A 5CEAA 4GTVA 3EVYA 1MNDA 4ILIA 3T8MA 2JQHA 3ZT6A 4RG6A 4HOTA 2YHEA 3IF8B 3N9PA 5AQ9A 4F8HA 3KV9A 4N3BA 3EHQA 2JQ9A 1YD8G 2X0YA 4B89A 4B93B 3GZ2A 2A72A 2LRKA 2WXHA 2YU2A 4IRUA 3QJZA 4FULA 3I4RB 2P9BA 5J08A 3ASNE 3QC9A 4HWDA 3ZN1B 4N39A 3JC6D 3LBXB 4EYUA 3CR3A 4OYJA 4TWDA 1XNFA 5KX5E 3O1IA 1BD8A 2J49A 2W67A 4TN7B 2X67A 4ILCA 3KAEA 2XPZA 3U3WA 4U95D 1KLXA 1IBKT 2XS1A 4IIJE 4EXTA 3V2XA 4PH4B 4J0UA 3E34A 4X8QA 3EDVA 2WU5A 3PUGA 4UVCB 4DR2T 5IHYA 2B1EA 1BI8B 4Q96A 5L3BB 4H7XA 4BEPA 4UWLA 4K0UA 1XZYA 4Y6CA 5LFAA 5CMYA 3CQGB 4DUYT 1WYBA 2H6GA 3DP7A 1DCEA 4DX7D 4XZ4A 3E22E 3DXKG 2LM2A 3KBUA 3VR8A 2NSZA 3FDHA 1N32T 2YDQA 2WPVA 3C3OA 3L9TA 4KBMB 2JMKA 3RH3A 3FHNA 2BDEA 2W00A 1XMQT 2QC9A 3I5PA 1OEDE 3CQXC 2WQ6A 1E90A 3PDNA 2BF0X 1KT1A 2XQ9A 3B7SA 2I59A 2V7MA 3CGHA 4HS2A 1S35A 5HXCA 2X68A 5EN5D 5LOVE 3ZSTA 1XNQT 1Y01A 4I55E 3PTRB 3BQIA 4PS8A 1SA5A 2DCFA 1IZNB 4HFHA 4YT0A 4LF9T 4QQIA 4F1SA 4JYAT 1JWGA 3PUWF 4DV6T 4TXPA 4O6FA 3EDUA 3ASOE 2Q9QD 5ABHA 3FU3A 4NURA 3SS1A 4WWNA 1B7TA 4LERA 2Q9QC 2JABA 5LB7B 2LEHA 5JDNA 3LG7A 4DV4T 1E8WA 3DSUA 3AECA 4M3OA 1D0XA 5LHGB 3NF1A 2CFUA 2E9XA 4GA2A 1K1AA 4RG9A 1SE7A 3RAUA 1QLBA 2E8IA 3FTVA 4QFVA 4IGUA 2FBWA 3JYSA 1R8IA 1UCUA 3UT5E 1HS6A 1IHGA 4JW1A 3BUAA 3ABLE 4GTQA 1N54A 1J5ET 2MBGA 2BG9B 2IONA 1EDUA 2V8SV 2XAGB 5AQTB 2CHNA 4IREA 4IT4A 1OXJA 1SUMB 2V1DB 1FMWA 3AE4A 4EYYR 3K3QC 4GYYA 5LA6E 5FZSA 2Q7FA 3KV6A 1Z0PA 1I6ZA 3N9NA 2CXFA 1FCHA 3T1YT 1Q2ZA 4U63A 3AEFA 4I2ZA 3AEBA 4TWHA 4LUNU 4F1PA 4K0KT 4HOQA 2OV9A 2VURA 1NI1A 4GK5E 2MYSA 5FQ4A 4QWNB 5HS0A 4N78D 2R17C 2WXLA 3CVVA 3VHLA 2OV8A 3FTYA 5D0QD 2E0IA 4PK5A 2AJAA 2XZTG 2KZTA 5LGUB 4NRHB 2W61A 2ETAA 3P4WA 3QK6A 3C5RA 1DVPA 3CEQA 3AE5A 5CB4E 2NC9A 4J8SA 4FLHA 2RG8A 2DWZA 2UY1A 4CGVA 3Q5XA 4CN6A 1E1HB 3UIOC 3D9IA 4YFSA 4ILGA 3QOUA 4MFRA 4LF5T 5FP3A 1X5BA 3AG1E 2XQ7A 2V4LA 3GYZA 2OCCE 4H9NC 3U78A 4ZHBA 4KXKB 3I9WA 1FT2A 3ZPJA 1BPOA 3D9NA 3PUAA 3DSSA 5JQGE 3WAJA 4PJNA 4BESA 4HWFA 3C50A 2RFAA 3G2WA 4G24A 4HFDA 1MMDA 4KYOB 4P1NA 4GZDA 4N3AA 4K5BA 4C91A 3F6QA 3R9MA 2XPYA 2LHRA 2WXOA 1K1BA 4GPKA 2VYIA 4K03A 5HXHA 2VASA 3LDQB 2X6KA 4GA1A 5KDMC 1JCRA 3FU5A 2V8SE 4LNGA 5AYWD
chains in the Genus database with same CATH topology
2JJ9A 3HKBE 4EZHA 5EZYE 2AW6A 2JQQA 5ANRA 3CSFA 3NZQA 5JREA 1UN8A 4BX8A 1MHQA 4PFOA 3AS8A 5LP0A 1ZHCA 4BT8A 4ANWA 3E08A 1U4QA 3LVRE 4U0SA 1MMGA 3N2KE 5G04J 3C51A 1OWPA 2H7OA 1Z3XA 2XHEB 2IAKA 2WXIA 3AB3B 3MX3A 3HDXA 1VDYA 3K3NA 4ABNA 2ONDA 3GW4A 2ZMAA 5HXRA 1OXZA 3O4XE 3SWHA 3UX4A 4I50E 1E7VA 2VKDA 3ZMSB 1HX8A 4GZCA 2IOSA 4I6JA 4EIWA 2BVLA 4WNDA 4TUYE 3MKQA 2HR2A 3QARA 3TKLB 1IYGA 2DLRA 1QQEA 2KLQA 3OJAA 4I9EA 4JXTA 4O4IE 3I1AA 3ZMUB 2V7IA 4L2YA 5M72A 2WSSV 4ISTA 3R6NA 4UEMA 4ACKA 5G55A 1EPUA 1MQSA 4EBAA 3IKOB 4LCTA 2L9BA 2NW7A 2X51A 1NWMX 2JEKA 1WYCA 4FJZA 4IULA 4EECA 2QFCA 4AY6A 2AWIA 4BTAA 2W0GA 2PQRA 4XX5A 5EX0A 4QXBB 4O2BE 4DJAA 3VLEA 5KJMA 5C2YA 4I2WA 4EZJA 3EIJA 3PEVB 3IEEA 2LNIA 2GRLA 4EZKA 4CZZB 3CX8B 2CMRA 4KZCA 3AAAB 4TX5A 5LJNA 4IYPA 3FUNA 3LY9A 4APOA 2CM0A 4XAXB 2XUEA 2WXJA 4PFPA 2X9WA 1QSDA 4UWFA 5LX8A 4G25A 5HXSA 2MTQA 2I9CA 3QAQA 2VSXE 2DBAA 3TAXA 2KWIB 4HLEA 2I6HA 4ASKA 3SZ7A 1HF8A 4G2AA 2HM8A 4ME2A 2YU1A 3TJPA 3HVEA 3RYHE 1FVFA 5HYAA 4P09A 5JDFA 4BSXA 3M65A 5EK4A 4AM9A 4XKCA 2IW5B 3URZA 3UT7A 3ZC1A 3KEZA 3CVLA 2PG8A 3J7Yq 2VSYA 4AKIA 4GMJA 2J07A 5FJYA 3CHRA 4GB9A 3RC3A 3FEXA 3HKEE 2WXPA 4FLBA 1SQMA 3FTUA 3MCXA 4IE4A 2FF4A 2WB2A 2YEVC 5JJ6A 5LJMA 3MYVA 4PAGA 3NBXX 4XI9A 1G73A 1S94A 5A1LA 4CI1B 3L17A 2V7KA 4H9PC 4CRWA 5LNKA 4J8EA 3S7JA 1Y64B 2XCBA 4H63V 1T98A 2IOLA 3VTYA 2C5JA 4UF0B 3ASHA 2C0LA 2KATA 5E75A 2JLBA 3H3AA 4XKBA 3S7FA 2VGXB 3JUIA 2ZU6B 3LY8A 4X1KE 3PE3A 5FMNA 4PDXA 3BK9A 4I43B 4OFZA 5ENNA 2JMHA 3GWHA 3ZEFA 4HFVA 2V5FA 4B6XA 5AJDA 2AXVA 4GZ5A 1IQRA 5EK2A 4Q94A 3PNLB 2CE7A 3CVRA 4ZS2A 3CHPA 5H6QB 4CDRA 2PJQA 1SZAA 2LO6A 3GA8A 2CXLA 4C90A 4WAFA 3PU8A 2CCQA 5LHIB 3SFZA 3FY4A 5HQ8A 4K0RA 1HTJF 4CXXA 3E0ZA 5JDQA 4U8HA 1NZNA 5L3FB 3AA1B 3HL6A 2HH7A 4PJMA 3ML8A 3AU5A 3TG4A 3MK7C 2ES0A 4J8FA 3QWWA 3FBZA 2KC7A 2IF4A 3RYCE 5JRCA 3I4GA 3JCKC 1Y6IA 2X38A 3SBTB 1MIWA 2X0LB 3AS4A 3MV3B 2XAHB 5D0OD 3UUMA 3ASGA 2GGFA 5IYZE 4ZI3D 2AXUA 1LVKA 4GA0A 5DQVA 2XGOA 1TJCA 2UY1B 2D5UA 4GMLA 4UELA 4UWGA 2LSJA 3V5SA 1PAQA 1ZBPA 3CMLA 3LEWA 3O9XA 3L6AA 5FXZA 3APDA 3ZHEA 2PZIA 4BJNA 5CCLA 4O4JE 1TJFA 2Z6EA 4FP7A 4OYSA 5HXEA 4OVUA 3BEEA 4J2CA 3ZYMA 2V7JA 3KS2A 3MKQB 3OTNA 4CQIA 2VKJA 4KMOA 3B7RL 3RYFE 2CXDA 1DNPA 2X9YA 1YW0A 3CPZA 4P29A 3J9X1 5JJTA 3QKYA 3DJBA 3ZCIA 1OWNA 3UUXA 3G2TA 3C4XA 4PJJA 3GMIA 5EKQD 5CHEE 3ZW3A 1UX5A 1JUQA 3ETVA 3IV0A 1UW4B 4HN9A 3KV4A 5HAXA 3HA4A 3T8OA 3CIAA 3CLJA 4DI3A 5L3EB 4G11A 4F53A 4A3TA 3FH5A 3OXFA 3G2SA 3OXGA 1X79A 2N2NA 1UX4A 4TV8E 3SRZA 2DHRA 4DMVA 1H6KA 2C5IT 2K24A 3RPUA 5LCWC 4HOUA 4AKHA 1H7CA 2E9XD 4L9IA 1E8ZA 4O8SA 4A1GA 3Q5WA 4UVAB 4XI0A 5JDHA 2J08A 3R84B 3NQPA 4A55A 4YJ3E 3IEGA 3C4WA 4N3CA 3FHEA 4IDZA 3RU0A 1WLXA 2Y8DA 5JDGA 4DLQA 3I0QA 4I17A 1TEZA 4GYOA 2NTXA 2LSUA 3FXDB 5FQ7A 4W9RA 3CVQA 4ANUA 1W3BA 2PFVA 2KZTB 1WY6A 4HEAA 4N2QA 2RA1A 3PUQA 4F6RC 4EZ4A 2CWOA 3Q49B 5CMWA 3MZLB 3FTXA 3A5XA 2X9XA 3ENEA 4QHOA 5LHHB 3O48A 2LSYA 2JPFA 5J90A 3KD7A 3N9OA 4JVSA 4GYRA 3PUKA 4FHJA 2VGYA 2ZM8A 4XZCA 2RD0A 3PZDA 3HI2A 3LDZA 2W63A 2E2EA 4PS7A 3N9LA 4KZ0A 4LEUA 4PK6A 4GCOA 3UT8A 2L9QA 2HO1A 5A23A 5JH7E 1HFAA 1BR0A 4QXHB 5BV1A 3N5LA 4JLEA 5JRCB 3I0OA 3V5UA 4JC8A 2K5BB 4CI3B 3ANWB 4JEUB 3ZRHA 2HPJA 2X6HA 3HKCE 3FU6A 4AXPA 1OWOA 2A3DA 5C1DA 5BPPA 5FY0A 3KV5A 2ZM0A 3D9KA 4P0AA 2HYZA 1HG2A 1JWFA 2E9XB 3PVLA 2ZM2A 3MXZA 3B7UX 4MKTA 2DIWA 3C98B 3MJWA 2L3LA 1BR2A 4JHRA 4NUUA 2LT3A 3IHVA 2KCLA 1Z3YA 2VB6A 1D0ZA 3SNXA 3PNTB 3ZMTB 3JQ0A 1HG5A 2IC9A 2VSNA 5FYMA 3UTKA 3VTXA 2Y48B 5ARFA 5FXVA 3PUSA 4I43A 5HWYA 3T5XA 2DNXA 3EHMA 4G1TA 4I6GA 1MNEA 3SHFA 4URKA 3ASFA 2Q9QA 5L3DB 2NXPA 3MA5A 4CEMA 2WXQA 5EX3A 4GOUA 4O4LE 4WWOA 4UV9B 3ZGQA 5LCWJ 2LSIA 3QWVA 3FTSA 2CEAA 3LS8A 3K3OA 2XTLA 3FXEB 2NW8A 3ZFWA 5FNVE 4PUCA 1ZU2A 2X9HA 3PREA 1EF1C 5A7DB 4AVXA 5LCYA 4KT6B 2OVFA 4JA7A 1O3XA 3N9MA 1SZ9A 2CFZA 2PM7A 5L3CB 3OYXA 1D0YA 4X1YE 4HTEA 3KDSE 3ASDA 4QKNA 2XGSA 4BA9A 5JJ7A 4ANXA 2WXMA 5BV0A 2H3RA 2UXXB 4NACA 2ZLYA 3RRWA 3UFEA 3C4ZA 5KMGP 3RYIE 4AEZC 3S4UA 2WXRA 3AS5A 2FO7A 3UPVA 3OXLA 3AVSA 3UMVA 2KT9A 2VKHA 3D9MA 3LPZA 3UUXB 2X6FA 2KINB 4HKAA 3VKGA 1FIOA 5M4YA 4I1OB 2DCPA 3MKDA 3DTOA 3MKRA 5LGNB 3ESLA 3ZXSA 2WQHA 4KVMA 4CI2B 4DBQA 5FY1A 3UUNA 4ZHQE 4J6IA 1NA3A 5A6CA 3L22A 3RRNB 2Y6XA 3C64A 3AA0B 3FH8A 4DNDA 4EB6E 2CG3A 3Q5MA 4MHCA 3CK8A 4GU5A 5FZRA 4OK0A 3FTZA 3CQCB 2A4ZA 2WMOA 2LAIA 3NRYA 4EPZA 3LFMA 3R7QA 3UQ3A 3FH7A 1D1CA 3HHMA 2X66A 2PQNA 5FQ6A 2P58C 3B7TA 4WNFA 4YVOA 2LOSA 4QXCB 4AV7A 4ILHB 4I1MA 4ANJA 1D1BA 5DBKA 1BR1A 3ZC0A 4M1PA 3F57A 3AVRA 3WI3A 3MACA 2LOPA 1HH8A 3T5VA 5LXTE 3APCA 3S7BA 4CXYA 2K48A 2I1JA 4UI9K 2EHOA 3DPDA 5EDSA 3EUHA 4A3VA 4BAYB 5G2NA 2E9XC 3AU4A 3LXUX 3IBEA 5LOZA 4R7LA 3KVBA 4U07A 3LK3B 4AQFA 3FP3A 4H63H 4UXNB 3B57A 2UWJG 4FI5A 3L54A 5CA1E 2W62A 1U5PA 1WM5A 1NA0A 1H0AA 3R9AB 3P2BA 4N2SA 3K9IA 5JDMA 2FULA 4LRZA 1MIYA 2XQ0A 5DIZA 2VSOE 4I6EA 2QGSA 3I9YA 1HU3A 4MBQA 2VL8A 3PURA 2X6IA 4MS6A 4OYKA 4E6HA 3UT4A 4NQ0A 3MGBA 3FWVA 4G63A 2YK0A 4KUMB 3EDTB 2LSKA 3OAWA 4GCNA 1HCIA 3FU0A 4P0BA 3VKHA 5ANLA 4BX9A 3LVQE 4G2VA 4TV3A 4HVBA 2CLYB 3APFA 2KZ7B 4DK5A 3L09A 2BTDA 4YLHA 4IE6A 1G8XA 3NRXA 1KK7A 4UIGA 4HE8A 4ZI3C 3PE4A 3QUJA 4UWHA 1KNZA 4CCAA 1UN9A 3LYAA 5BMVE 1IJ5A 2IQCA 2J9QA 3GN5B 4E85A 4DLOA 5JR9C 5JR9B 3QK0A 4ANVA 5ETWA 4WNGA 1HXIA 4MRUA 3ZYLA 1MIVA 2VWAA 3RRCA 1JPLA 4FA6A 3L13A 3U3IA 3U4TA 4GK0E 1XGWA 5AJLA 4RVBA 5FTPA 3RKVA 3RK6A 2WAUA 2XQYA 4G26A 4V3IA 1QNFA 4A56A 2M63A 4HOSA 1A17A 2MRIA 3TGOA 4UQZA 2KCKA 1NAFA 3CHOA 3CKCA 3CWZB 4GIWA 3S2AA 2VQ2A 2MOWA 3AA6B 2PL2A 3PS6A 3KFWX 4AQGA 3G2UA 3ONKA 2D2SA 2DWGA 1MMNA 5C8YE 4HGAA 1GW6A 3ZVVA 3HVEB 5FT9A 3HYMB 4H7YA 4APFA 3ESKA 5J2UE 2ODUA 1OWAA 3F2EA 5ADXL 4PK4A 4TRQA 1WR6A 4DI4A 4MLPA 4AXHA 2YNQA 3RO3A 2DWKA 5L3GB 4JEHA 5HI7A 3HR0A 5EK3A 3SI5A 2XRZA 2J09A 3Q47B 4KP3C 2HPLA 3SGHA 2C2LA 4GZ6A 4UQYA 3FUFA 3QNKA 3CKDA 4A1SA 1QUUA 4XIFA 3WXXA 3ANWA 2XEVA 4JEUA 5AFUL 2LJLA 4AJWA 3CX6B 3QWPA 3CSTA 4AKLA 4WBOA 2QY7A 1FEWA 3D9JA 2XHEA 1ELKA 2WBLA 3ZMVB 2EHOB 4HFGA 4KBQA 3MJXA 4C9BB 3CVXA 1YKEB 2VJ8A 4GZ3A 1E8YA 4BT9A 3E4BA 3RO2A 3Q2MA 1FMVA 3FEYA 4PNIA 4B0ZA 5DABA 1LKXA 4H9OC 2C0MA 2KWHA 1UG3A 4X20E 5BT1A 4I1AA 4MALA 4EOZB 4WBNE 2XASB 4PJLA 4JZYA 3S7DA 3OBVE 2X3MA 4TV9E 1PC2A 4U72A 5F8PA 1AJ3A 4B8CB 4DVDA 3CHQA 3ONXA 4L7TA 4C0EA 4L0RA 3DBSA 1UJKA 4U74A 3P7IA 4YJ2E 2R5SA 2XAFB 2CHXA 5H6RB 3CHMA 4IHJE 1Y8MA 5GONE 2CHZA 5FZQA 4GYSA 4IE0A 3D9OA 3RRUA 4WW0A 3RX6A 3NZPA 4WWPA 4D10C 2GK9A 2G0UA 4N5CA 3CVWA 3FB2A 4IE5A 2R59A 5G05C 3MZKB 4PW8A 1WAO1 3ZEFB 3W15B 5J2TE 4UI9C 1U3CA 3ZN3A 3MA9A 3C98A 2ODVA 2WVIA 3GZ1A 3KBTA 5DJQC 4E7SA 2D0UA 2D0TA 3BG0B 1LRZA 3FUIA 5BUZA 4FU3A 4TZ4C 3CV0A 3ZHEB 2AVPA 2WXKA 4CDMA 4YNDA 1E7UA 3D9PA 3ML9A 1E8XA 3U66A 4JHJA 4L2LA 2KM4A 3P1UA 3ZYQA 3LK42 3MEKA 4XE0A 2WQ7A 3FULA 2AXZA 3WAKA 1H2VC 3CVNA 1VRBA 4EAHA 4OHFA 2I2OA 2M67A 5HWXA 2CHWA 1ZV4X 3RKOA 1VOMA 1LF8A 5CCMA 3QB2A 3QDNA 2WM9A 3CKBA 3PDYA 3AA7B 2BZBA 1N52A 5BNWA 3VLDA 2WXGA 5E0OA 4FHKA 3UULA 2H7VC 2LAHA 2L8KA 3KVAA 1S0PA 4BFRA 4CGWA 3P8CD 5LBQB 3B13A 1H19A 5T4YA 1LVFA 4BTBA 4ZI7E 3ZPOA 3CX7B 4BY6A 1FVHA 2QA7A 4TUUA 3D0TA 4JUYA 3TG5A 2GW1A 5ARGA 2KCVA 5AIJA 3HKDE 1YKHB 2FBNA 3IHYA 2DI4A 3ZCJA 4I4TE 4Z8XA 2EHOD 2SPCA 3LCAA 3GZSA 4KVOA 3RIBA 2ACXA 4AKRB 2KNDA 4ERRA 1UJJA 3SBSA 2J1DG 5KJNA 2I1KA 4UQXA 2LSVA 3SD5A 4ACLA 4I9CA 4ISSA 2VTBA 5LP6E 2XRYA 3K8PC 1L5JA 3EIQC 1E96B 3CHSA 3TL5A 4FJYA 5KJKA 4GYWA 1H2UA 2FEZA 3I3NA 4FC8A 3QC1A 1INZA 3CK7A 3TXMA 3PH0C 3GN5A 5FXWA 2IC6A 4AIFA 5KJLA 2N1GA 5G04C 2EQXA 2LSGA 4WUYA 2VTBB 4EZLA 1SHZC 2X6JA 2XAJB 5JDLA 4PS3A 4ADZA 2L0IA 4WNEA 5DQWA 4FADA 4AP2A 3OKQA 3PE0A 4AY5A 2LHNA 1IQUA 3JQ1A 4F7AA 4ATGA 1ELWA 3FUKA 5JHBA 4DPRA 5G05J 3CK9A 2KMFA 4U0UA 2WMNA 2XPIA 4UV8B 3LKUA 3D3MA 5LBMA 4E7ZA 3RRMB 4JL0A 5J1GA 1P5QA 5AENA 5BW8C 2V0PA 2RP4A 4JPSA 4KMCA 2WXNA 2OOEA 4YVQC 1HZ4A 2NWBA 3BG1B 3Q15A 4CT4A 3O4ZA 4JA9A 5FY7A 5L2LA 3ETUA 2N9DA 4UVBB 3RJVA 3LJCA 3O1JA 3OYZA 3ZLIA 2NOXA 2BVMA 5FWQA 3FTWA 3EHNA 3FUDA 3VLFA 4AOFA 3BQLA 1MMAA 2L0TB 4ZOLE 4F3VA 3U9WA 5LYJE 3VU7H 2CLYC 1IAPA 3FFLA 4X1IE 2UXNB 3LY7A 1WRDA 3CVUA 2LM9A 4XBFB 4U04A 3AAEB 2VK9A 2NP9A 4JEHB 1U3DA 3EJNA 2J4BA 5CA0E 2K9AA 4AKGA 4CDNA 4UWKA 3TXNA 2IU1A 2J4DA 3LBXA 2JRKA 5LG4A 3H37A 5T8IA 4H9RC 3ZN0B 4NUVA 1EYHA 3BQKA 3FUJA 5JR9A 2MHKA 3MV2B 3JC6C 3PRZA 3FUMA 1KT0A 4Y6WA 3CVYA 3Q4AB 5FQ8A 1V9DA 4WNKA 2OA5A 4UI9J 4L5GA 4BWRA 1IJ6A 2CG2A 4HXIA 1CUNA 2WXFA 2IFUA 3ZJ2A 4JHKA 1H2TC 3N71A 1Z6TA 2KXPB 3ONLA 4IN3B 2C0SA 4HORA 4B94A 1EZ3A 4ZI2C 2OVBA 4DBRA 3R7RA 1HS7A 4YHJA 3PUJA 4CXWA 1HE8A 5LGTB 3FUEA 3G2VA 2EHOC 3ZIMA 3LK2B 3N2OA 2FI7A 3ZJ1A 1US7B 4G23A 2MOZA 1OWMA 3FBLA 1B89A 3L3PA 4L23A 4IE7A 3NZSA 1ELRA 2L6JA 4H9QC 3F31A 5TAOA 1QZ2A 4O2AE 2ILRA 3FUHA 3N2GE 1OUVA 3U64A 2Y4UA 1D1AA 1PY1A 2YINA 2XAQB 5E76A 5JHAA 2IJGX 2BUGA 1ZEEA 3NZUA 4EBAG 2XCCA 4J8DA 3KINB 2GRMA 4AQFC 3AAIA 4OVVA 3IBPA 4QX8B 3PEUB 2V26A 3RC8A 4Q69A 2YHCA 3ULQA 3ZYKA 4MLKA 2Y3AA 4L1BA 1NP7A 4FJOA 4ZS3A 4C0MA 4B8AA 3SF4A 3O1HA 1ZKEA 2V7LA 4UF0A 4CT0A 4GAAA 2WWUA 2A2FX 3SOLA 2Y4TA 3IHRA 2C5KT 1OWLA 4O4HE 2VGXA 2CA5A 4BJMA 3L08A 5JVDE 4ILUA 3CVPA 1SA0E 3ZMZB 5KCMA 2LE8A 2XGMA 3LJ3A 3L16A 4H9SE 3N9QA 2PM6A 1HO8A 2PBIA 2VKOA 2YQ8A 4QX7B 4DMWA 4EQFA 5T3RA 3Q9DA 4AI6A 4U0ZA 2CWYA 5F3JA 2NTYA 3D9LA 2Q9QB 2NW9A 5FXXA 1BR4A 3HIZA 3PU3A 2A5UA 4RSYA 4ZI2D 4V1Av 4DO0A 1YA0A 3EVYA 1MNDA 4ILIA 3T8MA 4RG6A 4HOTA 2YHEA 3IF8B 3N9PA 3KV9A 4N3BA 1YD8G 4B89A 3GZ2A 2A72A 2WXHA 2YU2A 4IRUA 3QJZA 4FULA 3I4RB 2P9BA 5J08A 3QC9A 3ZN1B 4N39A 3JC6D 3LBXB 4EYUA 3CR3A 4OYJA 1XNFA 5KX5E 3O1IA 2J49A 4TN7B 2X67A 3KAEA 2XPZA 3U3WA 1KLXA 4IIJE 4EXTA 4PH4B 4J0UA 3EDVA 3PUGA 4UVCB 5IHYA 2B1EA 4Q96A 5L3BB 4H7XA 4UWLA 4K0UA 5LFAA 4Y6CA 5CMYA 3CQGB 1WYBA 3DP7A 4XZ4A 3E22E 3KBUA 2NSZA 3FDHA 2WPVA 4KBMB 2JMKA 3RH3A 3FHNA 2BDEA 2W00A 3I5PA 3CQXC 2WQ6A 1E90A 3PDNA 2BF0X 1KT1A 3B7SA 2I59A 2V7MA 3CGHA 4HS2A 1S35A 5HXCA 2X68A 5LOVE 4I55E 3PTRB 3BQIA 4PS8A 2DCFA 1IZNB 4F1SA 1JWGA 4O6FA 3EDUA 2Q9QD 3FU3A 4NURA 3SS1A 4WWNA 1B7TA 4LERA 2Q9QC 2LEHA 5JDNA 3LG7A 1E8WA 4M3OA 1D0XA 5LHGB 3NF1A 2CFUA 2E9XA 4GA2A 4RG9A 2E8IA 3FTVA 4QFVA 4IGUA 3JYSA 1UCUA 3UT5E 1HS6A 1IHGA 4JW1A 1N54A 2MBGA 2IONA 1EDUA 2XAGB 2V1DB 1FMWA 4EYYR 3K3QC 4GYYA 5LA6E 5FZSA 2Q7FA 3KV6A 1Z0PA 3N9NA 2CXFA 1FCHA 4U63A 4I2ZA 4LUNU 4HOQA 4GK5E 2MYSA 5FQ4A 4QWNB 4N78D 2R17C 2WXLA 3CVVA 3VHLA 2OV8A 3FTYA 5D0QD 2E0IA 4PK5A 2KZTA 5LGUB 4NRHB 2W61A 3QK6A 1DVPA 3CEQA 5CB4E 2NC9A 4J8SA 4FLHA 2RG8A 2UY1A 4CGVA 3Q5XA 1E1HB 3D9IA 4YFSA 4ILGA 3QOUA 4MFRA 5FP3A 1X5BA 2V4LA 3GYZA 4H9NC 3U78A 4KXKB 3I9WA 3ZPJA 1BPOA 3D9NA 3PUAA 5JQGE 3WAJA 4PJNA 3G2WA 3C50A 4G24A 1MMDA 4KYOB 4GZDA 4N3AA 4C91A 2XPYA 2LHRA 2WXOA 4GPKA 2VYIA 4K03A 5HXHA 2VASA 2X6KA 4GA1A 5KDMC 3FU5A 2V8SE 5AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9N A;  1HF8 A;  2DCP A;  3ZYQ A;  1SZA A;  2LO6 A;  1SZ9 A;  3G2W A;  1JUQ A;  3ONL A;  1JWG A;  1HG5 A;  3D9K A;  3D9L A;  2L0I A;  1DVP A;  4GZD A;  1H0A A;  1HG2 A;  1HFA A;  1UJJ A;  1JWF A;  5J08 A;  4FLB A;  1VDY A;  1MHQ A;  3D9O A;  3ZYL A;  4Q96 A;  4JXT A;  3CLJ A;  3ZYK A;  2QY7 A;  3D9M A;  4FU3 A;  2DIW A;  3D9I A;  5LP0 A;  2BF0 X;  3RRU A;  3G2V A;  3D9J A;  4Q94 A;  5CMY A;  1EYH A;  2L0T B;  4NAC A;  1X5B A;  1ELK A;  2MOW A;  3D9P A;  3G2S A;  3LDZ A;  5LOZ A;  1PY1 A;  1INZ A;  1JPL A;  1EDU A;  2KM4 A;  3G2U A;  4HFG A;  1UJK A;  2V8S E;  5CMW A;  3G2T A;  3ONK A;  4AVX A;  1HX8 A;  1XGW A;  4GZC A;  1LF8 A;  3ZYM A; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  3HKB E;  3LSV A;  4EZH A;  5EZY E;  2AW6 A;  2JQQ A;  5ANR A;  3CSF A;  3NZQ A;  5JRE A;  1UK5 A;  1UN8 A;  3BU8 A;  4BX8 A;  1MHQ A;  4PFO A;  3SY2 A;  4HWI B;  4EHM A;  3AS8 A;  1HNW T;  5LP0 A;  1ZHC A;  4BT8 A;  2YN6 A;  4ANW A;  3X2Q E;  3E08 A;  1HR0 T;  4XEI G;  1U4Q A;  3LVR E;  1MYO A;  2HN2 A;  4U0S A;  1MMG A;  1WR0 A;  3N2K E;  5G04 J;  3C51 A;  1AWC B;  1WDY A;  4YDW A;  2XQ5 A;  1OWP A;  2H7O A;  2UXC T;  1Z3X A;  2XHE B;  2F4V T;  1J1J A;  4HWC A;  2IAK A;  1TNY A;  2WXI A;  3AB3 B;  3MX3 A;  3HDX A;  1VDY A;  3K3N A;  4ABN A;  2BED A;  3C3Q A;  2OND A;  3GW4 A;  2ZMA A;  5HXR A;  5AQP B;  2HHH T;  1OXZ A;  3O4X E;  4ZXL A;  3SWH A;  3UX4 A;  4I50 E;  2I0M A;  1E7V A;  3UU8 A;  4YXD A;  2VKD A;  2W4X A;  3ZMS B;  3Q73 A;  1HX8 A;  4GZC A;  2IOS A;  4I6J A;  1IKN D;  4EIW A;  2WZH A;  2BVL A;  4WND A;  4TUY E;  3MKQ A;  2HR2 A;  5C2T A;  4U33 A;  3EHR A;  3QAR A;  3TKL B;  1IYG A;  2DLR A;  1QQE A;  3EAB A;  2KLQ A;  3OJA A;  2ZIR A;  4I9E A;  4JXT A;  4JI2 T;  4DX2 A;  4O4I E;  3HRA A;  3I1A A;  3ZMU B;  2V7I A;  4L2Y A;  5M72 A;  2WSS V;  4IST A;  3UM0 A;  4LFC T;  1Z8U A;  5AQQ B;  3R6N A;  4UEM A;  1V55 E;  4ACK A;  5G55 A;  3PUZ F;  3OTO T;  1EPU A;  1MQS A;  4EBA A;  1N4R A;  3IKO B;  3DSW A;  4LCT A;  2L9B A;  2NW7 A;  2X51 A;  4HFB A;  1NWM X;  5JMN D;  2JEK A;  2YKS A;  1K3Z D;  1WYC A;  4FJZ A;  4IUL A;  4EEC A;  2QFC A;  4AY6 A;  1V54 E;  1OY3 D;  2YDR A;  2AWI A;  4BTA A;  2W0G A;  3RQU A;  3ZT5 A;  5ABG A;  2PQR A;  4XX5 A;  5EX0 A;  4QXB B;  2NYJ A;  3E32 A;  4O2B E;  4U7I A;  4DJA A;  3VLE A;  1OED C;  5KJM A;  5C2Y A;  4I2W A;  4EZJ A;  3EIJ A;  3PEV B;  3IEE A;  2LNI A;  2GRL A;  4EZK A;  4CZZ B;  3CX8 B;  3PJA J;  2CMR A;  4KZC A;  3AAA B;  4Z68 A;  4TX5 A;  2BKN A;  5LJN A;  4IYP A;  4M7C A;  3FUN A;  3LY9 A;  4ZFH A;  4HFC A;  4ATZ D;  4APO A;  4TUM A;  2CM0 A;  4XAX B;  2K3W A;  2XUE A;  4QH4 A;  5C3J A;  3RKG A;  2WXJ A;  4PFP A;  1JCQ A;  2X9W A;  2XSB A;  1QSD A;  4UWF A;  5LX8 A;  4G25 A;  5HXS A;  2MTQ A;  2I9C A;  3QAQ A;  3ZT7 A;  2VSX E;  4HRL A;  2DBA A;  3TAX A;  2KWI B;  4HLE A;  2I6H A;  4ASK A;  3SZ7 A;  1HF8 A;  4G2A A;  2HM8 A;  4ME2 A;  2YU1 A;  3TJP A;  5F5W A;  4EV6 A;  3HVE A;  3UM1 A;  1N4S A;  3RYH E;  1FVF A;  5HYA A;  4P09 A;  5JDF A;  2J4G A;  4BSX A;  3M65 A;  5EK4 A;  4AM9 A;  4XKC A;  1T72 A;  2IW5 B;  3URZ A;  4G8L A;  3UT7 A;  4NPP A;  3ZC1 A;  3KEZ A;  3CVL A;  2PG8 A;  2P9K G;  3J7Y q;  4DV3 T;  2VSY A;  3EI0 A;  1I94 T;  3PZ1 A;  4AKI A;  4GMJ A;  3DST A;  2J07 A;  5FJY A;  1X81 A;  3CHR A;  4GB9 A;  3RC3 A;  3FEX A;  2B76 A;  5AQS B;  3DWL G;  3HKE E;  2WXP A;  4FLB A;  1SQM A;  1UUR A;  2VL0 A;  3FTU A;  3MCX A;  4IE4 A;  2FF4 A;  2WB2 A;  2YEV C;  4U8V D;  5JJ6 A;  5LJM A;  3MYV A;  4PAG A;  3NBX X;  4XI9 A;  4X66 T;  1G73 A;  1S94 A;  5A1L A;  5CGM A;  4CI1 B;  3L17 A;  3QNU A;  2V7K A;  4H9P C;  4GTO A;  4CRW A;  3EUV A;  5LNK A;  2P2C P;  4J8E A;  3AEE A;  3S7J A;  1HX1 B;  1Y64 B;  2XCB A;  4H63 V;  1T98 A;  2IOL A;  3VTY A;  2C5J A;  4UF0 B;  3ASH A;  4X5T A;  2C0L A;  2KAT A;  5E75 A;  3TWW A;  2JLB A;  1XDO A;  3H3A A;  2CRB A;  4XKB A;  3S7F A;  2DYS E;  2GRP B;  2VGX B;  1NL4 A;  5AAO A;  3JUI A;  2BBJ A;  2ZU6 B;  3LY8 A;  2GRR B;  3UKU G;  4X1K E;  3PE3 A;  2XPK A;  5FMN A;  4PDX A;  3BK9 A;  4I43 B;  4OFZ A;  5ENN A;  2JMH A;  3W9F A;  3GWH A;  3ZEF A;  4HFV A;  2V5F A;  4B6X A;  5AJD A;  2AXV A;  4GZ5 A;  1IQR A;  5EK2 A;  4Q94 A;  3PNL B;  5AQK B;  5JA4 D;  2CE7 A;  3CVR A;  3OPC A;  4ZS2 A;  3V30 A;  4HRM B;  4DR4 T;  3CHP A;  5H6Q B;  1QBQ A;  1NFI E;  1FJG T;  3JCF A;  5ENS D;  4CDR A;  5AQG B;  2PJQ A;  1SZA A;  2LO6 A;  2CXL A;  3GA8 A;  4C90 A;  2PNN A;  4NIK A;  4WAF A;  3AE9 A;  3PU8 A;  2CCQ A;  5LHI B;  3SFZ A;  3FY4 A;  5HQ8 A;  4K0R A;  1HTJ F;  4CXX A;  3E0Z A;  2W2U A;  3HXD A;  5JDQ A;  2EIJ E;  3DEP A;  3PJA A;  1TYQ G;  4U8H A;  2BKP A;  2QYU A;  1NZN A;  5L3F B;  3AA1 B;  3HL6 A;  2HH7 A;  4PJM A;  3ML8 A;  1KZO A;  5ENQ D;  3AU5 A;  3TG4 A;  3MK7 C;  4YDO A;  2ES0 A;  4J8F A;  3QWW A;  2B6C A;  4RQI A;  3FBZ A;  3AAA C;  4IDP A;  2KC7 A;  2L6B A;  5ITZ F;  1WFD A;  2IF4 A;  3RYC E;  5JRC A;  1MX4 A;  3I4G A;  3JCK C;  1Y6I A;  2X38 A;  3SBT B;  1MIW A;  2X0L B;  1YQ3 A;  4GTS A;  3AJI A;  3AS4 A;  3MV3 B;  2XAH B;  5D0O D;  3UUM A;  3ASG A;  2GGF A;  5IYZ E;  4ZI3 D;  2AXU A;  1LVK A;  4GA0 A;  5AN8 A;  5DQV A;  4DUI A;  2XGO A;  1TJC A;  2UY1 B;  2D5U A;  4GML A;  4UEL A;  4UWG A;  2LSJ A;  3V5S A;  1N36 T;  1PAQ A;  1ZBP A;  3CML A;  3LEW A;  2A5E A;  4BET A;  3O9X A;  3L6A A;  1W0A A;  1YCS B;  5FXZ A;  3APD A;  3ZHE A;  2PZI A;  4DV0 T;  4WYV A;  1YYH A;  4BJN A;  3W9G A;  5CCL A;  4O4J E;  3QB5 K;  1TJF A;  1N11 A;  2Z6E A;  4FP7 A;  4AIS A;  5HXE A;  4OYS A;  3BEE A;  4OVU A;  4J2C A;  3ZYM A;  5HKP A;  2V7J A;  1HNZ T;  3KS2 A;  3MKQ B;  5BXU A;  3OTN A;  1SVX A;  4CQI A;  2VKJ A;  2DZN A;  4KMO A;  3K1S A;  3B7R L;  3RYF E;  2CXD A;  1DNP A;  2WDR A;  2X9Y A;  1YW0 A;  3Q9N C;  2XQ3 A;  3CPZ A;  4P29 A;  3J9X 1;  5JJT A;  3Q7A A;  2MPK A;  3Q5E A;  3QKY A;  3DJB A;  4JI8 T;  5HEO A;  1VCS A;  3ZCI A;  1OWN A;  3UUX A;  2LLY A;  3G2T A;  3C4X A;  4PJJ A;  3GMI A;  5EKQ D;  5CHE E;  3ZW3 A;  1UX5 A;  5IWA T;  1JUQ A;  1AP7 A;  4ILB A;  3EAM A;  3ETV A;  3IV0 A;  1N4P A;  1UW4 B;  2YOE A;  4HN9 A;  5HEH A;  3KV4 A;  3UKR G;  5HAX A;  3HA4 A;  3T8O A;  3CIA A;  3CLJ A;  4DI3 A;  5L3E B;  4G11 A;  3ABK E;  4F53 A;  3DPY A;  4A3T A;  3FH5 A;  3OXF A;  3PUX F;  3G2S A;  1M62 A;  3OXG A;  1X79 A;  2N2N A;  4U31 A;  4DID B;  4YSY A;  1UX4 A;  1XMO T;  4TV8 E;  3SRZ A;  4IDO A;  2DHR A;  4DMV A;  1H6K A;  5HEG A;  2C5I T;  2K24 A;  3RPU A;  5LCW C;  4HOU A;  4AKH A;  1H7C A;  3OVU A;  1MX6 A;  2E9X D;  4L9I A;  1E8Z A;  4O8S A;  4A1G A;  3Q5W A;  2JQK A;  2XQ6 A;  4UVA B;  1H6P A;  4XI0 A;  5JDH A;  2J08 A;  2EIK E;  3R84 B;  3NQP A;  4A55 A;  3E30 A;  4YJ3 E;  3IEG A;  4OAU C;  3C4W A;  4N3C A;  3FHE A;  4IDZ A;  4X65 T;  1KNP A;  1WLX A;  5JTG A;  3RU0 A;  2Y8D A;  4COF A;  5JDG A;  4DLQ A;  3I0Q A;  4I17 A;  3E37 A;  5AQF B;  1TEZ A;  4GYO A;  2NTX A;  4DRX E;  2BKG A;  2LSU A;  2WB5 A;  3FXD B;  5FQ7 A;  3DRA A;  4W9R A;  3CVQ A;  4ANU A;  1W3B A;  2PFV A;  1KNR A;  3UQ7 A;  2UUB T;  3PZ4 A;  2KZT B;  2Y69 E;  1WY6 A;  4HEA A;  4N2Q A;  5L4H A;  2RA1 A;  3PUQ A;  4F6R C;  4YSX A;  4EZ4 A;  2CWO A;  3Q49 B;  5CMW A;  3MZL B;  3FTX A;  3A5X A;  2X9X A;  3ENE A;  4QHO A;  5LHH B;  3O48 A;  2R6G F;  4HLL A;  2LSY A;  2JPF A;  3UXG A;  5J90 A;  3KD7 A;  3N9O A;  4JVS A;  2IUB A;  4GYR A;  4I0U A;  3PUK A;  1KFY A;  4FHJ A;  2VGY A;  2ZM8 A;  4XZC A;  2RD0 A;  2CBJ A;  3PZD A;  2LUH A;  3HI2 A;  3LDZ A;  3KSL A;  2W63 A;  2E2E A;  4PS7 A;  2Y0B G;  4U3C A;  3N9L A;  3NBN B;  1H6O A;  1N33 T;  4LEU A;  4KZ0 A;  4QH5 A;  4PK6 A;  4GCO A;  3UT8 A;  2L9Q A;  3RSE G;  2HO1 A;  5A23 A;  2J8S D;  5JH7 E;  1TNU A;  1HFA A;  2NR4 A;  1BR0 A;  3TLV A;  2F0Y A;  4QXH B;  2XEH A;  4EGW A;  5BV1 A;  3N5L A;  4JLE A;  5JRC B;  3TWT A;  3I0O A;  3V5U A;  4JC8 A;  2JIW A;  2K5B B;  3UIP C;  4CI3 B;  4B3T T;  3ANW B;  4JEU B;  3ZRH A;  2HPJ A;  3UM3 A;  2X6H A;  3HKC E;  3NWI A;  3FU6 A;  4AXP A;  4HI9 A;  5ABF A;  1OWO A;  1MJ0 A;  2A3D A;  4A97 A;  2WCA A;  5C1D A;  3DEO A;  5BPP A;  5FY0 A;  4J7W A;  3KV5 A;  2ZM0 A;  4LF7 T;  4P0A A;  1TN8 A;  3D9K A;  2HYZ A;  1HG2 A;  1OED A;  1TN6 A;  1U2V G;  1JWF A;  2E9X B;  3PVL A;  2ZM2 A;  3MXZ A;  3B7U X;  4MKT A;  2V6X A;  3LJN A;  2DIW A;  3C98 B;  3MJW A;  2L3L A;  1BR2 A;  4JHR A;  4NUU A;  2LT3 A;  4EEB A;  5FVL A;  5HCM A;  3IHV A;  2KCL A;  3RI5 A;  1Z3Y A;  4DV5 T;  3UFG A;  2VB6 A;  1D0Z A;  3FZH B;  3SNX A;  3PNT B;  2PTF A;  3ZMT B;  3L82 A;  3JQ0 A;  1HG5 A;  2IC9 A;  3TLU A;  2VSN A;  5FYM A;  3UTK A;  3UIN C;  3VTX A;  2Y48 B;  5ARF A;  5FXV A;  3PUS A;  4I43 A;  3UM2 A;  5HWY A;  3T5X A;  4IL4 A;  2DNX A;  5AQ7 A;  3IA3 A;  3EHM A;  2QYJ A;  4G1T A;  3ABV A;  1TNZ A;  2H6I A;  4I6G A;  4J8Y A;  4K5A B;  1MNE A;  2BKO A;  3SHF A;  4URK A;  3ASF A;  2Q9Q A;  4C48 B;  5L3D B;  2UUA T;  2NXP A;  3MA5 A;  4U7Y A;  4DR3 T;  2WXQ A;  2LKH A;  4CEM A;  5EX3 A;  4GOU A;  4O4L E;  3UQ4 A;  1OCZ E;  4WWO A;  3TWS A;  4UV9 B;  4CZ2 D;  5EID A;  2M6I A;  2BG9 C;  3ZGQ A;  5LCW J;  2LSI A;  3QWV A;  3ULE G;  3FTS A;  2CEA A;  3LS8 A;  3JUE A;  4N5Q A;  3K3O A;  2XTL A;  4LMK A;  3FXE B;  2V4H C;  5AQJ B;  5H7P A;  1G3N B;  1X9B A;  1HNX T;  2NW8 A;  3ZFW A;  5FNV E;  4PUC A;  2R2L A;  1ZU2 A;  1DU2 A;  2X9H A;  3PRE A;  1EF1 C;  3NVO A;  3TLW A;  5A7D B;  4Z90 A;  4AVX A;  5LCY A;  4KT6 B;  2OVF A;  4JA7 A;  1O3X A;  3H3M A;  3N9M A;  4UR9 A;  1SZ9 A;  2CFZ A;  2PM7 A;  3ISM C;  5L3C B;  3OYX A;  1D0Y A;  4X1Y E;  4HTE A;  4DR1 T;  3KDS E;  3ASD A;  4QKN A;  2XGS A;  4BA9 A;  5JJ7 A;  4ANX A;  2WXM A;  5BV0 A;  4IDQ A;  2H3R A;  2UXX B;  4BSZ B;  2IDO B;  2QZA A;  4NAC A;  2ZLY A;  5ABF B;  2B0O E;  1ZB1 A;  3RRW A;  3UFE A;  4LFB T;  3C4Z A;  2P9N G;  5KMG P;  3RYI E;  3V2O A;  3HXE A;  2FJE A;  2HN1 A;  3DSV A;  4AEZ C;  3S4U A;  2WXR A;  3AS5 A;  2FO7 A;  2FJD A;  3UPV A;  2FUP A;  3OXL A;  3AVS A;  5AQN B;  5EYL A;  3UMV A;  2KT9 A;  2VKH A;  1N94 A;  1JNR A;  2P9S G;  3D9M A;  3AG2 E;  1O1T A;  3RIU C;  3LPZ A;  3QOF A;  3UUX B;  2IO3 C;  2KIN B;  2X6F A;  4HKA A;  3VKG A;  1FIO A;  5M4Y A;  4I1O B;  2ZXW E;  2DCP A;  3SFY A;  3MKD A;  3DTO A;  3FZL B;  3MKR A;  3RIA A;  5LGN B;  3ESL A;  3ZXS A;  2WQH A;  3Q7F A;  4KVM A;  4CI2 B;  5L4E A;  4DBQ A;  5FY1 A;  3UUN A;  4ZHQ E;  3P4S A;  4J6I A;  1NA3 A;  5A6C A;  3L22 A;  4OAV B;  5AQO B;  3RRN B;  2Y6X A;  3C64 A;  4JI3 T;  3AA0 B;  3FH8 A;  3Q75 A;  5CRV A;  4DND A;  4EB6 E;  2FJB A;  2CG3 A;  3Q5M A;  4MHC A;  3CK8 A;  4GU5 A;  5FZR A;  4OK0 A;  3FTZ A;  2DL1 A;  3CQC B;  2A4Z A;  2WMO A;  3G06 A;  2IIU A;  2LAI A;  3ZNG A;  3NRY A;  4EPZ A;  3LFM A;  5FVK A;  3R7Q A;  4AQY T;  3V79 K;  3UQ3 A;  3Q5D A;  2LRL A;  1VCT A;  4DV2 T;  3FH7 A;  1D1C A;  3HHM A;  2X66 A;  2PQN A;  5FQ6 A;  2P58 C;  3B7T A;  4WNF A;  4YVO A;  2P9I G;  2LOS A;  3P50 A;  4QXC B;  4ZZC A;  2A9U A;  4AV7 A;  4A5X A;  4ILH B;  5B3S E;  4TNV A;  1N0R A;  4I1M A;  4ANJ A;  4A63 B;  3KSQ A;  1D1B A;  5DBK A;  1BR1 A;  3ZC0 A;  2XEN A;  1UOH A;  2LXL A;  4M1P A;  3F57 A;  2QYW A;  3AVR A;  3WI3 A;  4TXQ A;  3MAC A;  2LOP A;  3PV0 F;  1HH8 A;  5AAR A;  3T5V A;  4ZEY A;  5LXT E;  3APC A;  3S7B A;  3C72 A;  3NOC D;  4CXY A;  2K48 A;  2I1J A;  4UI9 K;  2EHO A;  1QYM A;  3KEA A;  3DPD A;  5EDS A;  3EUH A;  3AED A;  3VR9 A;  4OX9 T;  4A3V A;  4YDE A;  2BS4 A;  4BAY B;  1W9R A;  5G2N A;  2E9X C;  3AU4 A;  3LXU X;  3IBE A;  5LOZ A;  3CK6 A;  4R7L A;  3KVB A;  4DX5 D;  4U07 A;  3LK3 B;  4AQF A;  3FP3 A;  4H63 H;  4UXN B;  3B57 A;  2UWJ G;  4FI5 A;  3L54 A;  5CA1 E;  2W62 A;  1U5P A;  4DR7 T;  5FL1 A;  1WM5 A;  2ZGD A;  1NA0 A;  1H0A A;  3R9A B;  4CYM D;  3P2B A;  4N2S A;  3K9I A;  5JDM A;  2E2A A;  2FUL A;  4LRZ A;  1MIY A;  3T9K A;  3ZKR A;  2XQ0 A;  2OEV A;  5DIZ A;  4JI7 T;  2VSO E;  4I6E A;  2VVN A;  2QGS A;  3JXI A;  2WY2 A;  5CRU A;  3I9Y A;  1HU3 A;  4MBQ A;  1LD7 A;  2VL8 A;  5CJ5 A;  3PUR A;  2WQY A;  2X6I A;  4MS6 A;  3C3R A;  1IBM T;  4OYK A;  4E6H A;  2P9P G;  4O1O A;  1GQE A;  3UT4 A;  3L8R A;  2BKK B;  2UU9 T;  2UXB T;  2BS2 A;  1D8E A;  4NQ0 A;  3MGB A;  3FWV A;  2ETB A;  4G63 A;  3TWR A;  2YK0 A;  4Q25 A;  4KUM B;  3EDT B;  4B3M T;  2LSK A;  3OAW A;  1HCI A;  2P9U G;  2J62 A;  3FU0 A;  4GCN A;  4P0B A;  3RGL A;  2E5L T;  3ONL C;  3VKH A;  5ANL A;  1YMP A;  1UUS A;  5AQI B;  4BX9 A;  3LVQ E;  4G2V A;  4TV3 A;  4HVB A;  2CLY B;  1LTX A;  3APF A;  2KZ7 B;  4DK5 A;  3L09 A;  2BTD A;  2MAW A;  4YLH A;  2CHO A;  4IE6 A;  2CPT A;  1G8X A;  3NRX A;  1KK7 A;  2UXD T;  4GTT A;  4JB8 P;  4UIG A;  4GPM A;  4HE8 A;  2P9L G;  4ZI3 C;  3PE4 A;  3QUJ A;  5FIN A;  4UWH A;  1KNZ A;  5KWD A;  4GTM A;  1UN9 A;  4CCA A;  5CED B;  3LYA A;  3VRB A;  3AE7 A;  5BMV E;  2WZI A;  1IJ5 A;  2IQC A;  2F8X K;  4DR5 T;  2J9Q A;  3GN5 B;  4K5C A;  4DLO A;  5JR9 C;  2E5V A;  5JR9 B;  5LMU T;  1IXV A;  4E85 A;  3QK0 A;  4ANV A;  5ETW A;  4HFE A;  4WNG A;  1HXI A;  4MRU A;  3ZYL A;  1XDP A;  4YTN A;  3FZM B;  5ABE A;  1MIV A;  2XM2 A;  2VWA A;  5AQU B;  3RRC A;  2OEW A;  3DSX A;  1JPL A;  4FA6 A;  3L13 A;  1DC2 A;  2IO2 C;  3U3I A;  3U4T A;  4GK0 E;  1XGW A;  4ZZB A;  4WZX A;  1RW2 A;  3PZ3 A;  5AJL A;  4RVB A;  5FTP A;  3RKV A;  3RK6 A;  2WAU A;  2XQY A;  4G26 A;  4V3I A;  2BS3 A;  3CIR A;  1O1R A;  1QNF A;  4A56 A;  2M63 A;  5KNH D;  1A17 A;  4HOS A;  2MRI A;  5D2M C;  3TGO A;  4UQZ A;  3HXC A;  2XZD G;  3AE3 A;  2KCK A;  1NAF A;  3CHO A;  3CKC A;  5BR8 T;  3CWZ B;  4GIW A;  3JXJ A;  3S2A A;  2VQ2 A;  2MOW A;  5AQH B;  3AA6 B;  2PL2 A;  3PS6 A;  3SO8 A;  4HWH A;  4HBD A;  3KFW X;  4AQG A;  2M6B A;  3G2U A;  3ONK A;  2EIN E;  2BBH A;  2D2S A;  3T1H T;  2DWG A;  2V5C A;  1MMN A;  2V5Q C;  3PUY F;  5C8Y E;  4HGA A;  1GW6 A;  5HEU A;  3HVE B;  3ZVV A;  2VGE A;  5FT9 A;  4DV7 T;  1TNB A;  1KF6 A;  3HYM B;  1A5E A;  4H7Y A;  4APF A;  3ESK A;  3SFX A;  5J2U E;  2ODU A;  1OWA A;  3F2E A;  2AXD S;  5ADX L;  4PK4 A;  4TRQ A;  1WR6 A;  2WP9 A;  4DI4 A;  4MLP A;  2RKK A;  4AXH A;  2YNQ A;  1SW6 A;  3RO3 A;  5CBN A;  2DWK A;  2WDQ A;  5L3G B;  4JEH A;  3NB2 A;  5HI7 A;  1T8B A;  3HR0 A;  5EK3 A;  3SI5 A;  2XRZ A;  2BG9 E;  2J09 A;  3Q47 B;  4KP3 C;  3M3Z B;  2HPL A;  4O60 A;  3SGH A;  2C2L A;  3SFD A;  4GZ6 A;  1DCQ A;  4UQY A;  3J5Q B;  3B95 A;  3FUF A;  3QNK A;  3CKD A;  4A1S A;  1QUU A;  1YQ4 A;  4XIF A;  3WXX A;  3ANW A;  2XEV A;  4JEU A;  5IY5 E;  1BI7 B;  2X0H A;  5AFU L;  2LJL A;  4AJW A;  3CX6 B;  3L39 A;  3QWP A;  1OED B;  2VVS A;  1OT8 A;  3CST A;  5BXO A;  3AXJ B;  5FIO A;  4L9P A;  4AKL A;  1FPP A;  3ZU7 B;  4WBO A;  2H89 A;  2WWV A;  2QY7 A;  3UUB A;  2ZIS A;  1FEW A;  3D9J A;  2XHE A;  1ELK A;  2WBL A;  3ZMV B;  2EHO B;  4HFG A;  4KBQ A;  3MJX A;  2IEJ A;  4C9B B;  3CVX A;  1N4Q A;  1YKE B;  2VJ8 A;  2ZGG A;  3TWU A;  4B3R T;  4GZ3 A;  1E8Y A;  4JV5 T;  4DUZ T;  4LF6 T;  2KBX A;  4BT9 A;  2RPA A;  4LF8 T;  3E4B A;  3RO2 A;  3ULY A;  3Q2M A;  3JAE A;  1FMV A;  5HCJ A;  3TLS A;  2W66 A;  1N34 T;  3UU5 A;  4UUC A;  3FEY A;  4HRN A;  4PNI A;  4B0Z A;  5DAB A;  1LKX A;  4H9O C;  2C0M A;  2KWH A;  1UG3 A;  4YTM A;  4X20 E;  5BT1 A;  4I1A A;  4MAL A;  4YSZ A;  4KX6 A;  4EOZ B;  3NAW A;  5EYP F;  3B5M A;  4WBN E;  2XAS B;  4PJL A;  2QVA A;  5CFB A;  4JZY A;  1WG0 A;  2KSR A;  3S7D A;  2BG9 A;  3OBV E;  2X3M A;  4TV9 E;  4Z91 A;  1PC2 A;  4U72 A;  2H6H A;  4YTP A;  5F8P A;  1AJ3 A;  1O5M A;  4LFA T;  1SA4 A;  4B8C B;  4DVD A;  4JI0 T;  4BER A;  1FT1 A;  3CHQ A;  3ONX A;  4L7T A;  2ZM6 T;  4C0E A;  4L0R A;  3Q79 A;  4EED A;  1OCC E;  5LMN T;  3DBS A;  1MZC A;  1UJK A;  2GRO B;  4U74 A;  3P7I A;  4YJ2 E;  2R5S A;  2XAF B;  2CHX A;  5H6R B;  2FO1 E;  3CHM A;  4IHJ E;  4F6R D;  1Y8M A;  4NXN T;  5J0Z A;  5GON E;  2CHZ A;  5FZQ A;  4GYS A;  4YDY A;  2XEE A;  4IE0 A;  3D9O A;  5B1B E;  4YY3 T;  4TNW A;  3RRU A;  4WW0 A;  3RX6 A;  3NZP A;  4WWP A;  4D10 C;  2GK9 A;  2G0U A;  1KZP A;  4N5C A;  3CVW A;  3FB2 A;  4IE5 A;  2R59 A;  4NXM T;  5G05 C;  1NEN A;  3AXJ A;  3MZK B;  4PW8 A;  1WAO 1;  3ZEF B;  3W15 B;  5J2T E;  5HEJ A;  1U3C A;  4UI9 C;  3ZN3 A;  3MA9 A;  3X1D A;  3C98 A;  2ODV A;  2WVI A;  2XSA A;  3GZ1 A;  3KBT A;  5DJQ C;  4E7S A;  2D0U A;  3AG4 E;  2D0T A;  3BG0 B;  1LRZ A;  2XQA A;  3FUI A;  5BUZ A;  4FU3 A;  4TZ4 C;  3CV0 A;  5AQV B;  4HNA D;  3ZHE B;  1WCR A;  2AVP A;  2WXK A;  4CDM A;  4YND A;  5B1A E;  1E7U A;  3D9P A;  3ML9 A;  1E8X A;  3U66 A;  4JHJ A;  4L2L A;  2KM4 A;  3P1U A;  4LNU D;  4CN4 A;  4JD2 G;  3ZYQ A;  3RF1 A;  3LK4 2;  3QB5 A;  3MEK A;  4X62 T;  4XE0 A;  2WQ7 A;  3FUL A;  3ZKJ A;  1J5W A;  2AXZ A;  3WAK A;  1W09 A;  3UU6 A;  3VRA A;  3EHZ A;  1H2V C;  3CVN A;  1VRB A;  4EAH A;  3P4Q A;  4OHF A;  2I2O A;  2M67 A;  4GKK T;  3ABM E;  2ACZ A;  5HWX A;  2CHW A;  1ZV4 X;  3RKO A;  3AE1 A;  1VOM A;  1LF8 A;  5CCM A;  3QB2 A;  3QDN A;  3T8K A;  5KXJ A;  2WM9 A;  3CKB A;  3PDY A;  1OCO E;  3AA7 B;  1KEY A;  2BZB A;  4LMJ A;  1N52 A;  3J5P A;  5BNW A;  5L47 A;  5CBO A;  3AE2 A;  3VLD A;  2WXG A;  4GKJ T;  1KPS B;  5E0O A;  4FHK A;  2WU2 A;  3P4P A;  3UUL A;  1W0B A;  2H7V C;  2LAH A;  2L8K A;  3KVA A;  1S0P A;  4BFR A;  4CGW A;  3P8C D;  5LBQ B;  4A98 A;  3B13 A;  1H19 A;  5T4Y A;  1LVF A;  3HXB A;  4BTB A;  5AQL B;  4ZI7 E;  3ZPO A;  2AE9 A;  3CX7 B;  1N9A A;  4BY6 A;  1FVH A;  4O1P A;  2QA7 A;  4TUU A;  3D0T A;  4JUY A;  3TG5 A;  2GW1 A;  5ARG A;  2XZE A;  2KCV A;  5AIJ A;  3HKD E;  4JBW F;  1UGO A;  5EIL A;  1YKH B;  2FBN A;  3IHY A;  2UUC T;  2DI4 A;  3ZCJ A;  2GRN B;  4I4T E;  3FZK B;  4Z8X A;  2XQ4 A;  2EHO D;  2SPC A;  3LCA A;  4IDN A;  2DZO A;  3GZS A;  4KVO A;  3RIB A;  3UTM A;  2ACX A;  4AKR B;  2KND A;  4ERR A;  3NKZ A;  1TNO A;  5ENT D;  2WS3 A;  2V6Y A;  1UJJ A;  3SBS A;  2J1D G;  1MX2 A;  4GTR A;  5AQB A;  2Y1L E;  5KJN A;  2I1K A;  4UQX A;  2F37 A;  3PUV F;  2LSV A;  3SD5 A;  4ACL A;  4I9C A;  4ISS A;  2VTB A;  4AIU A;  5LP6 E;  2XRY A;  4IL9 A;  3K8P C;  1L5J A;  4DX6 D;  2RFM A;  3RIF A;  3AEG A;  2R05 A;  3EIQ C;  1E96 B;  3CHS A;  3TL5 A;  1K8K G;  4FJY A;  4LG6 A;  5KJK A;  4U2Z A;  4GYW A;  1H2U A;  2HE0 A;  3A7M A;  2V6Y B;  2FEZ A;  3I3N A;  4FC8 A;  1YXR A;  4U8Y D;  1XWM A;  4B3S T;  3QC1 A;  3CK7 A;  3TXM A;  1INZ A;  3PH0 C;  4NIQ A;  2ETC A;  3GN5 A;  5FXW A;  3TLT A;  3PZ2 A;  2IC6 A;  4AIF A;  5KJL A;  2N1G A;  2KXP C;  1D8D A;  5G04 C;  2EQX A;  1BU9 A;  2LSG A;  4WUY A;  3HXF A;  2VTB B;  4LSZ E;  1ZOY A;  3Q9U C;  1SHZ C;  2X6J A;  4EZL A;  2XAJ B;  5JDL A;  4PS3 A;  4JI4 T;  2OLT A;  4ADZ A;  2L0I A;  2R02 A;  3HG0 D;  5AQA A;  4WNE A;  5DQW A;  4FAD A;  4AP2 A;  3OKQ A;  4RLY A;  3PE0 A;  4AY5 A;  2LHN A;  3AG3 E;  1IQU A;  3JQ1 A;  4F7A A;  4ATG A;  1ELW A;  3FUK A;  3SQV A;  3D9H A;  5JHB A;  4DPR A;  4JI5 T;  5G05 J;  3B7B A;  2V5D A;  3CK9 A;  2KMF A;  3IXE A;  1OCR E;  4U0U A;  2WMN A;  2XPI A;  4UV8 B;  3LKU A;  3D3M A;  5LBM A;  4E7Z A;  3RRM B;  4JL0 A;  5J1G A;  1P5Q A;  5AEN A;  4HI8 A;  5BW8 C;  3ZUV B;  2V0P A;  2RP4 A;  4JPS A;  4KMC A;  1JNZ A;  2OOE A;  2WXN A;  4YVQ C;  1HZ4 A;  2QRX A;  2NWB A;  1NEK A;  3BG1 B;  4DR6 T;  2VQF T;  3Q15 A;  4CT4 A;  3O4Z A;  4U2Y A;  2MYO A;  4JA9 A;  5FY7 A;  5L2L A;  5ENR D;  3EU5 A;  3ETU A;  2N9D A;  4UVB B;  3RJV A;  3LJC A;  3O1J A;  3JAF A;  3OYZ A;  3ZLI A;  4YHH T;  2NOX A;  2BVM A;  5FWQ A;  3FTW A;  3EHN A;  4U96 D;  3FUD A;  1L0V A;  3UU4 A;  3VLF A;  5LG3 A;  4AOF A;  3ZSS A;  3BQL A;  4X64 T;  1MMA A;  2L0T B;  5CEC B;  4ZOL E;  4F3V A;  1E7P A;  3U9W A;  4MBG A;  5AQR B;  5LYJ E;  3VU7 H;  2J47 A;  2CLY C;  1IAP A;  3FFL A;  4ILA A;  4LF4 T;  1IHB A;  4X1I E;  4TXR A;  3TWV A;  2UXN B;  2EIM E;  5ENP D;  3LY7 A;  1WRD A;  4JI6 T;  3CVU A;  2LM9 A;  4XBF B;  4U04 A;  3AAE B;  2VK9 A;  1ZP0 A;  2NP9 A;  4JEH B;  1S70 B;  1D9S A;  1U3D A;  3EJN A;  3RHW A;  5ENO D;  1LD8 A;  2J4B A;  5CA0 E;  2K9A A;  4AKG A;  1CHU A;  4CDN A;  4UWK A;  3TXN A;  2IU1 A;  2J4D A;  3LBX A;  3UI2 A;  1T7S A;  2JRK A;  1S64 A;  5LG4 A;  4CN1 A;  3H37 A;  3ONJ A;  1BLX B;  5T8I A;  4H9R C;  3ZN0 B;  4DX1 A;  3UU3 A;  4NUV A;  5FKY A;  1EYH A;  3BQK A;  3FUJ A;  2DVW A;  5JR9 A;  2MHK A;  3MV2 B;  3JC6 C;  2IY0 C;  5FL0 A;  3PRZ A;  3FUM A;  1KT0 A;  4Y6W A;  3WG7 E;  3V31 A;  2R03 A;  4JI1 T;  3CVY A;  3SFE A;  5IUX A;  3Q4A B;  2DYR E;  5FQ8 A;  1V9D A;  4WNK A;  2OA5 A;  4UI9 J;  4L5G A;  4BWR A;  1IJ6 A;  4DV1 T;  2CG2 A;  4HXI A;  2XY8 B;  3TWQ A;  3NOG D;  1CUN A;  2WXF A;  3AE6 A;  2GRQ B;  4TWF A;  1JCS A;  4HB5 A;  4HFI A;  2IFU A;  1TR4 A;  3ZJ2 A;  4JHK A;  1H2T C;  3N71 A;  1Z6T A;  4LML A;  2KXP B;  3RLF F;  4U7E B;  5D66 A;  3ONL A;  4IN3 B;  2C0S A;  4GTP A;  5EIB E;  4B94 A;  4HOR A;  5AQM B;  1EZ3 A;  4ZI2 C;  4LNB A;  2OVB A;  4DBR A;  3R7R A;  1HS7 A;  4YHJ A;  3PUJ A;  4CXW A;  1HE8 A;  5LGT B;  1RZ4 A;  3FUE A;  1N95 A;  3G2V A;  2EHO C;  3P4R A;  1S63 A;  2D9D A;  1TN7 A;  3ZIM A;  3LK2 B;  3N2O A;  2FI7 A;  3ZJ1 A;  2IML A;  1US7 B;  4G23 A;  2MOZ A;  1OWM A;  3FBL A;  2H6F A;  1B89 A;  3L3P A;  1XNR T;  4L23 A;  3Q78 A;  4IE7 A;  4G8K A;  3NZS A;  3ZXP A;  1ELR A;  2L6J A;  4H9Q C;  2IHR 1;  3F31 A;  5TAO A;  2YDS A;  1QZ2 A;  4O2A E;  2ILR A;  3FUH A;  3N2G E;  1OUV A;  3EU9 A;  2Y4U A;  3U64 A;  1D1A A;  1PY1 A;  2YIN A;  2XAQ B;  5E76 A;  5JHA A;  2LXM A;  2IJG X;  2XM1 A;  2BUG A;  1ZEE A;  3NZU A;  2VQE T;  2XCC A;  4J8D A;  4EBA G;  3KIN B;  2GRM A;  4AQF C;  3AAI A;  4OVV A;  3IBP A;  4QX8 B;  3E33 A;  4HQD A;  3PEU B;  2V26 A;  3RC8 A;  2XS8 A;  4Q69 A;  2YHC A;  3RQW A;  3A8Y C;  5KBA A;  5HRY A;  2XJ7 A;  3ULQ A;  3ZYK A;  4MLK A;  3AE8 A;  3DXM G;  2Y3A A;  4L1B A;  3BQO A;  1NP7 A;  4FJO A;  4ZS3 A;  4C0M A;  4B8A A;  3SF4 A;  3O1H A;  2CBI A;  1ZKE A;  2V7L A;  3TWX A;  4UF0 A;  4CT0 A;  4GAA A;  4GMR A;  2FJA A;  2WWU A;  2A2F X;  4KHZ F;  3SOL A;  2Y4T A;  3IHR A;  1N0Q A;  2C5K T;  1OWL A;  4O4H E;  2VGX A;  2CA5 A;  1IBL T;  4QH1 A;  2H88 A;  4BJM A;  3L08 A;  5JVD E;  4ILU A;  3CVP A;  1SA0 E;  3ZMZ B;  5KCM A;  2LE8 A;  4KI0 F;  2EIL E;  2XGM A;  3LJ3 A;  5CER B;  3L16 A;  4H9S E;  3N9Q A;  2PM6 A;  2WDV A;  1HO8 A;  3AEA A;  2PBI A;  2VKO A;  2YQ8 A;  4QX7 B;  4DMW A;  2F8Y A;  5T3R A;  4EQF A;  3Q9D A;  4AI6 A;  1O1S A;  4U0Z A;  2CWY A;  5F3J A;  2NTY A;  2XQ8 A;  3RIU A;  4KHP T;  3D9L A;  2Q9Q B;  3FZF B;  2NW9 A;  5FXX A;  1BR4 A;  3JAD A;  3HIZ A;  1E2A A;  3PU3 A;  2A5U A;  4RSY A;  5KNG A;  2LKG A;  1M7K A;  4ZI2 D;  4V1A v;  1Z5S C;  4DO0 A;  1YA0 A;  5CEA A;  4GTV A;  3EVY A;  1MND A;  4ILI A;  3T8M A;  2JQH A;  3ZT6 A;  4RG6 A;  4HOT A;  2YHE A;  3IF8 B;  3N9P A;  5AQ9 A;  4F8H A;  3KV9 A;  4N3B A;  3EHQ A;  2JQ9 A;  1YD8 G;  2X0Y A;  4B89 A;  4B93 B;  3GZ2 A;  2A72 A;  2LRK A;  2WXH A;  2YU2 A;  4IRU A;  3QJZ A;  4FUL A;  3I4R B;  2P9B A;  5J08 A;  3ASN E;  3QC9 A;  4HWD A;  3ZN1 B;  4N39 A;  3JC6 D;  3LBX B;  4EYU A;  3CR3 A;  4OYJ A;  4TWD A;  1XNF A;  5KX5 E;  3O1I A;  1BD8 A;  2J49 A;  2W67 A;  4TN7 B;  2X67 A;  4ILC A;  3KAE A;  2XPZ A;  3U3W A;  4U95 D;  1KLX A;  1IBK T;  2XS1 A;  4IIJ E;  4EXT A;  3V2X A;  4PH4 B;  4J0U A;  3E34 A;  4X8Q A;  3EDV A;  2WU5 A;  3PUG A;  4UVC B;  4DR2 T;  5IHY A;  2B1E A;  1BI8 B;  4Q96 A;  5L3B B;  4H7X A;  4BEP A;  4UWL A;  4K0U A;  1XZY A;  4Y6C A;  5LFA A;  5CMY A;  3CQG B;  4DUY T;  1WYB A;  2H6G A;  3DP7 A;  1DCE A;  4DX7 D;  4XZ4 A;  3E22 E;  3DXK G;  2LM2 A;  3KBU A;  3VR8 A;  2NSZ A;  3FDH A;  1N32 T;  2YDQ A;  2WPV A;  3C3O A;  3L9T A;  4KBM B;  2JMK A;  3RH3 A;  3FHN A;  2BDE A;  2W00 A;  1XMQ T;  2QC9 A;  3I5P A;  1OED E;  3CQX C;  2WQ6 A;  1E90 A;  3PDN A;  2BF0 X;  1KT1 A;  2XQ9 A;  3B7S A;  2I59 A;  2V7M A;  3CGH A;  4HS2 A;  1S35 A;  5HXC A;  2X68 A;  5EN5 D;  5LOV E;  3ZST A;  1XNQ T;  1Y01 A;  4I55 E;  3PTR B;  3BQI A;  4PS8 A;  1SA5 A;  2DCF A;  1IZN B;  4HFH A;  4YT0 A;  4LF9 T;  4QQI A;  4F1S A;  4JYA T;  1JWG A;  3PUW F;  4DV6 T;  4TXP A;  4O6F A;  3EDU A;  3ASO E;  2Q9Q D;  5ABH A;  3FU3 A;  4NUR A;  3SS1 A;  4WWN A;  1B7T A;  4LER A;  2Q9Q C;  2JAB A;  5LB7 B;  2LEH A;  5JDN A;  3LG7 A;  4DV4 T;  1E8W A;  3DSU A;  3AEC A;  4M3O A;  1D0X A;  5LHG B;  3NF1 A;  2CFU A;  2E9X A;  4GA2 A;  1K1A A;  4RG9 A;  1SE7 A;  3RAU A;  1QLB A;  2E8I A;  3FTV A;  4QFV A;  4IGU A;  2FBW A;  3JYS A;  1R8I A;  1UCU A;  3UT5 E;  1HS6 A;  1IHG A;  4JW1 A;  3BUA A;  3ABL E;  4GTQ A;  1N54 A;  1J5E T;  2MBG A;  2BG9 B;  2ION A;  1EDU A;  2V8S V;  2XAG B;  5AQT B;  2CHN A;  4IRE A;  4IT4 A;  1OXJ A;  1SUM B;  2V1D B;  1FMW A;  3AE4 A;  4EYY R;  3K3Q C;  4GYY A;  5LA6 E;  5FZS A;  2Q7F A;  3KV6 A;  1Z0P A;  1I6Z A;  3N9N A;  2CXF A;  1FCH A;  3T1Y T;  1Q2Z A;  4U63 A;  3AEF A;  4I2Z A;  3AEB A;  4TWH A;  4LUN U;  4F1P A;  4K0K T;  4HOQ A;  2OV9 A;  2VUR A;  1NI1 A;  4GK5 E;  2MYS A;  5FQ4 A;  4QWN B;  5HS0 A;  4N78 D;  2R17 C;  2WXL A;  3CVV A;  3VHL A;  2OV8 A;  3FTY A;  5D0Q D;  2E0I A;  4PK5 A;  2AJA A;  2XZT G;  2KZT A;  5LGU B;  4NRH B;  2W61 A;  2ETA A;  3P4W A;  3QK6 A;  3C5R A;  1DVP A;  3CEQ A;  3AE5 A;  5CB4 E;  2NC9 A;  4J8S A;  4FLH A;  2RG8 A;  2DWZ A;  2UY1 A;  4CGV A;  3Q5X A;  4CN6 A;  1E1H B;  3UIO C;  3D9I A;  4YFS A;  4ILG A;  3QOU A;  4MFR A;  4LF5 T;  5FP3 A;  1X5B A;  3AG1 E;  2XQ7 A;  2V4L A;  3GYZ A;  2OCC E;  4H9N C;  3U78 A;  4ZHB A;  4KXK B;  3I9W A;  1FT2 A;  3ZPJ A;  1BPO A;  3D9N A;  3PUA A;  3DSS A;  5JQG E;  3WAJ A;  4PJN A;  4BES A;  4HWF A;  3C50 A;  2RFA A;  3G2W A;  4G24 A;  4HFD A;  1MMD A;  4KYO B;  4P1N A;  4GZD A;  4N3A A;  4K5B A;  4C91 A;  3F6Q A;  3R9M A;  2XPY A;  2LHR A;  2WXO A;  1K1B A;  4GPK A;  2VYI A;  4K03 A;  5HXH A;  2VAS A;  3LDQ B;  2X6K A;  4GA1 A;  5KDM C;  1JCR A;  3FU5 A;  2V8S E;  4LNG A;  5AYW D; 
#chains in the Genus database with same CATH homology
 2JJ9 A;  3HKB E;  4EZH A;  5EZY E;  2AW6 A;  2JQQ A;  5ANR A;  3CSF A;  3NZQ A;  5JRE A;  1UN8 A;  4BX8 A;  1MHQ A;  4PFO A;  3AS8 A;  5LP0 A;  1ZHC A;  4BT8 A;  4ANW A;  3E08 A;  1U4Q A;  3LVR E;  4U0S A;  1MMG A;  3N2K E;  5G04 J;  3C51 A;  1OWP A;  2H7O A;  1Z3X A;  2XHE B;  2IAK A;  2WXI A;  3AB3 B;  3MX3 A;  3HDX A;  1VDY A;  3K3N A;  4ABN A;  2OND A;  3GW4 A;  2ZMA A;  5HXR A;  1OXZ A;  3O4X E;  3SWH A;  3UX4 A;  4I50 E;  1E7V A;  2VKD A;  3ZMS B;  1HX8 A;  4GZC A;  2IOS A;  4I6J A;  4EIW A;  2BVL A;  4WND A;  4TUY E;  3MKQ A;  2HR2 A;  3QAR A;  3TKL B;  1IYG A;  2DLR A;  1QQE A;  2KLQ A;  3OJA A;  4I9E A;  4JXT A;  4O4I E;  3I1A A;  3ZMU B;  2V7I A;  4L2Y A;  5M72 A;  2WSS V;  4IST A;  3R6N A;  4UEM A;  4ACK A;  5G55 A;  1EPU A;  1MQS A;  4EBA A;  3IKO B;  4LCT A;  2L9B A;  2NW7 A;  2X51 A;  1NWM X;  2JEK A;  1WYC A;  4FJZ A;  4IUL A;  4EEC A;  2QFC A;  4AY6 A;  2AWI A;  4BTA A;  2W0G A;  2PQR A;  4XX5 A;  5EX0 A;  4QXB B;  4O2B E;  4DJA A;  3VLE A;  5KJM A;  5C2Y A;  4I2W A;  4EZJ A;  3EIJ A;  3PEV B;  3IEE A;  2LNI A;  2GRL A;  4EZK A;  4CZZ B;  3CX8 B;  2CMR A;  4KZC A;  3AAA B;  4TX5 A;  5LJN A;  4IYP A;  3FUN A;  3LY9 A;  4APO A;  2CM0 A;  4XAX B;  2XUE A;  2WXJ A;  4PFP A;  2X9W A;  1QSD A;  4UWF A;  5LX8 A;  4G25 A;  5HXS A;  2MTQ A;  2I9C A;  3QAQ A;  2VSX E;  2DBA A;  3TAX A;  2KWI B;  4HLE A;  2I6H A;  4ASK A;  3SZ7 A;  1HF8 A;  4G2A A;  2HM8 A;  4ME2 A;  2YU1 A;  3TJP A;  3HVE A;  3RYH E;  1FVF A;  5HYA A;  4P09 A;  5JDF A;  4BSX A;  3M65 A;  5EK4 A;  4AM9 A;  4XKC A;  2IW5 B;  3URZ A;  3UT7 A;  3ZC1 A;  3KEZ A;  3CVL A;  2PG8 A;  3J7Y q;  2VSY A;  4AKI A;  4GMJ A;  2J07 A;  5FJY A;  3CHR A;  4GB9 A;  3RC3 A;  3FEX A;  3HKE E;  2WXP A;  4FLB A;  1SQM A;  3FTU A;  3MCX A;  4IE4 A;  2FF4 A;  2WB2 A;  2YEV C;  5JJ6 A;  5LJM A;  3MYV A;  4PAG A;  3NBX X;  4XI9 A;  1G73 A;  1S94 A;  5A1L A;  4CI1 B;  3L17 A;  2V7K A;  4H9P C;  4CRW A;  5LNK A;  4J8E A;  3S7J A;  1Y64 B;  2XCB A;  4H63 V;  1T98 A;  2IOL A;  3VTY A;  2C5J A;  4UF0 B;  3ASH A;  2C0L A;  2KAT A;  5E75 A;  2JLB A;  3H3A A;  4XKB A;  3S7F A;  2VGX B;  3JUI A;  2ZU6 B;  3LY8 A;  4X1K E;  3PE3 A;  5FMN A;  4PDX A;  3BK9 A;  4I43 B;  4OFZ A;  5ENN A;  2JMH A;  3GWH A;  3ZEF A;  4HFV A;  2V5F A;  4B6X A;  5AJD A;  2AXV A;  4GZ5 A;  1IQR A;  5EK2 A;  4Q94 A;  3PNL B;  2CE7 A;  3CVR A;  4ZS2 A;  3CHP A;  5H6Q B;  4CDR A;  2PJQ A;  1SZA A;  2LO6 A;  3GA8 A;  2CXL A;  4C90 A;  4WAF A;  3PU8 A;  2CCQ A;  5LHI B;  3SFZ A;  3FY4 A;  5HQ8 A;  4K0R A;  1HTJ F;  4CXX A;  3E0Z A;  5JDQ A;  4U8H A;  1NZN A;  5L3F B;  3AA1 B;  3HL6 A;  2HH7 A;  4PJM A;  3ML8 A;  3AU5 A;  3TG4 A;  3MK7 C;  2ES0 A;  4J8F A;  3QWW A;  3FBZ A;  2KC7 A;  2IF4 A;  3RYC E;  5JRC A;  3I4G A;  3JCK C;  1Y6I A;  2X38 A;  3SBT B;  1MIW A;  2X0L B;  3AS4 A;  3MV3 B;  2XAH B;  5D0O D;  3UUM A;  3ASG A;  2GGF A;  5IYZ E;  4ZI3 D;  2AXU A;  1LVK A;  4GA0 A;  5DQV A;  2XGO A;  1TJC A;  2UY1 B;  2D5U A;  4GML A;  4UEL A;  4UWG A;  2LSJ A;  3V5S A;  1PAQ A;  1ZBP A;  3CML A;  3LEW A;  3O9X A;  3L6A A;  5FXZ A;  3APD A;  3ZHE A;  2PZI A;  4BJN A;  5CCL A;  4O4J E;  1TJF A;  2Z6E A;  4FP7 A;  4OYS A;  5HXE A;  4OVU A;  3BEE A;  4J2C A;  3ZYM A;  2V7J A;  3KS2 A;  3MKQ B;  3OTN A;  4CQI A;  2VKJ A;  4KMO A;  3B7R L;  3RYF E;  2CXD A;  1DNP A;  2X9Y A;  1YW0 A;  3CPZ A;  4P29 A;  3J9X 1;  5JJT A;  3QKY A;  3DJB A;  3ZCI A;  1OWN A;  3UUX A;  3G2T A;  3C4X A;  4PJJ A;  3GMI A;  5EKQ D;  5CHE E;  3ZW3 A;  1UX5 A;  1JUQ A;  3ETV A;  3IV0 A;  1UW4 B;  4HN9 A;  3KV4 A;  5HAX A;  3HA4 A;  3T8O A;  3CIA A;  3CLJ A;  4DI3 A;  5L3E B;  4G11 A;  4F53 A;  4A3T A;  3FH5 A;  3OXF A;  3G2S A;  3OXG A;  1X79 A;  2N2N A;  1UX4 A;  4TV8 E;  3SRZ A;  2DHR A;  4DMV A;  1H6K A;  2C5I T;  2K24 A;  3RPU A;  5LCW C;  4HOU A;  4AKH A;  1H7C A;  2E9X D;  4L9I A;  1E8Z A;  4O8S A;  4A1G A;  3Q5W A;  4UVA B;  4XI0 A;  5JDH A;  2J08 A;  3R84 B;  3NQP A;  4A55 A;  4YJ3 E;  3IEG A;  3C4W A;  4N3C A;  3FHE A;  4IDZ A;  3RU0 A;  1WLX A;  2Y8D A;  5JDG A;  4DLQ A;  3I0Q A;  4I17 A;  1TEZ A;  4GYO A;  2NTX A;  2LSU A;  3FXD B;  5FQ7 A;  4W9R A;  3CVQ A;  4ANU A;  1W3B A;  2PFV A;  2KZT B;  1WY6 A;  4HEA A;  4N2Q A;  2RA1 A;  3PUQ A;  4F6R C;  4EZ4 A;  2CWO A;  3Q49 B;  5CMW A;  3MZL B;  3FTX A;  3A5X A;  2X9X A;  3ENE A;  4QHO A;  5LHH B;  3O48 A;  2LSY A;  2JPF A;  5J90 A;  3KD7 A;  3N9O A;  4JVS A;  4GYR A;  3PUK A;  4FHJ A;  2VGY A;  2ZM8 A;  4XZC A;  2RD0 A;  3PZD A;  3HI2 A;  3LDZ A;  2W63 A;  2E2E A;  4PS7 A;  3N9L A;  4KZ0 A;  4LEU A;  4PK6 A;  4GCO A;  3UT8 A;  2L9Q A;  2HO1 A;  5A23 A;  5JH7 E;  1HFA A;  1BR0 A;  4QXH B;  5BV1 A;  3N5L A;  4JLE A;  5JRC B;  3I0O A;  3V5U A;  4JC8 A;  2K5B B;  4CI3 B;  3ANW B;  4JEU B;  3ZRH A;  2HPJ A;  2X6H A;  3HKC E;  3FU6 A;  4AXP A;  1OWO A;  2A3D A;  5C1D A;  5BPP A;  5FY0 A;  3KV5 A;  2ZM0 A;  3D9K A;  4P0A A;  2HYZ A;  1HG2 A;  1JWF A;  2E9X B;  3PVL A;  2ZM2 A;  3MXZ A;  3B7U X;  4MKT A;  2DIW A;  3C98 B;  3MJW A;  2L3L A;  1BR2 A;  4JHR A;  4NUU A;  2LT3 A;  3IHV A;  2KCL A;  1Z3Y A;  2VB6 A;  1D0Z A;  3SNX A;  3PNT B;  3ZMT B;  3JQ0 A;  1HG5 A;  2IC9 A;  2VSN A;  5FYM A;  3UTK A;  3VTX A;  2Y48 B;  5ARF A;  5FXV A;  3PUS A;  4I43 A;  5HWY A;  3T5X A;  2DNX A;  3EHM A;  4G1T A;  4I6G A;  1MNE A;  3SHF A;  4URK A;  3ASF A;  2Q9Q A;  5L3D B;  2NXP A;  3MA5 A;  4CEM A;  2WXQ A;  5EX3 A;  4GOU A;  4O4L E;  4WWO A;  4UV9 B;  3ZGQ A;  5LCW J;  2LSI A;  3QWV A;  3FTS A;  2CEA A;  3LS8 A;  3K3O A;  2XTL A;  3FXE B;  2NW8 A;  3ZFW A;  5FNV E;  4PUC A;  1ZU2 A;  2X9H A;  3PRE A;  1EF1 C;  5A7D B;  4AVX A;  5LCY A;  4KT6 B;  2OVF A;  4JA7 A;  1O3X A;  3N9M A;  1SZ9 A;  2CFZ A;  2PM7 A;  5L3C B;  3OYX A;  1D0Y A;  4X1Y E;  4HTE A;  3KDS E;  3ASD A;  4QKN A;  2XGS A;  4BA9 A;  5JJ7 A;  4ANX A;  2WXM A;  5BV0 A;  2H3R A;  2UXX B;  4NAC A;  2ZLY A;  3RRW A;  3UFE A;  3C4Z A;  5KMG P;  3RYI E;  4AEZ C;  3S4U A;  2WXR A;  3AS5 A;  2FO7 A;  3UPV A;  3OXL A;  3AVS A;  3UMV A;  2KT9 A;  2VKH A;  3D9M A;  3LPZ A;  3UUX B;  2X6F A;  2KIN B;  4HKA A;  3VKG A;  1FIO A;  5M4Y A;  4I1O B;  2DCP A;  3MKD A;  3DTO A;  3MKR A;  5LGN B;  3ESL A;  3ZXS A;  2WQH A;  4KVM A;  4CI2 B;  4DBQ A;  5FY1 A;  3UUN A;  4ZHQ E;  4J6I A;  1NA3 A;  5A6C A;  3L22 A;  3RRN B;  2Y6X A;  3C64 A;  3AA0 B;  3FH8 A;  4DND A;  4EB6 E;  2CG3 A;  3Q5M A;  4MHC A;  3CK8 A;  4GU5 A;  5FZR A;  4OK0 A;  3FTZ A;  3CQC B;  2A4Z A;  2WMO A;  2LAI A;  3NRY A;  4EPZ A;  3LFM A;  3R7Q A;  3UQ3 A;  3FH7 A;  1D1C A;  3HHM A;  2X66 A;  2PQN A;  5FQ6 A;  2P58 C;  3B7T A;  4WNF A;  4YVO A;  2LOS A;  4QXC B;  4AV7 A;  4ILH B;  4I1M A;  4ANJ A;  1D1B A;  5DBK A;  1BR1 A;  3ZC0 A;  4M1P A;  3F57 A;  3AVR A;  3WI3 A;  3MAC A;  2LOP A;  1HH8 A;  3T5V A;  5LXT E;  3APC A;  3S7B A;  4CXY A;  2K48 A;  2I1J A;  4UI9 K;  2EHO A;  3DPD A;  5EDS A;  3EUH A;  4A3V A;  4BAY B;  5G2N A;  2E9X C;  3AU4 A;  3LXU X;  3IBE A;  5LOZ A;  4R7L A;  3KVB A;  4U07 A;  3LK3 B;  4AQF A;  3FP3 A;  4H63 H;  4UXN B;  3B57 A;  2UWJ G;  4FI5 A;  3L54 A;  5CA1 E;  2W62 A;  1U5P A;  1WM5 A;  1NA0 A;  1H0A A;  3R9A B;  3P2B A;  4N2S A;  3K9I A;  5JDM A;  2FUL A;  4LRZ A;  1MIY A;  2XQ0 A;  5DIZ A;  2VSO E;  4I6E A;  2QGS A;  3I9Y A;  1HU3 A;  4MBQ A;  2VL8 A;  3PUR A;  2X6I A;  4MS6 A;  4OYK A;  4E6H A;  3UT4 A;  4NQ0 A;  3MGB A;  3FWV A;  4G63 A;  2YK0 A;  4KUM B;  3EDT B;  2LSK A;  3OAW A;  4GCN A;  1HCI A;  3FU0 A;  4P0B A;  3VKH A;  5ANL A;  4BX9 A;  3LVQ E;  4G2V A;  4TV3 A;  4HVB A;  2CLY B;  3APF A;  2KZ7 B;  4DK5 A;  3L09 A;  2BTD A;  4YLH A;  4IE6 A;  1G8X A;  3NRX A;  1KK7 A;  4UIG A;  4HE8 A;  4ZI3 C;  3PE4 A;  3QUJ A;  4UWH A;  1KNZ A;  4CCA A;  1UN9 A;  3LYA A;  5BMV E;  1IJ5 A;  2IQC A;  2J9Q A;  3GN5 B;  4E85 A;  4DLO A;  5JR9 C;  5JR9 B;  3QK0 A;  4ANV A;  5ETW A;  4WNG A;  1HXI A;  4MRU A;  3ZYL A;  1MIV A;  2VWA A;  3RRC A;  1JPL A;  4FA6 A;  3L13 A;  3U3I A;  3U4T A;  4GK0 E;  1XGW A;  5AJL A;  4RVB A;  5FTP A;  3RKV A;  3RK6 A;  2WAU A;  2XQY A;  4G26 A;  4V3I A;  1QNF A;  4A56 A;  2M63 A;  4HOS A;  1A17 A;  2MRI A;  3TGO A;  4UQZ A;  2KCK A;  1NAF A;  3CHO A;  3CKC A;  3CWZ B;  4GIW A;  3S2A A;  2VQ2 A;  2MOW A;  3AA6 B;  2PL2 A;  3PS6 A;  3KFW X;  4AQG A;  3G2U A;  3ONK A;  2D2S A;  2DWG A;  1MMN A;  5C8Y E;  4HGA A;  1GW6 A;  3ZVV A;  3HVE B;  5FT9 A;  3HYM B;  4H7Y A;  4APF A;  3ESK A;  5J2U E;  2ODU A;  1OWA A;  3F2E A;  5ADX L;  4PK4 A;  4TRQ A;  1WR6 A;  4DI4 A;  4MLP A;  4AXH A;  2YNQ A;  3RO3 A;  2DWK A;  5L3G B;  4JEH A;  5HI7 A;  3HR0 A;  5EK3 A;  3SI5 A;  2XRZ A;  2J09 A;  3Q47 B;  4KP3 C;  2HPL A;  3SGH A;  2C2L A;  4GZ6 A;  4UQY A;  3FUF A;  3QNK A;  3CKD A;  4A1S A;  1QUU A;  4XIF A;  3WXX A;  3ANW A;  2XEV A;  4JEU A;  5AFU L;  2LJL A;  4AJW A;  3CX6 B;  3QWP A;  3CST A;  4AKL A;  4WBO A;  2QY7 A;  1FEW A;  3D9J A;  2XHE A;  1ELK A;  2WBL A;  3ZMV B;  2EHO B;  4HFG A;  4KBQ A;  3MJX A;  4C9B B;  3CVX A;  1YKE B;  2VJ8 A;  4GZ3 A;  1E8Y A;  4BT9 A;  3E4B A;  3RO2 A;  3Q2M A;  1FMV A;  3FEY A;  4PNI A;  4B0Z A;  5DAB A;  1LKX A;  4H9O C;  2C0M A;  2KWH A;  1UG3 A;  4X20 E;  5BT1 A;  4I1A A;  4MAL A;  4EOZ B;  4WBN E;  2XAS B;  4PJL A;  4JZY A;  3S7D A;  3OBV E;  2X3M A;  4TV9 E;  1PC2 A;  4U72 A;  5F8P A;  1AJ3 A;  4B8C B;  4DVD A;  3CHQ A;  3ONX A;  4L7T A;  4C0E A;  4L0R A;  3DBS A;  1UJK A;  4U74 A;  3P7I A;  4YJ2 E;  2R5S A;  2XAF B;  2CHX A;  5H6R B;  3CHM A;  4IHJ E;  1Y8M A;  5GON E;  2CHZ A;  5FZQ A;  4GYS A;  4IE0 A;  3D9O A;  3RRU A;  4WW0 A;  3RX6 A;  3NZP A;  4WWP A;  4D10 C;  2GK9 A;  2G0U A;  4N5C A;  3CVW A;  3FB2 A;  4IE5 A;  2R59 A;  5G05 C;  3MZK B;  4PW8 A;  1WAO 1;  3ZEF B;  3W15 B;  5J2T E;  4UI9 C;  1U3C A;  3ZN3 A;  3MA9 A;  3C98 A;  2ODV A;  2WVI A;  3GZ1 A;  3KBT A;  5DJQ C;  4E7S A;  2D0U A;  2D0T A;  3BG0 B;  1LRZ A;  3FUI A;  5BUZ A;  4FU3 A;  4TZ4 C;  3CV0 A;  3ZHE B;  2AVP A;  2WXK A;  4CDM A;  4YND A;  1E7U A;  3D9P A;  3ML9 A;  1E8X A;  3U66 A;  4JHJ A;  4L2L A;  2KM4 A;  3P1U A;  3ZYQ A;  3LK4 2;  3MEK A;  4XE0 A;  2WQ7 A;  3FUL A;  2AXZ A;  3WAK A;  1H2V C;  3CVN A;  1VRB A;  4EAH A;  4OHF A;  2I2O A;  2M67 A;  5HWX A;  2CHW A;  1ZV4 X;  3RKO A;  1VOM A;  1LF8 A;  5CCM A;  3QB2 A;  3QDN A;  2WM9 A;  3CKB A;  3PDY A;  3AA7 B;  2BZB A;  1N52 A;  5BNW A;  3VLD A;  2WXG A;  5E0O A;  4FHK A;  3UUL A;  2H7V C;  2LAH A;  2L8K A;  3KVA A;  1S0P A;  4BFR A;  4CGW A;  3P8C D;  5LBQ B;  3B13 A;  1H19 A;  5T4Y A;  1LVF A;  4BTB A;  4ZI7 E;  3ZPO A;  3CX7 B;  4BY6 A;  1FVH A;  2QA7 A;  4TUU A;  3D0T A;  4JUY A;  3TG5 A;  2GW1 A;  5ARG A;  2KCV A;  5AIJ A;  3HKD E;  1YKH B;  2FBN A;  3IHY A;  2DI4 A;  3ZCJ A;  4I4T E;  4Z8X A;  2EHO D;  2SPC A;  3LCA A;  3GZS A;  4KVO A;  3RIB A;  2ACX A;  4AKR B;  2KND A;  4ERR A;  1UJJ A;  3SBS A;  2J1D G;  5KJN A;  2I1K A;  4UQX A;  2LSV A;  3SD5 A;  4ACL A;  4I9C A;  4ISS A;  2VTB A;  5LP6 E;  2XRY A;  3K8P C;  1L5J A;  3EIQ C;  1E96 B;  3CHS A;  3TL5 A;  4FJY A;  5KJK A;  4GYW A;  1H2U A;  2FEZ A;  3I3N A;  4FC8 A;  3QC1 A;  1INZ A;  3CK7 A;  3TXM A;  3PH0 C;  3GN5 A;  5FXW A;  2IC6 A;  4AIF A;  5KJL A;  2N1G A;  5G04 C;  2EQX A;  2LSG A;  4WUY A;  2VTB B;  4EZL A;  1SHZ C;  2X6J A;  2XAJ B;  5JDL A;  4PS3 A;  4ADZ A;  2L0I A;  4WNE A;  5DQW A;  4FAD A;  4AP2 A;  3OKQ A;  3PE0 A;  4AY5 A;  2LHN A;  1IQU A;  3JQ1 A;  4F7A A;  4ATG A;  1ELW A;  3FUK A;  5JHB A;  4DPR A;  5G05 J;  3CK9 A;  2KMF A;  4U0U A;  2WMN A;  2XPI A;  4UV8 B;  3LKU A;  3D3M A;  5LBM A;  4E7Z A;  3RRM B;  4JL0 A;  5J1G A;  1P5Q A;  5AEN A;  5BW8 C;  2V0P A;  2RP4 A;  4JPS A;  4KMC A;  2WXN A;  2OOE A;  4YVQ C;  1HZ4 A;  2NWB A;  3BG1 B;  3Q15 A;  4CT4 A;  3O4Z A;  4JA9 A;  5FY7 A;  5L2L A;  3ETU A;  2N9D A;  4UVB B;  3RJV A;  3LJC A;  3O1J A;  3OYZ A;  3ZLI A;  2NOX A;  2BVM A;  5FWQ A;  3FTW A;  3EHN A;  3FUD A;  3VLF A;  4AOF A;  3BQL A;  1MMA A;  2L0T B;  4ZOL E;  4F3V A;  3U9W A;  5LYJ E;  3VU7 H;  2CLY C;  1IAP A;  3FFL A;  4X1I E;  2UXN B;  3LY7 A;  1WRD A;  3CVU A;  2LM9 A;  4XBF B;  4U04 A;  3AAE B;  2VK9 A;  2NP9 A;  4JEH B;  1U3D A;  3EJN A;  2J4B A;  5CA0 E;  2K9A A;  4AKG A;  4CDN A;  4UWK A;  3TXN A;  2IU1 A;  2J4D A;  3LBX A;  2JRK A;  5LG4 A;  3H37 A;  5T8I A;  4H9R C;  3ZN0 B;  4NUV A;  1EYH A;  3BQK A;  3FUJ A;  5JR9 A;  2MHK A;  3MV2 B;  3JC6 C;  3PRZ A;  3FUM A;  1KT0 A;  4Y6W A;  3CVY A;  3Q4A B;  5FQ8 A;  1V9D A;  4WNK A;  2OA5 A;  4UI9 J;  4L5G A;  4BWR A;  1IJ6 A;  2CG2 A;  4HXI A;  1CUN A;  2WXF A;  2IFU A;  3ZJ2 A;  4JHK A;  1H2T C;  3N71 A;  1Z6T A;  2KXP B;  3ONL A;  4IN3 B;  2C0S A;  4HOR A;  4B94 A;  1EZ3 A;  4ZI2 C;  2OVB A;  4DBR A;  3R7R A;  1HS7 A;  4YHJ A;  3PUJ A;  4CXW A;  1HE8 A;  5LGT B;  3FUE A;  3G2V A;  2EHO C;  3ZIM A;  3LK2 B;  3N2O A;  2FI7 A;  3ZJ1 A;  1US7 B;  4G23 A;  2MOZ A;  1OWM A;  3FBL A;  1B89 A;  3L3P A;  4L23 A;  4IE7 A;  3NZS A;  1ELR A;  2L6J A;  4H9Q C;  3F31 A;  5TAO A;  1QZ2 A;  4O2A E;  2ILR A;  3FUH A;  3N2G E;  1OUV A;  3U64 A;  2Y4U A;  1D1A A;  1PY1 A;  2YIN A;  2XAQ B;  5E76 A;  5JHA A;  2IJG X;  2BUG A;  1ZEE A;  3NZU A;  4EBA G;  2XCC A;  4J8D A;  3KIN B;  2GRM A;  4AQF C;  3AAI A;  4OVV A;  3IBP A;  4QX8 B;  3PEU B;  2V26 A;  3RC8 A;  4Q69 A;  2YHC A;  3ULQ A;  3ZYK A;  4MLK A;  2Y3A A;  4L1B A;  1NP7 A;  4FJO A;  4ZS3 A;  4C0M A;  4B8A A;  3SF4 A;  3O1H A;  1ZKE A;  2V7L A;  4UF0 A;  4CT0 A;  4GAA A;  2WWU A;  2A2F X;  3SOL A;  2Y4T A;  3IHR A;  2C5K T;  1OWL A;  4O4H E;  2VGX A;  2CA5 A;  4BJM A;  3L08 A;  5JVD E;  4ILU A;  3CVP A;  1SA0 E;  3ZMZ B;  5KCM A;  2LE8 A;  2XGM A;  3LJ3 A;  3L16 A;  4H9S E;  3N9Q A;  2PM6 A;  1HO8 A;  2PBI A;  2VKO A;  2YQ8 A;  4QX7 B;  4DMW A;  4EQF A;  5T3R A;  3Q9D A;  4AI6 A;  4U0Z A;  2CWY A;  5F3J A;  2NTY A;  3D9L A;  2Q9Q B;  2NW9 A;  5FXX A;  1BR4 A;  3HIZ A;  3PU3 A;  2A5U A;  4RSY A;  4ZI2 D;  4V1A v;  4DO0 A;  1YA0 A;  3EVY A;  1MND A;  4ILI A;  3T8M A;  4RG6 A;  4HOT A;  2YHE A;  3IF8 B;  3N9P A;  3KV9 A;  4N3B A;  1YD8 G;  4B89 A;  3GZ2 A;  2A72 A;  2WXH A;  2YU2 A;  4IRU A;  3QJZ A;  4FUL A;  3I4R B;  2P9B A;  5J08 A;  3QC9 A;  3ZN1 B;  4N39 A;  3JC6 D;  3LBX B;  4EYU A;  3CR3 A;  4OYJ A;  1XNF A;  5KX5 E;  3O1I A;  2J49 A;  4TN7 B;  2X67 A;  3KAE A;  2XPZ A;  3U3W A;  1KLX A;  4IIJ E;  4EXT A;  4PH4 B;  4J0U A;  3EDV A;  3PUG A;  4UVC B;  5IHY A;  2B1E A;  4Q96 A;  5L3B B;  4H7X A;  4UWL A;  4K0U A;  5LFA A;  4Y6C A;  5CMY A;  3CQG B;  1WYB A;  3DP7 A;  4XZ4 A;  3E22 E;  3KBU A;  2NSZ A;  3FDH A;  2WPV A;  4KBM B;  2JMK A;  3RH3 A;  3FHN A;  2BDE A;  2W00 A;  3I5P A;  3CQX C;  2WQ6 A;  1E90 A;  3PDN A;  2BF0 X;  1KT1 A;  3B7S A;  2I59 A;  2V7M A;  3CGH A;  4HS2 A;  1S35 A;  5HXC A;  2X68 A;  5LOV E;  4I55 E;  3PTR B;  3BQI A;  4PS8 A;  2DCF A;  1IZN B;  4F1S A;  1JWG A;  4O6F A;  3EDU A;  2Q9Q D;  3FU3 A;  4NUR A;  3SS1 A;  4WWN A;  1B7T A;  4LER A;  2Q9Q C;  2LEH A;  5JDN A;  3LG7 A;  1E8W A;  4M3O A;  1D0X A;  5LHG B;  3NF1 A;  2CFU A;  2E9X A;  4GA2 A;  4RG9 A;  2E8I A;  3FTV A;  4QFV A;  4IGU A;  3JYS A;  1UCU A;  3UT5 E;  1HS6 A;  1IHG A;  4JW1 A;  1N54 A;  2MBG A;  2ION A;  1EDU A;  2XAG B;  2V1D B;  1FMW A;  4EYY R;  3K3Q C;  4GYY A;  5LA6 E;  5FZS A;  2Q7F A;  3KV6 A;  1Z0P A;  3N9N A;  2CXF A;  1FCH A;  4U63 A;  4I2Z A;  4LUN U;  4HOQ A;  4GK5 E;  2MYS A;  5FQ4 A;  4QWN B;  4N78 D;  2R17 C;  2WXL A;  3CVV A;  3VHL A;  2OV8 A;  3FTY A;  5D0Q D;  2E0I A;  4PK5 A;  2KZT A;  5LGU B;  4NRH B;  2W61 A;  3QK6 A;  1DVP A;  3CEQ A;  5CB4 E;  2NC9 A;  4J8S A;  4FLH A;  2RG8 A;  2UY1 A;  4CGV A;  3Q5X A;  1E1H B;  3D9I A;  4YFS A;  4ILG A;  3QOU A;  4MFR A;  5FP3 A;  1X5B A;  2V4L A;  3GYZ A;  4H9N C;  3U78 A;  4KXK B;  3I9W A;  3ZPJ A;  1BPO A;  3D9N A;  3PUA A;  5JQG E;  3WAJ A;  4PJN A;  3G2W A;  3C50 A;  4G24 A;  1MMD A;  4KYO B;  4GZD A;  4N3A A;  4C91 A;  2XPY A;  2LHR A;  2WXO A;  4GPK A;  2VYI A;  4K03 A;  5HXH A;  2VAS A;  2X6K A;  4GA1 A;  5KDM C;  3FU5 A;  2V8S E;  5AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...