1HG5A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 101
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg5A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg5A01
4FU3A 1DVPA 1JPLA 5CMWA 3ZYMA 5J08A 3RRUA 1HFAA 1HX8A 1UJJA 3G2VA 3ONKA 1HG5A 2DCPA 1JWFA 1X5BA 5LP0A 1EYHA 2QY7A 4NACA 1VDYA 3ONLA 4GZCA 2MOWA 4AVXA 3ZYQA 2V8SE 1XGWA 3CLJA 1MHQA 2DIWA 3D9NA 2L0TB 5LOZA 4HFGA 2BF0X 3LDZA 3D9MA 4GZDA 3G2TA 1PY1A 1JWGA 3G2WA 2L0IA 4FLBA 1INZA 2LO6A 1LF8A 1H0AA 5CMYA 3D9OA 3ZYKA 1SZ9A 1HG2A 3D9KA 1JUQA 1SZAA 3D9JA 3G2SA 3ZYLA 4JXTA 3D9LA 3G2UA 2KM4A 3D9PA 3D9IA 1HF8A 4Q96A 4Q94A 1UJKA 1ELKA 1EDUA
chains in the Genus database with same CATH superfamily
2FO7A 1BI7B 3S7FA 5JDHA 2V0PA 3RU0A 1HNWT 1JWFA 5AQMB 4JZYA 2Y8DA 5KX5E 3QDNA 3L82A 2W00A 3QNKA 3MZLB 2LEHA 2X3MA 1D0ZA 2BS2A 2D9DA 3ONXA 4TWFA 3B7UX 4GPMA 3NB2A 4IN3B 4G25A 1HE8A 2UUAT 2YINA 2OEVA 1OWAA 2EINE 2XEHA 1KZOA 2MBGA 5CMYA 3D9IA 5AARA 5HWYA 2Q9QA 4KMOA 3FB2A 4GPKA 1AP7A 5BV1A 3JQ1A 5EK2A 1K8KG 3F2EA 4EHMA 3PEUB 5JDNA 2R17C 3DXKG 4LERA 3V30A 4CZZB 4DI3A 3LDZA 3ZSTA 4OHFA 2Y1LE 1Z3YA 5BW8C 1HG2A 2MTQA 1MJ0A 2J8SD 3CHMA 3TXMA 3ENEA 1V9DA 1OEDC 3I3NA 2XQYA 5LCYA 3VTXA 2IF4A 4AV7A 1QZ2A 3SFYA 4GA2A 5L2LA 4O6FA 4AKRB 3CVYA 2BBJA 4IT4A 3ZCJA 5JDFA 5DQVA 2BG9B 4GB9A 3PUXF 4WWOA 3RRNB 2KATA 5DIZA 3PVLA 5AQNB 3RK6A 3D3MA 4DUYT 2VWAA 5T3RA 1IXVA 3HKCE 2FO1E 3FFLA 2WXRA 2ZM8A 3AG2E 3L39A 2PZIA 2WWUA 4KP3C 3CKDA 3IBEA 3CVPA 1OEDE 4M7CA 2BDEA 2IEJA 4QXHB 2V6YB 3UIOC 3NZSA 4LMKA 2VJ8A 2BKPA 2X67A 4XZ4A 3M3ZB 4A98A 3HG0D 3DBSA 1MNEA 3C4ZA 2HR2A 3VRBA 4ADZA 4ERRA 2VASA 2VYIA 2WXKA 2XUEA 2VKJA 4EPZA 4CI2B 3Q5EA 3LDQB 4OVVA 2EHOB 4IDOA 4QWNB 5ABHA 3AU5A 4YDOA 1OCCE 4MBQA 4I55E 3GMIA 2WQ7A 5JR9A 3FZKB 4EGWA 3D9HA 3UTMA 5FVKA 4UQYA 3HIZA 1UURA 3UUMA 1S70B 3R7RA 5LG3A 3PV0F 4B3ST 3TWUA 4LG6A 3AE5A 2J4BA 2JQKA 4I1AA 3UKUG 4LF7T 4AIUA 3U78A 1H6PA 4K0RA 3KV6A 3SFZA 3RYHE 1WYBA 3CIRA 3HVEA 3RIUC 3ETUA 3UT4A 2ZM2A 4DV5T 4AY5A 4YY3T 4N3AA 3JAFA 1OXZA 4TN7B 2VQFT 5ADXL 3JC6D 2DBAA 2JMKA 2PJQA 2E0IA 1E90A 5JJ7A 4HWHA 2IC6A 3APFA 2FBNA 3P50A 1WR6A 2ILRA 4MHCA 3LJ3A 4K0UA 5CCMA 3AVRA 1NFIE 2HH7A 4H9RC 4A97A 5J90A 2P9BA 1KNPA 3UM2A 2WU2A 4I6EA 1H2TC 2HO1A 1NA0A 2LSIA 1JNRA 5DJQC 2YOEA 4CRWA 3ONJA 5ARGA 3TL5A 2WDVA 4K5CA 4N5CA 1KT1A 4XAXB 4CXYA 5HEHA 3HDXA 2BBHA 2L0IA 4LF9T 3AE2A 4LFAT 1G73A 5LXTE 5FMNA 3ZYKA 4JLEA 4DV7T 1IKND 3CHSA 2LXLA 3Q5MA 2LRLA 3FH8A 4U7YA 1MZCA 4AM9A 1HX8A 3MCXA 3CHQA 4F1PA 4ZI2D 4N2QA 4BETA 4IDQA 4CZ2D 3TLUA 2Q9QB 3FP3A 5BMVE 5HEOA 4JB8P 2NTYA 5FNVE 3PZ1A 2X9YA 2JLBA 5H7PA 3CX6B 4ATGA 4EAHA 3AE4A 3ZPJA 2IO3C 2XZTG 4EOZB 4DRXE 2Y0BG 3FU6A 5IUXA 2OV8A 5LMNT 4ME2A 3JUIA 2AW6A 5KMGP 1N34T 3EVYA 1KNZA 3HXDA 3CQXC 3TWWA 5HAXA 2E9XD 3FXDB 3OTNA 4U72A 4HWFA 4AVXA 5A23A 2WQYA 1OWNA 2VSNA 2CBIA 2GW1A 2C0SA 2E8IA 2LSVA 4EB6E 3ABME 4OAVB 3CR3A 3AE7A 1IYGA 2I9CA 2FJBA 4ZI2C 3VLFA 1G3NB 1TNYA 3N71A 3P4RA 1H7CA 3SFEA 2XQ3A 2VVNA 1AWCB 2J47A 3K3QC 5FXXA 3HXFA 4JA9A 3KVBA 3HKDE 4EIWA 5CBNA 2WQ6A 2HN1A 2J08A 2V5CA 2YHCA 2KZ7B 3OPCA 4X62T 2XCBA 3A8YC 2E9XC 3O9XA 5AAOA 4PK4A 1NEKA 4CDRA 4TV8E 5KBAA 3LVQE 5LX8A 1UCUA 2V4HC 2DWKA 3CVUA 4B0ZA 4X1YE 1OEDA 3AE1A 5CHEE 4JYAT 4F8HA 2ZXWE 1VDYA 4E6HA 4KYOB 5LGTB 2XQ0A 1CUNA 5JR9B 1S64A 1BR2A 3CQCB 3FZMB 2CE7A 2D0UA 3K8PC 4O8SA 1AJ3A 2MPKA 3UT5E 3FTZA 3QJZA 3JC6C 4CXXA 5L3EB 4XKCA 3TGOA 3ONKA 2FI7A 3NAWA 1QUUA 1ZP0A 2JQHA 3P4SA 4GCNA 3C4WA 3CMLA 2C5IT 3LK42 2VGXB 4O4JE 4HNAD 5EILA 5A7DB 3ZT7A 2ZGGA 3TJPA 4PW8A 3NZQA 1IHBA 1X9BA 5ABGA 2XAFB 1K3ZD 4ZEYA 2AE9A 1ELRA 4JA7A 4GKKT 4YTMA 3PUYF 4QXCB 4HBDA 1XNFA 3CX7B 3ML9A 4I6JA 4CDMA 2V6XA 4CN1A 3RX6A 2QZAA 5JRCA 5EK3A 2D5UA 4HOSA 2AVPA 4RLYA 2XY8B 2IFUA 3RRMB 2XM2A 1DC2A 1UX5A 3UT7A 3EDVA 5CA0E 2DZNA 3LVRE 5LGNB 3SO8A 1OWOA 4DR6T 2OVFA 2NP9A 4ABNA 3AVSA 3DSWA 1YXRA 3PE0A 5HRYA 2YKSA 4BT8A 4HORA 4U2ZA 3SFXA 5J2TE 3Q7AA 2DVWA 4EZLA 3MA9A 4WNKA 5LBMA 5JQGE 2J9QA 1FIOA 2PG8A 3AG4E 4EBAG 4ASKA 2KM4A 4J8YA 3EUVA 2XGMA 2BS3A 3E08A 4JEHA 4JI6T 3PE3A 1XDOA 2KC7A 1N36T 5AQBA 4U8YD 5FY7A 1QBQA 2C2LA 2LAHA 3QB5A 5E75A 2ZIRA 3WI3A 3ULEG 1B7TA 1DNPA 1BI8B 3LY9A 3RYFE 4FJZA 2KNDA 1OCRE 3Q9DA 3DXMG 2Y6XA 4ILGA 4QFVA 5HEUA 1TNZA 3QK0A 1IBMT 4CGWA 2KCVA 3CVXA 2IQCA 4YFSA 3D9PA 3PH0C 4NXMT 3PUQA 5AQ9A 4DV1T 2J07A 1N4RA 3N9MA 3S2AA 1XWMA 2W61A 3K3NA 3EHQA 1W3BA 3RHWA 1SE7A 2WP9A 2UXDT 5AYWD 5KJNA 2WXQA 2Y48B 5L3BB 1ZOYA 4ZHQE 2I0MA 3N2OA 4JEUA 3WG7E 2QC9A 2PQNA 3EU5A 2AJAA 2DYSE 4N3BA 2LXMA 3AXJB 2LHNA 2DL1A 2Y4UA 3TLSA 2N1GA 4YHJA 3C98A 5LB7B 5FQ8A 2GK9A 4UQXA 4I6GA 4HRNA 4XKBA 2J09A 5C1DA 3RKOA 2HE0A 5AQOB 4PS8A 5GONE 1N94A 2XASB 4I9CA 4A55A 3BG0B 2J4DA 1LVKA 2RFMA 3ASHA 4ZI3C 3FTUA 4TUUA 2AXZA 1JCRA 1N4SA 2XAQB 3UULA 1OWPA 4BTBA 2SPCA 2L6BA 3AG1E 4QXBB 2RG8A 2LRKA 2WAUA 4WZXA 1OT8A 5JA4D 4AQFA 1WG0A 3ZT5A 3G2UA 3C3OA 2CHWA 4GTPA 3NOGD 3RIAA 3ANWB 2UY1B 1X5BA 3ZCIA 3Q78A 5FINA 4DVDA 4MRUA 4APFA 4UV9B 4PFOA 3UU5A 1TN6A 2IUBA 4Z90A 3ZMSB 3F31A 3JXIA 5AIJA 1UGOA 2F8YA 2Y3AA 4AJWA 2RA1A 5AQIB 4U04A 4OK0A 5CJ5A 3AAAC 4N5QA 5CEDB 1X79A 4N78D 1V55E 2NR4A 3FBZA 3KDSE 4NUVA 3ONLC 3MV2B 2H88A 2XQ9A 2XGSA 3V2OA 2VL0A 2WMNA 1Y64B 4XIFA 5JTGA 3RQUA 2OLTA 2LJLA 2WU5A 1YQ4A 5HXHA 1INZA 1ZHCA 2R6GF 3CHRA 2V5QC 2R02A 2D2SA 1NI1A 5AQFB 3AA0B 5HI7A 4PH4B 2V8SV 4GTOA 2CWOA 3PUZF 4AXPA 2Q7FA 2XQ5A 2IAKA 2XQ6A 2EHOA 4DV3T 1UX4A 4A5XA 2V5DA 1WY6A 4JVSA 3TWRA 4GTQA 4UV8B 4HGAA 2JEKA 2XGOA 3LXUX 2CHNA 1FT2A 2X6IA 1T8BA 2MYOA 1YMPA 4H9PC 3IHRA 2W67A 5AQPB 3D9OA 3UQ3A 5LFAA 2CWYA 3E4BA 4W9RA 1DCQA 4YDWA 3TWQA 1SA4A 4U74A 3DSSA 2XZDG 1HG5A 2WXFA 4GZCA 3DJBA 1XZYA 1MMAA 5BV0A 2LNIA 5J0ZA 4O4HE 2BKKB 3B7RL 3SQVA 1HXIA 3BQOA 1WR0A 5J1GA 5ABFA 3ZIMA 4BEPA 2LLYA 3ZT6A 1HZ4A 1ZB1A 2LO6A 2F37A 5KJKA 3Q2MA 5ETWA 4I43B 3VLEA 4A1SA 3ZXSA 5JVDE 1J5ET 2LSYA 3ZYLA 4GAAA 2UWJG 4CI1B 5ANRA 3X2QE 2A5UA 3OXLA 4DUIA 3BK9A 4AOFA 3HR0A 1EF1C 4U7IA 3GZ1A 4EZKA 3RGLA 2AXDS 2BG9E 4WBOA 3ZN0B 2YDQA 2C0LA 1M7KA 2P9SG 3LJNA 3ULQA 4HOTA 3AE8A 3FTWA 4XE0A 5KXJA 1XNRT 2XJ7A 3N9QA 4HS2A 4JEUB 2L8KA 4Q96A 2WPVA 2XS1A 1HX1B 2IC9A 2XAJB 2C5KT 4UWFA 2WCAA 1UOHA 4GOUA 3KV4A 3PUVF 4PK5A 2MOWA 4L5GA 3K1SA 4L9PA 4LNUD 2FF4A 4ZOLE 3HKEE 1G8XA 3ZVVA 4AKHA 2EQXA 4G63A 5AQTB 2BF0X 2WB5A 2CMRA 3LEWA 2B6CA 1N32T 4CT0A 5EDSA 3LKUA 4BTAA 4CI3B 2OEWA 3G2SA 5L3DB 4K0KT 4Y6CA 3UU6A 4B8CB 2VSXE 3HXCA 3UPVA 2ONDA 2ODUA 3AECA 5KWDA 3UUXA 3PREA 3Q9UC 5FZRA 4DLQA 2XQ8A 5HCMA 2CG2A 4U8HA 3FUEA 2V5FA 4GYOA 2R2LA 2V4LA 5LBQB 3DEOA 1BR1A 2HPLA 2MYSA 2X0HA 2CFUA 4FULA 2W0GA 4KMCA 4DR3T 2PNNA 2JQ9A 2IIUA 4WAFA 2C0MA 4GA0A 3PDNA 4LRZA 1IHGA 4C90A 3DTOA 4XBFB 4X5TA 2J1DG 3I1AA 4QX7B 1TN8A 1BD8A 3NF1A 2JMHA 3B5MA 3ZC0A 4FP7A 2WQHA 4R7LA 3C51A 4B93B 1E2AA 2CHOA 1JPLA 2LM9A 2N9DA 4JHKA 5FXVA 4TXPA 4BWRA 3CV0A 2H6IA 3Q5DA 2E5LT 4ZS3A 2PTFA 1D1CA 1VOMA 4LSZE 2OCCE 3OBVE 3LG7A 2WVIA 2K48A 3N2KE 4U0SA 3D0TA 1E8XA 4UVAB 2KBXA 4LUNU 1W0AA 4KX6A 3FUFA 5LP6E 5AQLB 1OCZE 1FMWA 4LNBA 4ILBA 3U3IA 4P0BA 2HPJA 2VURA 4EXTA 5L3FB 3APCA 2VQ2A 3NKZA 3RC3A 1WFDA 2DZOA 3CPZA 2IOLA 2XCCA 2YK0A 2RKKA 2UUBT 2VKHA 4TRQA 5AJLA 3DSVA 1BLXB 3KS2A 3RRWA 2UXCT 1UG3A 1QSDA 1YKEB 4BSZB 3EHNA 3S7DA 3KEZA 3ZN3A 2LHRA 5G05J 4X65T 5AQJB 3P7IA 4Z8XA 2LOSA 4B6XA 3PUGA 2LSKA 1U3CA 2VTBB 4JI5T 3V5SA 4YJ3E 2D0TA 5BR8T 3ZEFA 4P1NA 2F8XK 4HI9A 4CT4A 5JHAA 5LGUB 3TWTA 5HKPA 2NW8A 4IE4A 2P9LG 2P9NG 4ILHB 4ISTA 2GRLA 5L47A 2GRRB 4LF8T 1HH8A 4O4IE 1E8ZA 2NTXA 4GMRA 5HS0A 3SF4A 4JUYA 2CEAA 3FZFB 1E7UA 2ZGDA 4F7AA 4UI9C 2PM6A 3IKOB 3SRZA 3VKGA 3KVAA 4V3IA 4RSYA 4YXDA 1N52A 5G55A 3SD5A 3MKQB 2XQAA 1KPSB 3V31A 3I0OA 1QYMA 3PZ4A 3Q4AB 4GYWA 5D66A 2XTLA 5EK4A 3SOLA 4XX5A 3UIPC 1O1TA 4B89A 4TZ4C 4IIJE 3E22E 4GZ6A 3L09A 3ESLA 5KDMC 2BS4A 2HM8A 4UWKA 5FL1A 2ZU6B 2NYJA 1W09A 2CM0A 1MMDA 3B7TA 2QA7A 4TWHA 4TV9E 5IYZE 4DX2A 3PUWF 3AB3B 5D0OD 3C5RA 4JEHB 2X6FA 1LVFA 1P5QA 1SA0E 1UUSA 5LHHB 2BTDA 4HOQA 4EBAA 3IBPA 1O3XA 2VVSA 4K5BA 4ZXLA 1IBKT 4F53A 5FQ6A 3CVLA 4UWHA 3DSUA 3PZ2A 4WW0A 2F0YA 4NRHB 3UFEA 3RLFF 2NSZA 4ANVA 3L17A 4P29A 2K3WA 2IJGX 3E0ZA 1W9RA 4HFHA 4UVBB 4WNFA 3UT8A 2RP4A 1NZNA 3ZYQA 4DBQA 4DMVA 1N0QA 1U2VG 4DLOA 2NC9A 3FULA 4HFGA 3CVNA 3FUHA 3UI2A 5L4HA 4YJ2E 3MKRA 4DR7T 1PAQA 5BT1A 5ENNA 2I59A 4L2LA 4HE8A 4D10C 1D0XA 4U07A 4OAUC 2J49A 2XEEA 5T4YA 3HYMB 3G2WA 3Q79A 2YEVC 3I0QA 3AJIA 3QB2A 4ILIA 5ANLA 1QNFA 3NZUA 4BESA 2DYRE 3ZC1A 5LNKA 4HVBA 2BG9C 1IAPA 1ZEEA 1MMGA 3I4GA 4UIGA 5E0OA 3ZMVB 1T72A 4Z68A 2WZHA 1IBLT 2CCQA 4HXIA 3RJVA 1N54A 3DSTA 2ZMAA 4GYYA 2BVMA 2CA5A 4CXWA 5H6RB 3LCAA 4WBNE 2IMLA 1KF6A 4U7EB 2LKHA 3P2BA 4NXNT 3V5UA 5E76A 1E7VA 2K5BB 1WAO1 1LD7A 2E2AA 5C8YE 3GZ2A 4GIWA 4ACLA 4PAGA 2VQET 3FUKA 4DV4T 4WNEA 4O2BE 4KZ0A 3AE9A 4GTMA 2WDQA 3D9MA 3NWIA 5ABEA 4EZHA 3F6QA 4XI0A 2H3RA 4UF0A 3AS5A 3ASGA 5CRVA 3MEKA 2VGYA 3FU5A 5ENOD 1Y6IA 4J2CA 2QYWA 2CHZA 4FLHA 4QKNA 2P9PG 4CGVA 4ZHBA 3PUJA 3ZEFB 3PE4A 4GU5A 4PDXA 2XPZA 4J8EA 4EEBA 3Q5WA 3FH7A 4URKA 2XS8A 3J7Yq 5LCWJ 4KUMB 3CQGB 2AWIA 1HNXT 4DR4T 3FZLB 2KSRA 4IL4A 5L4EA 3DPDA 2WXOA 3Q7FA 3EJNA 3QK6A 1ELKA 1EDUA 1VCSA 5M4YA 4MLKA 4ISSA 4HLEA 1JCSA 4L2YA 3UTKA 1N4QA 4NPPA 3ASNE 3MKDA 4I1OB 5CCLA 2DWGA 4ZI3D 4XZCA 4IHJE 2VSYA 4TXQA 2CLYB 1TR4A 2X38A 4HTEA 2XSBA 4NUUA 5FXWA 3CKCA 1KEYA 2VKOA 3T8MA 4YVQC 2Y4TA 3WAJA 4ANWA 4IDNA 2DI4A 3GA8A 3N9PA 3UMVA 4GKJT 1ZU2A 3DEPA 3FHEA 5LCWC 3O1IA 1OY3D 4DV6T 3IV0A 4L1BA 4X64T 1GQEA 2BEDA 3GN5B 4CN6A 5G04C 1R8IA 5LYJE 5EIDA 4IULA 2KT9A 2V7MA 2X68A 2JPFA 1IQUA 2ODVA 2UU9T 2DIWA 2IO2C 3IEEA 4O1OA 3ZNGA 3FTVA 2FJDA 4YVOA 1E8YA 1FPPA 2RFAA 4F6RD 3FUNA 1HR0T 2WXLA 4FU3A 2VB6A 1WRDA 4PUCA 3AG3E 3E32A 4TNWA 4UQZA 4F1SA 3AXJA 3ZMZB 1S0PA 1Z5SC 4N3CA 3SBSA 2X0YA 4K5AB 3GYZA 3ABKE 3T5XA 2GRMA 3CSTA 3SGHA 2PBIA 3OKQA 2JJ9A 1CHUA 4GTVA 1YYHA 2XRZA 2ZM6T 4P09A 5G2NA 2WXGA 4OYKA 3ISMC 3VR8A 5LOVE 3U9WA 4HFCA 3NRXA 2ES0A 4HQDA 2ETCA 3C3RA 4COFA 5ENTD 2L3LA 3KSLA 3FWVA 3B57A 4U95D 1DU2A 2W62A 4ZZCA 3MXZA 5L3CB 1LD8A 1M62A 4LFBT 4GK5E 1UN8A 3HL6A 3AAAB 5AQAA 2JRKA 1X81A 2UXXB 2LSGA 1NL4A 1TNUA 4GZ5A 2FJEA 2L0TB 4JW1A 2UUCT 3AA6B 4X1KE 3CWZB 3I5PA 3E34A 4ANJA 1DCEA 1D8DA 3MJXA 2KCKA 3EDUA 5HXCA 4FI5A 1HF8A 3RYIE 3PS6A 4FHJA 5EN5D 4BERA 4H7YA 4C0EA 1L0VA 4KBQA 3L22A 1MMNA 4HEAA 3CK9A 3ZKRA 5AJDA 3B7BA 4LF5T 4JBWF 1MQSA 3Q75A 1XGWA 5FWQA 5B1BE 3FTXA 3KD7A 3FTSA 2LSUA 3CIAA 2FJAA 4DUZT 1B89A 4EEDA 3JAEA 3L3PA 1E8WA 5C2YA 1K1AA 3LFMA 3W15B 5FJYA 3UKRG 1XDPA 2VSOE 4Z91A 1KT0A 2R5SA 2V6YA 4YSZA 2P9KG 2KWIB 3O4ZA 3Q5XA 4U31A 3PU8A 3OYXA 3U3WA 4UR9A 4UUCA 1N33T 3TXNA 3E37A 2L9BA 2KZTB 4IE6A 4YSYA 2WSSV 3H3MA 1J1JA 2A3DA 3LK3B 1IQRA 4YSXA 3PNLB 3EUHA 4I9EA 5AQHB 3EIQC 2IU1A 3FDHA 4YTPA 5BXUA 3I9YA 2DWZA 1YD8G 4V1Av 2KINB 2QRXA 3UFGA 3CSFA 4ILUA 5A1LA 2IY0C 1QLBA 3ZPOA 1WYCA 2A2FX 4M1PA 5KJLA 3RYCE 4AQGA 4AXHA 4H9SE 3QWPA 5CMWA 3PJAJ 3QOUA 1OWLA 5JREA 4K03A 3CK7A 1ZBPA 5ENRD 1KFYA 4JL0A 2K24A 1HO8A 3NOCD 2L9QA 5FYMA 4AI6A 1NA3A 3L6AA 2H6FA 3QARA 5FY1A 3QWWA 3RF1A 3LPZA 2CFZA 4ANUA 4B94A 1YA0A 3QOFA 3R6NA 1Q2ZA 3TLWA 3FY4A 3OXGA 3EHRA 2A5EA 1K1BA 2R05A 1LF8A 4G24A 3KSQA 4RQIA 3Q47B 1SZ9A 4EZJA 4YHHT 2KXPC 3T5VA 4ILCA 3Q15A 3BG1B 4IE0A 5FXZA 3OVUA 4BJMA 3CGHA 1EPUA 3PU3A 3ZLIA 1MX2A 3DP7A 4DJAA 2QY7A 4JI2T 3P4PA 4U3CA 3OJAA 2XQ4A 2GRPB 4AKLA 3KEAA 4B3TT 4J0UA 2GROB 3UX4A 1S94A 4NURA 1O1SA 1UK5A 1JNZA 3S4UA 2M63A 3T9KA 5EIBE 2X9HA 3LBXB 2XHEA 4J6IA 2YU1A 2R59A 3BUAA 5J08A 1FEWA 3AEBA 5M72A 5CRUA 5ENSD 4EZ4A 1BR4A 5HQ8A 1TN7A 1OWMA 3UINC 3RPUA 3TLVA 3HI2A 5HYAA 1YKHB 3J9X1 3D9NA 3PEVB 3PUKA 2CRBA 1WM5A 4KI0F 5FZSA 1U4QA 2QGSA 3D9KA 3KAEA 3N9NA 2KMFA 3BU8A 1NAFA 4TUYE 4UELA 2W63A 4EYUA 3CHPA 5FQ4A 3VHLA 5AQ7A 1HFAA 4I50E 2LAIA 3JADA 4JV5T 3ZSSA 3C3QA 3JUEA 4AY6A 1N9AA 2PL2A 2DHRA 4GK0E 2OVBA 5AQSB 3UUXB 3FEXA 3EU9A 5EYPF 2I2OA 2E2EA 3TAXA 2XRYA 1PY1A 2JABA 4H9NC 4H9OC 3MZKB 4IL9A 4DX6D 2QVAA 1JUQA 4FC8A 1WLXA 3AEDA 3LSVA 5KNHD 2DCFA 2WBLA 2IOSA 4MBGA 1QQEA 2JIWA 1UJJA 3G2VA 2FUPA 3ZKJA 4IE7A 1BPOA 3LJCA 5F3JA 2H6GA 5AQQB 1RW2A 5BNWA 2IDOB 3I9WA 1XNQT 3EHMA 4X8QA 3SHFA 3T8KA 2ZISA 1Z0PA 2WWVA 1HS6A 1Y8MA 3ZGQA 4BX9A 4HB5A 3MX3A 4G23A 5LG4A 3LK2B 3C72A 4I0UA 4G1TA 3N2GE 2CXLA 4B3MT 4A3VA 1NWMX 2BKOA 3KV5A 2CBJA 4L9IA 2E9XB 2MRIA 4PJJA 1O5MA 3R9MA 1HTJF 2DCPA 3CK8A 4FHKA 4G2VA 2VK9A 3UXGA 3RSEG 3CX8B 2VKDA 4GYSA 3UUNA 3SZ7A 4APOA 5LJNA 5FIOA 5FZQA 4WWPA 3MGBA 4J7WA 5EZYE 4DR1T 3O1HA 2V26A 4Y6WA 3HKBE 5HEJA 5JDQA 2X0LB 1TNOA 4JPSA 3H3AA 3GW4A 1VCTA 1W0BA 2E5VA 2BKGA 3S7JA 2H7OA 4PS7A 4A3TA 1TJCA 3AU4A 1MX4A 5JMND 4TNVA 4H63H 4O4LE 4JI3T 5EX3A 3PUAA 2VGEA 1S63A 4AISA 4DX1A 2WXMA 3AAIA 2V7JA 3PTRB 1NP7A 2GRNB 3L16A 2IHR1 1D1BA 1VRBA 2MAWA 3TG4A 1SHZC 3MA5A 2X66A 3HA4A 3ZMTB 4ANXA 2A4ZA 5ENQD 4DMWA 5C2TA 2ZLYA 4MFRA 2MHKA 3APDA 4O60A 5A6CA 1HNZT 3TWVA 3NRYA 1YQ3A 1T7SA 2VGXA 5D2MC 2CLYC 2KXPB 4GTTA 2ACZA 3K9IA 4G8KA 4X66T 3ZHEB 5J2UE 1E96B 2V1DB 2FULA 4KZCA 1PC2A 5JRCB 5ITZF 2EILE 2FEZA 4IRUA 3MJWA 4WUYA 1U3DA 1Z3XA 2EIME 4RG6A 3T1HT 2HYZA 4CEMA 4LF6T 4HFBA 3G06A 4HLLA 1H6OA 2XM1A 5IWAT 3I4RB 1LRZA 3ZYMA 1XMQT 5KNGA 1XMOT 3IHVA 3CKBA 5AQKB 4GYRA 3HXBA 4DO0A 4TUMA 4BX8A 3ANWA 3SNXA 2KWHA 3VLDA 3CEQA 4YLHA 4G8LA 4WNGA 2KCLA 4DV0T 4QH1A 4BFRA 2YHEA 3KV9A 4U8VD 5DABA 4AKGA 3KBTA 2Y69E 3PDYA 3EI0A 3UQ4A 3P4WA 3NBXX 1N4PA 1FMVA 3B95A 4DX7D 5T8IA 4GCOA 2X6JA 2V7LA 3E30A 3HHMA 4JI0T 3MYVA 4BAYB 4H7XA 2YDRA 3GN5A 5IHYA 4HWCA 3ZJ2A 3IEGA 4KVMA 1H6KA 5CA1E 3QAQA 3ASOE 1SA5A 4LF4T 1H0AA 1OUVA 1V54E 3NBNB 1SQMA 4Q69A 4TWDA 1US7B 2M6BA 3J5QB 3B13A 5B3SE 5CGMA 1L5JA 3DWLG 1KK7A 4ACKA 3ETVA 4IREA 3E33A 4BSXA 4NACA 2XPKA 3AEEA 2LKGA 3L54A 4CDNA 3ABVA 1ZV4X 2X9XA 4XI9A 5B1AE 1Y01A 5JDLA 4YTNA 4PS3A 4BJNA 2WDRA 2XPIA 4U2YA 2IONA 3AA1B 5EKQD 5HWXA 4KXKB 4PJLA 3KBUA 1I94T 3Q49B 2B76A 4PNIA 1DVPA 5LJMA 3GWHA 2X6KA 4N2SA 2P9UG 3GZSA 1S35A 3F57A 4F3VA 4DR5T 1D0YA 2H89A 1UW4B 1TJFA 4X1IE 4HRLA 3PURA 4IE5A 2I1KA 2W66A 4BY6A 1MIVA 2RD0A 5AN8A 3ZUVB 2LOPA 3RRCA 3N5LA 1N11A 4LMJA 1IJ6A 1MYOA 4GTSA 4ZFHA 1U5PA 1ZKEA 3LY7A 4U96D 4JD2G 2H6HA 3CHOA 4PK6A 4JXTA 1E7PA 4EV6A 2UY1A 4LEUA 3R7QA 4FJOA 4UXNB 4I43A 1FJGT 5TAOA 3W9GA 3RRUA 1BU9A 3JYSA 3W9FA 3SI5A 3C50A 1TYQG 3RAUA 4L7TA 1TEZA 5FY0A 4JHJA 2CHXA 3R84B 3FTYA 4N39A 2ACXA 1GW6A 5FP3A 5KCMA 4O2AE 1FCHA 4GZDA 2B0OE 3EHZA 3FZHB 2WXHA 4U33A 3EDTB 1KLXA 4J8FA 5DQWA 4HN9A 4AIFA 4NIKA 2WXNA 5ENPD 2XQ7A 2BVLA 2ETBA 4G11A 4MLPA 2ETAA 4DX5D 3FBLA 4ZS2A 4XEIG 4GTRA 3MACA 4HFEA 5LHIB 2XENA 3WAKA 4YNDA 5BPPA 4L23A 4JHRA 4WYVA 1H2UA 4KVOA 3K3OA 5FVLA 2BKNA 4YT0A 3RIFA 4UWLA 3ZHEA 3PNTB 1UN9A 3O48A 2J4GA 3PRZA 4QH5A 4ATZD 1TNBA 2CPTA 2DLRA 3EIJA 3FHNA 3CVWA 4DNDA 3RH3A 3RI5A 4PFPA 4BT9A 4TV3A 2WXIA 2CG3A 4QX8B 4HOUA 4KBMB 4FJYA 4LMLA 1D9SA 3AE3A 3P4QA 2Q9QC 5CB4E 3ASDA 3O4XE 3HRAA 2AXVA 4E7SA 3JCFA 4O1PA 5HXRA 3QKYA 3CVQA 4HKAA 2X51A 1KNRA 3UM3A 3UU8A 4F6RC 2G0UA 2XPYA 2V8SE 2WB2A 3UM0A 1D8EA 4MALA 3OXFA 3MV3B 4CQIA 3AEFA 3HXEA 1N0RA 3RIBA 5JDMA 1SW6A 4QH4A 1ELWA 2I1JA 4HI8A 2X6HA 2P58C 4B8AA 5AENA 4G26A 3D9LA 3KFWX 5HXSA 2C5JA 3B7SA 4FLBA 4B3RT 5JH7E 1FVFA 1RZ4A 2QYUA 4A56A 3RQWA 5LP0A 2XHEB 5H6QB 4DI4A 3SFDA 4KHPT 3VKHA 3JQ0A 4E7ZA 4UEMA 4IYPA 3ULYA 2NW7A 5DBKA 3U4TA 3PZDA 2WMOA 4U0UA 1NENA 3C4XA 2PFVA 4Q25A 2EIJE 2YQ8A 3HVEB 5ABFB 4WWNA 2X9WA 4AQYT 1Z8UA 4M3OA 3T1YT 2QFCA 4PJMA 4HWIB 3RO3A 4Q94A 4WNDA 3AS8A 3V2XA 3ZFWA 3FXEB 3TG5A 3IHYA 3AAEB 5EYLA 2XSAA 4UWGA 5D0QD 2EHOC 1I6ZA 2A72A 3AEAA 2WXJA 3AS4A 5FT9A 2NXPA 5KJMA 2PQRA 3FUIA 2I6HA 3R9AB 2QYJA 2PM7A 4AEZC 4I1MA 2M67A 3UU3A 4LFCT 2LT3A 4C9BB 4GMLA 1UJKA 4ILAA 3TLTA 4HRMB 4CYMD 3ASFA 3URZA 2Z6EA 1H19A 3ONLA 2P2CP 4GZ3A 3ABLE 2OV9A 3FU0A 3QC1A 3U64A 5LMUT 2UXNB 2KZTA 5IY5E 4TXRA 5AQUB 4ZZBA 1E1HB 3A7MA 3IA3A 2BG9A 3JXJA 1JWGA 2L6JA 3H37A 2J62A 3L13A 3L8RA 5ARFA 2Q9QD 4P0AA 4GA1A 3ZW3A 3LY8A 3L08A 1D1AA 4NIQA 2CXFA 3X1DA 3BQLA 4U63A 2BZBA 4JI4T 5CEAA 3UQ7A 3CLJA 2UXBT 5AQRB 3EABA 5HEGA 4AQFC 2OA5A 4IGUA 5JJTA 4OFZA 2M6IA 3Q73A 1IJ5A 3SBTB 3ESKA 3BQIA 1OXJA 3AA7B 4H63V 2XAHB 4RG9A 4HFVA 3N9OA 4J8SA 1WDYA 4LNGA 4YDEA 3JCKC 4MS6A 5FKYA 3RO2A 4AP2A 3DPYA 3KINB 5CERB 2XZEA 3U66A 1WCRA 3C98B 1FVHA 1HU3A 3MK7C 4JC8A 3RC8A 4C48B 3CVRA 3QC9A 3NQPA 4YDYA 4UVCB 2XEVA 4HFIA 3RIUA 3TWXA 1J5WA 2LSJA 2VTBA 3ZU7B 3ZN1B 3O1JA 4BA9A 4DBRA 3D9JA 4UI9J 1HCIA 1SUMB 5F5WA 3G2TA 3ZMUB 5AQGB 5LHGB 2EIKE 2YN6A 2YU2A 4G2AA 3PZ3A 2WM9A 4CN4A 4EECA 2P9IG 3CK6A 3VRAA 3LBXA 4J8DA 4ZI7E 4E85A 1MNDA 4DV2T 1YW0A 3LYAA 5FL0A 2KLQA 5JR9C 1OCOE 3ML8A 1MX6A 4I2WA 3DRAA 3VU7H 5EX0A 3FH5A 5JHBA 3C64A 1IZNB 3AEGA 3RKVA 4H9QC 1OEDB 4HFDA 5AFUL 4JI7T 1BR0A 5CECB 2DNXA 2NWBA 2N2NA 4DR2T 4C91A 1SZAA 3MKQA 2LUHA 3VR9A 3SS1A 2WXPA 3A5XA 3ZXPA 1FT1A 2EHOD 5F8PA 4L0RA 2GGFA 2VL8A 1JCQA 1A5EA 1EZ3A 2WS3A 3FU3A 2LM2A 3J5PA 4MKTA 5HCJA 4A1GA 5G05C 5LOZA 3DSXA 2YDSA 3N9LA 2NW9A 3SY2A 2CXDA 4DPRA 3IXEA 3P8CD 3FUMA 4GMJA 2IW5B 2W4XA 2A9UA 3PJAA 3QUJA 5FQ7A 4QHOA 3OYZA 3ZJ1A 4UF0B 4QQIA 1HS7A 5AQVB 5L3GB 5BUZA 4JI1T 5JDGA 4NQ0A 2V7IA 2HHHT 2LE8A 3FUJA 3EAMA 5G04J 5C3JA 3IF8B 3TKLB 3CVVA 3UU4A 4CCAA 4I17A 3OAWA 3P1UA 4DK5A 2B1EA 4LCTA 2XAGB 3WXXA 3RKGA 4OYJA 5LA6E 1A17A 3NVOA 4OYSA 1T98A 2BUGA 2V7KA 2W2UA 1EYHA 3OTOT 3ZRHA 3V79K 5CFBA 2FBWA 1N95A 1KZPA 4C0MA 1Z6TA 2HN2A 4FA6A 4X20E 4RVBA 3PUSA 3TWSA 1MIWA 4KT6B 1LKXA 1H2VC 2WY2A 2R03A 3LS8A 2RPAA 2AXUA 4JI8T 4A63B 3QNUA 4KHZF 2ZM0A 3SWHA 3UM1A 1SVXA 2OOEA 2H7VC 2WZIA 1MIYA 5CBOA 4I2ZA 3S7BA 4TX5A 4I4TE 4EQFA 5BXOA 3T8OA 2F4VT 2NOXA 4AKIA 1YCSB 5FTPA 4FADA 3L9TA 1O1RA 3BQKA 4EYYR 5HXEA 3QB5K 4IDPA 4IDZA 1MHQA 3BEEA 3FUDA 5JJ6A 2JQQA 4OX9T 1LTXA 3M65A 2GRQB 4UI9K 3QWVA 4HWDA 2MOZA 4PJNA 2YNQA 4DIDB 4OVUA 3VTYA 3Q9NC 2E9XA 3AE6A 3NZPA 3UUBA 4U0ZA 2K9AA 3FEYA
chains in the Genus database with same CATH topology
2FO7A 3S7FA 5JDHA 2V0PA 3RU0A 1JWFA 4JZYA 2Y8DA 5KX5E 3QDNA 2W00A 3QNKA 3MZLB 2LEHA 2X3MA 1D0ZA 3ONXA 3B7UX 4IN3B 4G25A 1HE8A 2YINA 1OWAA 2MBGA 5CMYA 3D9IA 5HWYA 2Q9QA 4KMOA 3FB2A 4GPKA 5BV1A 3JQ1A 5EK2A 3F2EA 3PEUB 5JDNA 2R17C 4LERA 4CZZB 4DI3A 3LDZA 4OHFA 1Z3YA 5BW8C 1HG2A 2MTQA 3CHMA 3TXMA 3ENEA 1V9DA 3I3NA 2XQYA 5LCYA 3VTXA 2IF4A 4AV7A 1QZ2A 4GA2A 5L2LA 4O6FA 4AKRB 3CVYA 3ZCJA 5JDFA 5DQVA 4GB9A 3RRNB 4WWOA 2KATA 5DIZA 3PVLA 3RK6A 3D3MA 5T3RA 2VWAA 3HKCE 3FFLA 2WXRA 2ZM8A 2PZIA 2WWUA 4KP3C 3CKDA 3IBEA 3CVPA 2BDEA 4QXHB 3NZSA 2VJ8A 4XZ4A 2X67A 3DBSA 1MNEA 3C4ZA 2HR2A 4ADZA 4ERRA 2VYIA 2VASA 2WXKA 2XUEA 2VKJA 4EPZA 4CI2B 4OVVA 2EHOB 4QWNB 3AU5A 4MBQA 4I55E 3GMIA 2WQ7A 5JR9A 4UQYA 3HIZA 3UUMA 3R7RA 2J4BA 4I1AA 3U78A 4K0RA 3KV6A 3SFZA 3RYHE 1WYBA 3HVEA 3UT4A 3ETUA 2ZM2A 4AY5A 4N3AA 1OXZA 4TN7B 5ADXL 3JC6D 2DBAA 2JMKA 2PJQA 2E0IA 1E90A 5JJ7A 2IC6A 3APFA 2FBNA 1WR6A 2ILRA 4MHCA 3LJ3A 4K0UA 5CCMA 3AVRA 2HH7A 4H9RC 5J90A 2P9BA 4I6EA 1H2TC 2HO1A 1NA0A 2LSIA 5DJQC 4CRWA 5ARGA 3TL5A 4N5CA 1KT1A 4XAXB 4CXYA 3HDXA 2L0IA 1G73A 5LXTE 5FMNA 3ZYKA 4JLEA 3CHSA 3Q5MA 3FH8A 4AM9A 1HX8A 3MCXA 3CHQA 4ZI2D 4N2QA 3FP3A 2Q9QB 5BMVE 2NTYA 5FNVE 2X9YA 2JLBA 3CX6B 4ATGA 4EAHA 3ZPJA 4EOZB 3FU6A 2OV8A 4ME2A 3JUIA 2AW6A 5KMGP 3EVYA 1KNZA 3CQXC 5HAXA 2E9XD 3FXDB 3OTNA 4U72A 4AVXA 5A23A 1OWNA 2VSNA 2GW1A 2C0SA 2E8IA 2LSVA 4EB6E 3CR3A 1IYGA 2I9CA 4ZI2C 3VLFA 3N71A 1H7CA 3K3QC 5FXXA 4JA9A 3KVBA 3HKDE 4EIWA 2WQ6A 2J08A 2YHCA 2KZ7B 2XCBA 2E9XC 3O9XA 4PK4A 4CDRA 4TV8E 3LVQE 5LX8A 1UCUA 2DWKA 3CVUA 4B0ZA 4X1YE 5CHEE 1VDYA 4E6HA 4KYOB 5LGTB 2XQ0A 1CUNA 5JR9B 1BR2A 3CQCB 1AJ3A 2CE7A 2D0UA 3K8PC 4O8SA 3UT5E 3FTZA 3QJZA 3JC6C 4CXXA 5L3EB 4XKCA 3TGOA 3ONKA 2FI7A 1QUUA 4GCNA 3C4WA 3CMLA 2C5IT 3LK42 2VGXB 4O4JE 5A7DB 3TJPA 4PW8A 3NZQA 2XAFB 1ELRA 4JA7A 4QXCB 1XNFA 3CX7B 3ML9A 4I6JA 4CDMA 3RX6A 5JRCA 5EK3A 2D5UA 4HOSA 2AVPA 2IFUA 3RRMB 1UX5A 3UT7A 3EDVA 5CA0E 3LVRE 5LGNB 1OWOA 2OVFA 2NP9A 4ABNA 3AVSA 3PE0A 4BT8A 4HORA 5J2TE 4EZLA 3MA9A 4WNKA 5LBMA 5JQGE 2J9QA 1FIOA 2PG8A 4EBAG 4ASKA 2KM4A 2XGMA 3E08A 4JEHA 3PE3A 2KC7A 5FY7A 2C2LA 2LAHA 5E75A 3WI3A 1B7TA 1DNPA 3LY9A 3RYFE 4FJZA 2KNDA 3Q9DA 4QFVA 2Y6XA 4ILGA 3QK0A 4CGWA 2KCVA 3CVXA 2IQCA 4YFSA 3D9PA 3PH0C 3PUQA 2J07A 3N9MA 3S2AA 2W61A 3K3NA 1W3BA 5AYWD 5KJNA 2WXQA 2Y48B 5L3BB 4ZHQE 3N2OA 4JEUA 2PQNA 4N3BA 2LHNA 2Y4UA 2N1GA 4YHJA 3C98A 5FQ8A 2GK9A 4UQXA 4I6GA 4XKBA 2J09A 5C1DA 3RKOA 4PS8A 5GONE 2XASB 4I9CA 4A55A 3BG0B 2J4DA 1LVKA 3ASHA 4ZI3C 3FTUA 4TUUA 2AXZA 2XAQB 3UULA 1OWPA 4BTBA 2SPCA 4QXBB 2RG8A 2WAUA 4AQFA 3G2UA 2CHWA 3ANWB 2UY1B 1X5BA 3ZCIA 4DVDA 4MRUA 4APFA 4UV9B 4PFOA 3ZMSB 3F31A 5AIJA 2Y3AA 4AJWA 2RA1A 4U04A 4OK0A 1X79A 4N78D 3FBZA 3KDSE 4NUVA 3MV2B 2XGSA 2WMNA 1Y64B 4XIFA 2LJLA 5HXHA 1INZA 1ZHCA 3CHRA 2D2SA 3AA0B 5HI7A 4PH4B 2CWOA 4AXPA 2Q7FA 2IAKA 2EHOA 1UX4A 1WY6A 4JVSA 4UV8B 4HGAA 2JEKA 2XGOA 3LXUX 2X6IA 4H9PC 3IHRA 3D9OA 3UQ3A 5LFAA 2CWYA 3E4BA 4W9RA 4U74A 1HG5A 2WXFA 4GZCA 3DJBA 1MMAA 5BV0A 2LNIA 4O4HE 3B7RL 1HXIA 5J1GA 3ZIMA 1HZ4A 2LO6A 5KJKA 3Q2MA 5ETWA 4I43B 3VLEA 4A1SA 3ZXSA 5JVDE 2LSYA 3ZYLA 4GAAA 2UWJG 4CI1B 5ANRA 2A5UA 3OXLA 3BK9A 4AOFA 3HR0A 1EF1C 3GZ1A 4EZKA 4WBOA 3ZN0B 2C0LA 3ULQA 4HOTA 3FTWA 4XE0A 3N9QA 4HS2A 4JEUB 2L8KA 4Q96A 2WPVA 2IC9A 2XAJB 2C5KT 4UWFA 4GOUA 3KV4A 4PK5A 2MOWA 4L5GA 2FF4A 4ZOLE 3HKEE 1G8XA 3ZVVA 4AKHA 2EQXA 4G63A 2BF0X 2CMRA 3LEWA 4CT0A 5EDSA 3LKUA 4BTAA 4CI3B 3G2SA 5L3DB 4Y6CA 4B8CB 2VSXE 3UPVA 2ONDA 2ODUA 3UUXA 3PREA 4DLQA 5FZRA 2CG2A 4U8HA 3FUEA 2V5FA 4GYOA 2V4LA 5LBQB 1BR1A 2HPLA 2MYSA 2CFUA 4FULA 2W0GA 4KMCA 4WAFA 2C0MA 4GA0A 3PDNA 4LRZA 1IHGA 4C90A 3DTOA 4XBFB 2J1DG 3I1AA 4QX7B 3NF1A 4FP7A 2JMHA 3ZC0A 2WQHA 4R7LA 3C51A 1JPLA 2LM9A 2N9DA 4JHKA 5FXVA 4BWRA 3CV0A 4ZS3A 1D1CA 1VOMA 3OBVE 3LG7A 2WVIA 2K48A 3N2KE 4U0SA 3D0TA 1E8XA 4UVAB 4LUNU 3FUFA 5LP6E 1FMWA 3U3IA 4P0BA 2HPJA 3APCA 4EXTA 5L3FB 2VQ2A 3RC3A 3CPZA 2IOLA 2XCCA 2YK0A 2VKHA 4TRQA 5AJLA 3KS2A 3RRWA 1UG3A 1QSDA 1YKEB 3EHNA 3S7DA 3KEZA 3ZN3A 2LHRA 5G05J 3P7IA 4Z8XA 2LOSA 4B6XA 3PUGA 2LSKA 1U3CA 2VTBB 3V5SA 4YJ3E 2D0TA 3ZEFA 4CT4A 5JHAA 5LGUB 2NW8A 4IE4A 4ILHB 4ISTA 2GRLA 1HH8A 4O4IE 1E8ZA 2NTXA 3SF4A 4JUYA 2CEAA 1E7UA 4F7AA 4UI9C 2PM6A 3IKOB 3SRZA 3VKGA 3KVAA 4V3IA 4RSYA 1N52A 5G55A 3SD5A 3MKQB 3I0OA 3Q4AB 4GYWA 2XTLA 5EK4A 3SOLA 4XX5A 4B89A 4TZ4C 4IIJE 3E22E 4GZ6A 3L09A 3ESLA 5KDMC 2HM8A 4UWKA 2ZU6B 2CM0A 1MMDA 3B7TA 2QA7A 5IYZE 4TV9E 3AB3B 5D0OD 4JEHB 2X6FA 1LVFA 1P5QA 1SA0E 5LHHB 4HOQA 2BTDA 4EBAA 3IBPA 1O3XA 4F53A 5FQ6A 3CVLA 4UWHA 4WW0A 4NRHB 3UFEA 2NSZA 4ANVA 3L17A 4P29A 2IJGX 3E0ZA 4UVBB 4WNFA 3UT8A 2RP4A 1NZNA 3ZYQA 4DBQA 4DMVA 4DLOA 2NC9A 3FULA 4HFGA 3CVNA 3FUHA 4YJ2E 3MKRA 1PAQA 5BT1A 5ENNA 2I59A 4L2LA 4HE8A 4D10C 1D0XA 4U07A 2J49A 5T4YA 3HYMB 3G2WA 2YEVC 3I0QA 3QB2A 4ILIA 5ANLA 1QNFA 3NZUA 3ZC1A 5LNKA 4HVBA 1IAPA 1ZEEA 1MMGA 3I4GA 4UIGA 5E0OA 3ZMVB 2CCQA 4HXIA 3RJVA 1N54A 2ZMAA 4GYYA 2BVMA 2CA5A 4CXWA 5H6RB 3LCAA 4WBNE 3P2BA 3V5UA 5E76A 1E7VA 2K5BB 1WAO1 5C8YE 3GZ2A 4GIWA 4ACLA 4PAGA 3FUKA 4WNEA 4O2BE 4KZ0A 3D9MA 4EZHA 4XI0A 2H3RA 3ASGA 4UF0A 3AS5A 3MEKA 2VGYA 3FU5A 1Y6IA 4J2CA 4FLHA 2CHZA 4CGVA 4QKNA 3PUJA 3ZEFB 3PE4A 4GU5A 4PDXA 2XPZA 4J8EA 3Q5WA 3FH7A 4URKA 3J7Yq 5LCWJ 4KUMB 3CQGB 2AWIA 3DPDA 2WXOA 3EJNA 3QK6A 1ELKA 1EDUA 5M4YA 4MLKA 4ISSA 4HLEA 4L2YA 3UTKA 4I1OB 3MKDA 5CCLA 2DWGA 4ZI3D 4XZCA 4IHJE 2VSYA 2CLYB 2X38A 4HTEA 4NUUA 5FXWA 3CKCA 2VKOA 3T8MA 4YVQC 2Y4TA 3WAJA 4ANWA 2DI4A 3GA8A 3N9PA 3UMVA 1ZU2A 5LCWC 3FHEA 3O1IA 3IV0A 4L1BA 3GN5B 5G04C 5LYJE 4IULA 2KT9A 2V7MA 2X68A 2JPFA 1IQUA 2ODVA 2DIWA 3IEEA 3FTVA 4YVOA 1E8YA 3FUNA 2WXLA 4FU3A 2VB6A 1WRDA 4PUCA 4UQZA 4F1SA 3ZMZB 1S0PA 3SBSA 4N3CA 3GYZA 3T5XA 2GRMA 3CSTA 3SGHA 2PBIA 3OKQA 2JJ9A 2XRZA 4P09A 5G2NA 2WXGA 4OYKA 5LOVE 3U9WA 3NRXA 2ES0A 2L3LA 3FWVA 3B57A 2W62A 3MXZA 5L3CB 1UN8A 4GK5E 3HL6A 3AAAB 2JRKA 2UXXB 2LSGA 4GZ5A 2L0TB 4JW1A 3AA6B 4X1KE 3CWZB 3I5PA 4ANJA 3MJXA 2KCKA 3EDUA 5HXCA 4FI5A 1HF8A 3RYIE 3PS6A 4FHJA 4H7YA 4C0EA 4KBQA 3L22A 1MMNA 4HEAA 3CK9A 5AJDA 1MQSA 1XGWA 5FWQA 3FTXA 3KD7A 3FTSA 2LSUA 3CIAA 1B89A 3L3PA 1E8WA 5C2YA 3LFMA 3W15B 5FJYA 2VSOE 1KT0A 2R5SA 3O4ZA 2KWIB 3Q5XA 3PU8A 3OYXA 3U3WA 3TXNA 2L9BA 2KZTB 4IE6A 2WSSV 2A3DA 3LK3B 1IQRA 3PNLB 3EUHA 4I9EA 3EIQC 2IU1A 3FDHA 3I9YA 1YD8G 4V1Av 2KINB 3CSFA 4ILUA 5A1LA 3ZPOA 1WYCA 2A2FX 4M1PA 5KJLA 3RYCE 4AQGA 4AXHA 4H9SE 3QWPA 5CMWA 3QOUA 1OWLA 5JREA 4K03A 3CK7A 1ZBPA 4JL0A 2K24A 1HO8A 2L9QA 5FYMA 4AI6A 1NA3A 3L6AA 3QARA 5FY1A 3QWWA 3LPZA 2CFZA 4ANUA 4B94A 1YA0A 3R6NA 3FY4A 3OXGA 1LF8A 4G24A 3Q47B 1SZ9A 4EZJA 3T5VA 3Q15A 3BG1B 4IE0A 5FXZA 4BJMA 3CGHA 1EPUA 3PU3A 3ZLIA 4DJAA 3DP7A 2QY7A 3OJAA 4AKLA 4J0UA 3UX4A 1S94A 4NURA 3S4UA 2M63A 2X9HA 3LBXB 2XHEA 4J6IA 2YU1A 2R59A 5J08A 1FEWA 5M72A 4EZ4A 1BR4A 5HQ8A 1OWMA 3RPUA 3HI2A 5HYAA 1YKHB 3J9X1 3D9NA 3PEVB 3PUKA 1WM5A 5FZSA 1U4QA 2QGSA 3D9KA 3KAEA 3N9NA 2KMFA 1NAFA 4TUYE 4UELA 2W63A 4EYUA 3CHPA 5FQ4A 3VHLA 1HFAA 4I50E 2LAIA 4AY6A 2PL2A 2DHRA 4GK0E 2OVBA 3UUXB 3FEXA 2I2OA 2E2EA 3TAXA 2XRYA 1PY1A 4H9NC 4H9OC 3MZKB 4FC8A 1JUQA 1WLXA 2DCFA 2WBLA 2IOSA 1QQEA 1UJJA 3G2VA 4IE7A 1BPOA 3LJCA 5F3JA 5BNWA 3I9WA 3EHMA 3SHFA 1Z0PA 3ZGQA 1HS6A 1Y8MA 4BX9A 3MX3A 4G23A 5LG4A 3LK2B 4G1TA 3N2GE 2CXLA 4A3VA 1NWMX 3KV5A 2MRIA 4L9IA 2E9XB 4PJJA 1HTJF 2DCPA 3CK8A 4G2VA 4FHKA 2VK9A 3CX8B 2VKDA 4GYSA 3UUNA 3SZ7A 4APOA 5LJNA 5FZQA 4WWPA 3MGBA 5EZYE 3O1HA 2V26A 4Y6WA 3HKBE 5JDQA 2X0LB 4JPSA 3H3AA 3GW4A 3S7JA 2H7OA 4PS7A 4A3TA 1TJCA 3AU4A 4H63H 4O4LE 5EX3A 3PUAA 2WXMA 3AAIA 2V7JA 3PTRB 1NP7A 3L16A 1D1BA 1VRBA 3TG4A 1SHZC 3MA5A 2X66A 3HA4A 3ZMTB 4ANXA 2A4ZA 4DMWA 2ZLYA 4MFRA 2MHKA 3APDA 5A6CA 3NRYA 2VGXA 2CLYC 2KXPB 3K9IA 3ZHEB 5J2UE 1E96B 2V1DB 2FULA 4KZCA 1PC2A 5JRCB 2FEZA 4IRUA 3MJWA 4WUYA 1U3DA 1Z3XA 4RG6A 2HYZA 4CEMA 3I4RB 1LRZA 3ZYMA 3IHVA 3CKBA 4GYRA 4DO0A 4BX8A 3ANWA 3SNXA 2KWHA 3VLDA 3CEQA 4YLHA 4WNGA 2KCLA 4BFRA 2YHEA 3KV9A 5DABA 4AKGA 3KBTA 3PDYA 3NBXX 1FMVA 5T8IA 4GCOA 2X6JA 2V7LA 3HHMA 3MYVA 4BAYB 4H7XA 3GN5A 5IHYA 3ZJ2A 3IEGA 4KVMA 1H6KA 5CA1E 3QAQA 1H0AA 1OUVA 1SQMA 4Q69A 1US7B 3B13A 1L5JA 4ACKA 1KK7A 3ETVA 4BSXA 4NACA 3L54A 4CDNA 1ZV4X 2X9XA 4XI9A 5JDLA 4PS3A 4BJNA 2XPIA 2IONA 3AA1B 5EKQD 5HWXA 4KXKB 4PJLA 3KBUA 3Q49B 4PNIA 1DVPA 5LJMA 3GWHA 2X6KA 4N2SA 3GZSA 1S35A 3F57A 4F3VA 1D0YA 1UW4B 1TJFA 4X1IE 3PURA 4IE5A 2I1KA 4BY6A 1MIVA 2RD0A 2LOPA 3RRCA 3N5LA 1IJ6A 1U5PA 1ZKEA 3LY7A 3CHOA 4PK6A 4JXTA 2UY1A 4LEUA 3R7QA 4FJOA 4UXNB 4I43A 5TAOA 3RRUA 3JYSA 3SI5A 3C50A 4L7TA 1TEZA 5FY0A 4JHJA 2CHXA 3R84B 3FTYA 4N39A 2ACXA 1GW6A 5FP3A 5KCMA 4O2AE 1FCHA 4GZDA 2WXHA 3EDTB 1KLXA 4J8FA 5DQWA 4HN9A 4AIFA 2WXNA 2BVLA 4G11A 4MLPA 3FBLA 4ZS2A 3MACA 5LHIB 3WAKA 4YNDA 5BPPA 4L23A 4JHRA 1H2UA 4KVOA 3K3OA 4UWLA 3ZHEA 3PNTB 1UN9A 3O48A 3PRZA 2DLRA 3EIJA 3FHNA 3CVWA 4DNDA 3RH3A 4PFPA 4BT9A 4TV3A 2WXIA 2CG3A 4QX8B 4HOUA 4KBMB 4FJYA 2Q9QC 5CB4E 3ASDA 3O4XE 2AXVA 4E7SA 5HXRA 3QKYA 3CVQA 4HKAA 2X51A 4F6RC 2G0UA 2XPYA 2V8SE 2WB2A 4MALA 3OXFA 3MV3B 4CQIA 3RIBA 5JDMA 2I1JA 1ELWA 2X6HA 2P58C 4B8AA 5AENA 4G26A 3D9LA 3KFWX 5HXSA 2C5JA 3B7SA 4FLBA 5JH7E 1FVFA 4A56A 5LP0A 2XHEB 5H6QB 4DI4A 3VKHA 3JQ0A 4E7ZA 4UEMA 4IYPA 2NW7A 5DBKA 3U4TA 3PZDA 2WMOA 4U0UA 3C4XA 3HVEB 2PFVA 2YQ8A 4WWNA 2X9WA 4M3OA 2QFCA 4PJMA 3RO3A 4Q94A 4WNDA 3AS8A 3ZFWA 3FXEB 3TG5A 3IHYA 3AAEB 4UWGA 5D0QD 2EHOC 2A72A 2WXJA 3AS4A 5FT9A 2NXPA 5KJMA 2PQRA 3FUIA 2I6HA 3R9AB 2PM7A 4AEZC 4I1MA 2M67A 2LT3A 4C9BB 4GMLA 1UJKA 3ASFA 3URZA 2Z6EA 1H19A 3ONLA 4GZ3A 3QC1A 3U64A 3FU0A 2UXNB 2KZTA 1E1HB 1JWGA 2L6JA 3H37A 5ARFA 3L13A 2Q9QD 4P0AA 4GA1A 3ZW3A 3LY8A 3L08A 1D1AA 2CXFA 3BQLA 4U63A 2BZBA 3CLJA 4AQFC 2OA5A 4IGUA 5JJTA 4OFZA 1IJ5A 3SBTB 3ESKA 3BQIA 3AA7B 4H63V 2XAHB 4RG9A 4HFVA 3N9OA 4J8SA 3JCKC 4MS6A 3RO2A 4AP2A 3KINB 3U66A 3C98B 1FVHA 1HU3A 3MK7C 4JC8A 3RC8A 3CVRA 3QC9A 3NQPA 4UVCB 2XEVA 2LSJA 2VTBA 3ZN1B 3O1JA 4BA9A 4DBRA 3D9JA 4UI9J 1HCIA 3G2TA 3ZMUB 5LHGB 4G2AA 2YU2A 2WM9A 4EECA 3LBXA 4J8DA 4ZI7E 4E85A 1MNDA 1YW0A 3LYAA 5JR9C 2KLQA 3ML8A 4I2WA 3VU7H 5EX0A 3FH5A 5JHBA 3C64A 1IZNB 3RKVA 4H9QC 5AFUL 1BR0A 2DNXA 2NWBA 2N2NA 1SZAA 4C91A 3MKQA 3SS1A 2WXPA 3A5XA 2EHOD 5F8PA 4L0RA 2GGFA 2VL8A 1EZ3A 3FU3A 4MKTA 4A1GA 5G05C 5LOZA 2NW9A 3N9LA 2CXDA 4DPRA 3P8CD 3FUMA 4GMJA 2IW5B 3QUJA 5FQ7A 4QHOA 3OYZA 3ZJ1A 4UF0B 1HS7A 5L3GB 5BUZA 5JDGA 4NQ0A 2V7IA 2LE8A 3FUJA 5G04J 3IF8B 3TKLB 3CVVA 4CCAA 4I17A 3OAWA 3P1UA 4DK5A 2B1EA 4LCTA 2XAGB 3WXXA 4OYJA 5LA6E 1A17A 4OYSA 1T98A 2BUGA 2V7KA 1EYHA 3ZRHA 4C0MA 1Z6TA 4FA6A 4X20E 4RVBA 3PUSA 4KT6B 1MIWA 1LKXA 1H2VC 3LS8A 2AXUA 2ZM0A 3SWHA 2OOEA 2H7VC 1MIYA 4I2ZA 3S7BA 4TX5A 4I4TE 4EQFA 3T8OA 2NOXA 4AKIA 5FTPA 4FADA 3BQKA 4EYYR 5HXEA 4IDZA 1MHQA 3BEEA 3FUDA 5JJ6A 2JQQA 3M65A 4UI9K 3QWVA 2MOZA 4PJNA 2YNQA 4OVUA 3VTYA 2E9XA 3NZPA 4U0ZA 2K9AA 3FEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FU3 A;  1DVP A;  1JPL A;  5CMW A;  3ZYM A;  5J08 A;  3RRU A;  1HFA A;  1HX8 A;  1UJJ A;  3G2V A;  3ONK A;  1HG5 A;  2DCP A;  1JWF A;  1X5B A;  5LP0 A;  1EYH A;  2QY7 A;  4NAC A;  1VDY A;  3ONL A;  4GZC A;  2MOW A;  4AVX A;  3ZYQ A;  2V8S E;  1XGW A;  3CLJ A;  1MHQ A;  2DIW A;  3D9N A;  2L0T B;  5LOZ A;  4HFG A;  2BF0 X;  3LDZ A;  3D9M A;  4GZD A;  3G2T A;  1PY1 A;  1JWG A;  3G2W A;  2L0I A;  4FLB A;  1INZ A;  2LO6 A;  1LF8 A;  1H0A A;  5CMY A;  3D9O A;  3ZYK A;  1SZ9 A;  1HG2 A;  3D9K A;  1JUQ A;  1SZA A;  3D9J A;  3G2S A;  3ZYL A;  4JXT A;  3D9L A;  3G2U A;  2KM4 A;  3D9P A;  3D9I A;  1HF8 A;  4Q96 A;  4Q94 A;  1UJK A;  1ELK A;  1EDU A; 
#chains in the Genus database with same CATH topology
 2FO7 A;  1BI7 B;  3S7F A;  5JDH A;  2V0P A;  3RU0 A;  1HNW T;  1JWF A;  5AQM B;  4JZY A;  2Y8D A;  5KX5 E;  3QDN A;  3L82 A;  2W00 A;  3QNK A;  3MZL B;  2LEH A;  2X3M A;  1D0Z A;  2BS2 A;  2D9D A;  3ONX A;  4TWF A;  3B7U X;  4GPM A;  3NB2 A;  4IN3 B;  4G25 A;  1HE8 A;  2UUA T;  2YIN A;  2OEV A;  1OWA A;  2EIN E;  2XEH A;  1KZO A;  2MBG A;  5CMY A;  3D9I A;  5AAR A;  5HWY A;  2Q9Q A;  4KMO A;  3FB2 A;  4GPK A;  1AP7 A;  5BV1 A;  3JQ1 A;  5EK2 A;  1K8K G;  3F2E A;  4EHM A;  3PEU B;  5JDN A;  2R17 C;  3DXK G;  4LER A;  3V30 A;  4CZZ B;  4DI3 A;  3LDZ A;  3ZST A;  4OHF A;  2Y1L E;  1Z3Y A;  5BW8 C;  1HG2 A;  2MTQ A;  1MJ0 A;  2J8S D;  3CHM A;  3TXM A;  3ENE A;  1V9D A;  1OED C;  3I3N A;  2XQY A;  5LCY A;  3VTX A;  2IF4 A;  4AV7 A;  1QZ2 A;  3SFY A;  4GA2 A;  5L2L A;  4O6F A;  4AKR B;  3CVY A;  2BBJ A;  4IT4 A;  3ZCJ A;  5JDF A;  5DQV A;  2BG9 B;  4GB9 A;  3PUX F;  4WWO A;  3RRN B;  2KAT A;  5DIZ A;  3PVL A;  5AQN B;  3RK6 A;  3D3M A;  4DUY T;  2VWA A;  5T3R A;  1IXV A;  3HKC E;  2FO1 E;  3FFL A;  2WXR A;  2ZM8 A;  3AG2 E;  3L39 A;  2PZI A;  2WWU A;  4KP3 C;  3CKD A;  3IBE A;  3CVP A;  1OED E;  4M7C A;  2BDE A;  2IEJ A;  4QXH B;  2V6Y B;  3UIO C;  3NZS A;  4LMK A;  2VJ8 A;  2BKP A;  2X67 A;  4XZ4 A;  3M3Z B;  4A98 A;  3HG0 D;  3DBS A;  1MNE A;  3C4Z A;  2HR2 A;  3VRB A;  4ADZ A;  4ERR A;  2VAS A;  2VYI A;  2WXK A;  2XUE A;  2VKJ A;  4EPZ A;  4CI2 B;  3Q5E A;  3LDQ B;  4OVV A;  2EHO B;  4IDO A;  4QWN B;  5ABH A;  3AU5 A;  4YDO A;  1OCC E;  4MBQ A;  4I55 E;  3GMI A;  2WQ7 A;  5JR9 A;  3FZK B;  4EGW A;  3D9H A;  3UTM A;  5FVK A;  4UQY A;  3HIZ A;  1UUR A;  3UUM A;  1S70 B;  3R7R A;  5LG3 A;  3PV0 F;  4B3S T;  3TWU A;  4LG6 A;  3AE5 A;  2J4B A;  2JQK A;  4I1A A;  3UKU G;  4LF7 T;  4AIU A;  3U78 A;  1H6P A;  4K0R A;  3KV6 A;  3SFZ A;  3RYH E;  1WYB A;  3CIR A;  3HVE A;  3RIU C;  3ETU A;  3UT4 A;  2ZM2 A;  4DV5 T;  4AY5 A;  4YY3 T;  4N3A A;  3JAF A;  1OXZ A;  4TN7 B;  2VQF T;  5ADX L;  3JC6 D;  2DBA A;  2JMK A;  2PJQ A;  2E0I A;  1E90 A;  5JJ7 A;  4HWH A;  2IC6 A;  3APF A;  2FBN A;  3P50 A;  1WR6 A;  2ILR A;  4MHC A;  3LJ3 A;  4K0U A;  5CCM A;  3AVR A;  1NFI E;  2HH7 A;  4H9R C;  4A97 A;  5J90 A;  2P9B A;  1KNP A;  3UM2 A;  2WU2 A;  4I6E A;  1H2T C;  2HO1 A;  1NA0 A;  2LSI A;  1JNR A;  5DJQ C;  2YOE A;  4CRW A;  3ONJ A;  5ARG A;  3TL5 A;  2WDV A;  4K5C A;  4N5C A;  1KT1 A;  4XAX B;  4CXY A;  5HEH A;  3HDX A;  2BBH A;  2L0I A;  4LF9 T;  3AE2 A;  4LFA T;  1G73 A;  5LXT E;  5FMN A;  3ZYK A;  4JLE A;  4DV7 T;  1IKN D;  3CHS A;  2LXL A;  3Q5M A;  2LRL A;  3FH8 A;  4U7Y A;  1MZC A;  4AM9 A;  1HX8 A;  3MCX A;  3CHQ A;  4F1P A;  4ZI2 D;  4N2Q A;  4BET A;  4IDQ A;  4CZ2 D;  3TLU A;  2Q9Q B;  3FP3 A;  5BMV E;  5HEO A;  4JB8 P;  2NTY A;  5FNV E;  3PZ1 A;  2X9Y A;  2JLB A;  5H7P A;  3CX6 B;  4ATG A;  4EAH A;  3AE4 A;  3ZPJ A;  2IO3 C;  2XZT G;  4EOZ B;  4DRX E;  2Y0B G;  3FU6 A;  5IUX A;  2OV8 A;  5LMN T;  4ME2 A;  3JUI A;  2AW6 A;  5KMG P;  1N34 T;  3EVY A;  1KNZ A;  3HXD A;  3CQX C;  3TWW A;  5HAX A;  2E9X D;  3FXD B;  3OTN A;  4U72 A;  4HWF A;  4AVX A;  5A23 A;  2WQY A;  1OWN A;  2VSN A;  2CBI A;  2GW1 A;  2C0S A;  2E8I A;  2LSV A;  4EB6 E;  3ABM E;  4OAV B;  3CR3 A;  3AE7 A;  1IYG A;  2I9C A;  2FJB A;  4ZI2 C;  3VLF A;  1G3N B;  1TNY A;  3N71 A;  3P4R A;  1H7C A;  3SFE A;  2XQ3 A;  2VVN A;  1AWC B;  2J47 A;  3K3Q C;  5FXX A;  3HXF A;  4JA9 A;  3KVB A;  3HKD E;  4EIW A;  5CBN A;  2WQ6 A;  2HN1 A;  2J08 A;  2V5C A;  2YHC A;  2KZ7 B;  3OPC A;  4X62 T;  2XCB A;  3A8Y C;  2E9X C;  3O9X A;  5AAO A;  4PK4 A;  1NEK A;  4CDR A;  4TV8 E;  5KBA A;  3LVQ E;  5LX8 A;  1UCU A;  2V4H C;  2DWK A;  3CVU A;  4B0Z A;  4X1Y E;  1OED A;  3AE1 A;  5CHE E;  4JYA T;  4F8H A;  2ZXW E;  1VDY A;  4E6H A;  4KYO B;  5LGT B;  2XQ0 A;  1CUN A;  5JR9 B;  1S64 A;  1BR2 A;  3CQC B;  3FZM B;  2CE7 A;  2D0U A;  3K8P C;  4O8S A;  1AJ3 A;  2MPK A;  3UT5 E;  3FTZ A;  3QJZ A;  3JC6 C;  4CXX A;  5L3E B;  4XKC A;  3TGO A;  3ONK A;  2FI7 A;  3NAW A;  1QUU A;  1ZP0 A;  2JQH A;  3P4S A;  4GCN A;  3C4W A;  3CML A;  2C5I T;  3LK4 2;  2VGX B;  4O4J E;  4HNA D;  5EIL A;  5A7D B;  3ZT7 A;  2ZGG A;  3TJP A;  4PW8 A;  3NZQ A;  1IHB A;  1X9B A;  5ABG A;  2XAF B;  1K3Z D;  4ZEY A;  2AE9 A;  1ELR A;  4JA7 A;  4GKK T;  4YTM A;  3PUY F;  4QXC B;  4HBD A;  1XNF A;  3CX7 B;  3ML9 A;  4I6J A;  4CDM A;  2V6X A;  4CN1 A;  3RX6 A;  2QZA A;  5JRC A;  5EK3 A;  2D5U A;  4HOS A;  2AVP A;  4RLY A;  2XY8 B;  2IFU A;  3RRM B;  2XM2 A;  1DC2 A;  1UX5 A;  3UT7 A;  3EDV A;  5CA0 E;  2DZN A;  3LVR E;  5LGN B;  3SO8 A;  1OWO A;  4DR6 T;  2OVF A;  2NP9 A;  4ABN A;  3AVS A;  3DSW A;  1YXR A;  3PE0 A;  5HRY A;  2YKS A;  4BT8 A;  4HOR A;  4U2Z A;  3SFX A;  5J2T E;  3Q7A A;  2DVW A;  4EZL A;  3MA9 A;  4WNK A;  5LBM A;  5JQG E;  2J9Q A;  1FIO A;  2PG8 A;  3AG4 E;  4EBA G;  4ASK A;  2KM4 A;  4J8Y A;  3EUV A;  2XGM A;  2BS3 A;  3E08 A;  4JEH A;  4JI6 T;  3PE3 A;  1XDO A;  2KC7 A;  1N36 T;  5AQB A;  4U8Y D;  5FY7 A;  1QBQ A;  2C2L A;  2LAH A;  3QB5 A;  5E75 A;  2ZIR A;  3WI3 A;  3ULE G;  1B7T A;  1DNP A;  1BI8 B;  3LY9 A;  3RYF E;  4FJZ A;  2KND A;  1OCR E;  3Q9D A;  3DXM G;  2Y6X A;  4ILG A;  4QFV A;  5HEU A;  1TNZ A;  3QK0 A;  1IBM T;  4CGW A;  2KCV A;  3CVX A;  2IQC A;  4YFS A;  3D9P A;  3PH0 C;  4NXM T;  3PUQ A;  5AQ9 A;  4DV1 T;  2J07 A;  1N4R A;  3N9M A;  3S2A A;  1XWM A;  2W61 A;  3K3N A;  3EHQ A;  1W3B A;  3RHW A;  1SE7 A;  2WP9 A;  2UXD T;  5AYW D;  5KJN A;  2WXQ A;  2Y48 B;  5L3B B;  1ZOY A;  4ZHQ E;  2I0M A;  3N2O A;  4JEU A;  3WG7 E;  2QC9 A;  2PQN A;  3EU5 A;  2AJA A;  2DYS E;  4N3B A;  2LXM A;  3AXJ B;  2LHN A;  2DL1 A;  2Y4U A;  3TLS A;  2N1G A;  4YHJ A;  3C98 A;  5LB7 B;  5FQ8 A;  2GK9 A;  4UQX A;  4I6G A;  4HRN A;  4XKB A;  2J09 A;  5C1D A;  3RKO A;  2HE0 A;  5AQO B;  4PS8 A;  5GON E;  1N94 A;  2XAS B;  4I9C A;  4A55 A;  3BG0 B;  2J4D A;  1LVK A;  2RFM A;  3ASH A;  4ZI3 C;  3FTU A;  4TUU A;  2AXZ A;  1JCR A;  1N4S A;  2XAQ B;  3UUL A;  1OWP A;  4BTB A;  2SPC A;  2L6B A;  3AG1 E;  4QXB B;  2RG8 A;  2LRK A;  2WAU A;  4WZX A;  1OT8 A;  5JA4 D;  4AQF A;  1WG0 A;  3ZT5 A;  3G2U A;  3C3O A;  2CHW A;  4GTP A;  3NOG D;  3RIA A;  3ANW B;  2UY1 B;  1X5B A;  3ZCI A;  3Q78 A;  5FIN A;  4DVD A;  4MRU A;  4APF A;  4UV9 B;  4PFO A;  3UU5 A;  1TN6 A;  2IUB A;  4Z90 A;  3ZMS B;  3F31 A;  3JXI A;  5AIJ A;  1UGO A;  2F8Y A;  2Y3A A;  4AJW A;  2RA1 A;  5AQI B;  4U04 A;  4OK0 A;  5CJ5 A;  3AAA C;  4N5Q A;  5CED B;  1X79 A;  4N78 D;  1V55 E;  2NR4 A;  3FBZ A;  3KDS E;  4NUV A;  3ONL C;  3MV2 B;  2H88 A;  2XQ9 A;  2XGS A;  3V2O A;  2VL0 A;  2WMN A;  1Y64 B;  4XIF A;  5JTG A;  3RQU A;  2OLT A;  2LJL A;  2WU5 A;  1YQ4 A;  5HXH A;  1INZ A;  1ZHC A;  2R6G F;  3CHR A;  2V5Q C;  2R02 A;  2D2S A;  1NI1 A;  5AQF B;  3AA0 B;  5HI7 A;  4PH4 B;  2V8S V;  4GTO A;  2CWO A;  3PUZ F;  4AXP A;  2Q7F A;  2XQ5 A;  2IAK A;  2XQ6 A;  2EHO A;  4DV3 T;  1UX4 A;  4A5X A;  2V5D A;  1WY6 A;  4JVS A;  3TWR A;  4GTQ A;  4UV8 B;  4HGA A;  2JEK A;  2XGO A;  3LXU X;  2CHN A;  1FT2 A;  2X6I A;  1T8B A;  2MYO A;  1YMP A;  4H9P C;  3IHR A;  2W67 A;  5AQP B;  3D9O A;  3UQ3 A;  5LFA A;  2CWY A;  3E4B A;  4W9R A;  1DCQ A;  4YDW A;  3TWQ A;  1SA4 A;  4U74 A;  3DSS A;  2XZD G;  1HG5 A;  2WXF A;  4GZC A;  3DJB A;  1XZY A;  1MMA A;  5BV0 A;  2LNI A;  5J0Z A;  4O4H E;  2BKK B;  3B7R L;  3SQV A;  1HXI A;  3BQO A;  1WR0 A;  5J1G A;  5ABF A;  3ZIM A;  4BEP A;  2LLY A;  3ZT6 A;  1HZ4 A;  1ZB1 A;  2LO6 A;  2F37 A;  5KJK A;  3Q2M A;  5ETW A;  4I43 B;  3VLE A;  4A1S A;  3ZXS A;  5JVD E;  1J5E T;  2LSY A;  3ZYL A;  4GAA A;  2UWJ G;  4CI1 B;  5ANR A;  3X2Q E;  2A5U A;  3OXL A;  4DUI A;  3BK9 A;  4AOF A;  3HR0 A;  1EF1 C;  4U7I A;  3GZ1 A;  4EZK A;  3RGL A;  2AXD S;  2BG9 E;  4WBO A;  3ZN0 B;  2YDQ A;  2C0L A;  1M7K A;  2P9S G;  3LJN A;  3ULQ A;  4HOT A;  3AE8 A;  3FTW A;  4XE0 A;  5KXJ A;  1XNR T;  2XJ7 A;  3N9Q A;  4HS2 A;  4JEU B;  2L8K A;  4Q96 A;  2WPV A;  2XS1 A;  1HX1 B;  2IC9 A;  2XAJ B;  2C5K T;  4UWF A;  2WCA A;  1UOH A;  4GOU A;  3KV4 A;  3PUV F;  4PK5 A;  2MOW A;  4L5G A;  3K1S A;  4L9P A;  4LNU D;  2FF4 A;  4ZOL E;  3HKE E;  1G8X A;  3ZVV A;  4AKH A;  2EQX A;  4G63 A;  5AQT B;  2BF0 X;  2WB5 A;  2CMR A;  3LEW A;  2B6C A;  1N32 T;  4CT0 A;  5EDS A;  3LKU A;  4BTA A;  4CI3 B;  2OEW A;  3G2S A;  5L3D B;  4K0K T;  4Y6C A;  3UU6 A;  4B8C B;  2VSX E;  3HXC A;  3UPV A;  2OND A;  2ODU A;  3AEC A;  5KWD A;  3UUX A;  3PRE A;  3Q9U C;  5FZR A;  4DLQ A;  2XQ8 A;  5HCM A;  2CG2 A;  4U8H A;  3FUE A;  2V5F A;  4GYO A;  2R2L A;  2V4L A;  5LBQ B;  3DEO A;  1BR1 A;  2HPL A;  2MYS A;  2X0H A;  2CFU A;  4FUL A;  2W0G A;  4KMC A;  4DR3 T;  2PNN A;  2JQ9 A;  2IIU A;  4WAF A;  2C0M A;  4GA0 A;  3PDN A;  4LRZ A;  1IHG A;  4C90 A;  3DTO A;  4XBF B;  4X5T A;  2J1D G;  3I1A A;  4QX7 B;  1TN8 A;  1BD8 A;  3NF1 A;  2JMH A;  3B5M A;  3ZC0 A;  4FP7 A;  2WQH A;  4R7L A;  3C51 A;  4B93 B;  1E2A A;  2CHO A;  1JPL A;  2LM9 A;  2N9D A;  4JHK A;  5FXV A;  4TXP A;  4BWR A;  3CV0 A;  2H6I A;  3Q5D A;  2E5L T;  4ZS3 A;  2PTF A;  1D1C A;  1VOM A;  4LSZ E;  2OCC E;  3OBV E;  3LG7 A;  2WVI A;  2K48 A;  3N2K E;  4U0S A;  3D0T A;  1E8X A;  4UVA B;  2KBX A;  4LUN U;  1W0A A;  4KX6 A;  3FUF A;  5LP6 E;  5AQL B;  1OCZ E;  1FMW A;  4LNB A;  4ILB A;  3U3I A;  4P0B A;  2HPJ A;  2VUR A;  4EXT A;  5L3F B;  3APC A;  2VQ2 A;  3NKZ A;  3RC3 A;  1WFD A;  2DZO A;  3CPZ A;  2IOL A;  2XCC A;  2YK0 A;  2RKK A;  2UUB T;  2VKH A;  4TRQ A;  5AJL A;  3DSV A;  1BLX B;  3KS2 A;  3RRW A;  2UXC T;  1UG3 A;  1QSD A;  1YKE B;  4BSZ B;  3EHN A;  3S7D A;  3KEZ A;  3ZN3 A;  2LHR A;  5G05 J;  4X65 T;  5AQJ B;  3P7I A;  4Z8X A;  2LOS A;  4B6X A;  3PUG A;  2LSK A;  1U3C A;  2VTB B;  4JI5 T;  3V5S A;  4YJ3 E;  2D0T A;  5BR8 T;  3ZEF A;  4P1N A;  2F8X K;  4HI9 A;  4CT4 A;  5JHA A;  5LGU B;  3TWT A;  5HKP A;  2NW8 A;  4IE4 A;  2P9L G;  2P9N G;  4ILH B;  4IST A;  2GRL A;  5L47 A;  2GRR B;  4LF8 T;  1HH8 A;  4O4I E;  1E8Z A;  2NTX A;  4GMR A;  5HS0 A;  3SF4 A;  4JUY A;  2CEA A;  3FZF B;  1E7U A;  2ZGD A;  4F7A A;  4UI9 C;  2PM6 A;  3IKO B;  3SRZ A;  3VKG A;  3KVA A;  4V3I A;  4RSY A;  4YXD A;  1N52 A;  5G55 A;  3SD5 A;  3MKQ B;  2XQA A;  1KPS B;  3V31 A;  3I0O A;  1QYM A;  3PZ4 A;  3Q4A B;  4GYW A;  5D66 A;  2XTL A;  5EK4 A;  3SOL A;  4XX5 A;  3UIP C;  1O1T A;  4B89 A;  4TZ4 C;  4IIJ E;  3E22 E;  4GZ6 A;  3L09 A;  3ESL A;  5KDM C;  2BS4 A;  2HM8 A;  4UWK A;  5FL1 A;  2ZU6 B;  2NYJ A;  1W09 A;  2CM0 A;  1MMD A;  3B7T A;  2QA7 A;  4TWH A;  4TV9 E;  5IYZ E;  4DX2 A;  3PUW F;  3AB3 B;  5D0O D;  3C5R A;  4JEH B;  2X6F A;  1LVF A;  1P5Q A;  1SA0 E;  1UUS A;  5LHH B;  2BTD A;  4HOQ A;  4EBA A;  3IBP A;  1O3X A;  2VVS A;  4K5B A;  4ZXL A;  1IBK T;  4F53 A;  5FQ6 A;  3CVL A;  4UWH A;  3DSU A;  3PZ2 A;  4WW0 A;  2F0Y A;  4NRH B;  3UFE A;  3RLF F;  2NSZ A;  4ANV A;  3L17 A;  4P29 A;  2K3W A;  2IJG X;  3E0Z A;  1W9R A;  4HFH A;  4UVB B;  4WNF A;  3UT8 A;  2RP4 A;  1NZN A;  3ZYQ A;  4DBQ A;  4DMV A;  1N0Q A;  1U2V G;  4DLO A;  2NC9 A;  3FUL A;  4HFG A;  3CVN A;  3FUH A;  3UI2 A;  5L4H A;  4YJ2 E;  3MKR A;  4DR7 T;  1PAQ A;  5BT1 A;  5ENN A;  2I59 A;  4L2L A;  4HE8 A;  4D10 C;  1D0X A;  4U07 A;  4OAU C;  2J49 A;  2XEE A;  5T4Y A;  3HYM B;  3G2W A;  3Q79 A;  2YEV C;  3I0Q A;  3AJI A;  3QB2 A;  4ILI A;  5ANL A;  1QNF A;  3NZU A;  4BES A;  2DYR E;  3ZC1 A;  5LNK A;  4HVB A;  2BG9 C;  1IAP A;  1ZEE A;  1MMG A;  3I4G A;  4UIG A;  5E0O A;  3ZMV B;  1T72 A;  4Z68 A;  2WZH A;  1IBL T;  2CCQ A;  4HXI A;  3RJV A;  1N54 A;  3DST A;  2ZMA A;  4GYY A;  2BVM A;  2CA5 A;  4CXW A;  5H6R B;  3LCA A;  4WBN E;  2IML A;  1KF6 A;  4U7E B;  2LKH A;  3P2B A;  4NXN T;  3V5U A;  5E76 A;  1E7V A;  2K5B B;  1WAO 1;  1LD7 A;  2E2A A;  5C8Y E;  3GZ2 A;  4GIW A;  4ACL A;  4PAG A;  2VQE T;  3FUK A;  4DV4 T;  4WNE A;  4O2B E;  4KZ0 A;  3AE9 A;  4GTM A;  2WDQ A;  3D9M A;  3NWI A;  5ABE A;  4EZH A;  3F6Q A;  4XI0 A;  2H3R A;  4UF0 A;  3AS5 A;  3ASG A;  5CRV A;  3MEK A;  2VGY A;  3FU5 A;  5ENO D;  1Y6I A;  4J2C A;  2QYW A;  2CHZ A;  4FLH A;  4QKN A;  2P9P G;  4CGV A;  4ZHB A;  3PUJ A;  3ZEF B;  3PE4 A;  4GU5 A;  4PDX A;  2XPZ A;  4J8E A;  4EEB A;  3Q5W A;  3FH7 A;  4URK A;  2XS8 A;  3J7Y q;  5LCW J;  4KUM B;  3CQG B;  2AWI A;  1HNX T;  4DR4 T;  3FZL B;  2KSR A;  4IL4 A;  5L4E A;  3DPD A;  2WXO A;  3Q7F A;  3EJN A;  3QK6 A;  1ELK A;  1EDU A;  1VCS A;  5M4Y A;  4MLK A;  4ISS A;  4HLE A;  1JCS A;  4L2Y A;  3UTK A;  1N4Q A;  4NPP A;  3ASN E;  3MKD A;  4I1O B;  5CCL A;  2DWG A;  4ZI3 D;  4XZC A;  4IHJ E;  2VSY A;  4TXQ A;  2CLY B;  1TR4 A;  2X38 A;  4HTE A;  2XSB A;  4NUU A;  5FXW A;  3CKC A;  1KEY A;  2VKO A;  3T8M A;  4YVQ C;  2Y4T A;  3WAJ A;  4ANW A;  4IDN A;  2DI4 A;  3GA8 A;  3N9P A;  3UMV A;  4GKJ T;  1ZU2 A;  3DEP A;  3FHE A;  5LCW C;  3O1I A;  1OY3 D;  4DV6 T;  3IV0 A;  4L1B A;  4X64 T;  1GQE A;  2BED A;  3GN5 B;  4CN6 A;  5G04 C;  1R8I A;  5LYJ E;  5EID A;  4IUL A;  2KT9 A;  2V7M A;  2X68 A;  2JPF A;  1IQU A;  2ODV A;  2UU9 T;  2DIW A;  2IO2 C;  3IEE A;  4O1O A;  3ZNG A;  3FTV A;  2FJD A;  4YVO A;  1E8Y A;  1FPP A;  2RFA A;  4F6R D;  3FUN A;  1HR0 T;  2WXL A;  4FU3 A;  2VB6 A;  1WRD A;  4PUC A;  3AG3 E;  3E32 A;  4TNW A;  4UQZ A;  4F1S A;  3AXJ A;  3ZMZ B;  1S0P A;  1Z5S C;  4N3C A;  3SBS A;  2X0Y A;  4K5A B;  3GYZ A;  3ABK E;  3T5X A;  2GRM A;  3CST A;  3SGH A;  2PBI A;  3OKQ A;  2JJ9 A;  1CHU A;  4GTV A;  1YYH A;  2XRZ A;  2ZM6 T;  4P09 A;  5G2N A;  2WXG A;  4OYK A;  3ISM C;  3VR8 A;  5LOV E;  3U9W A;  4HFC A;  3NRX A;  2ES0 A;  4HQD A;  2ETC A;  3C3R A;  4COF A;  5ENT D;  2L3L A;  3KSL A;  3FWV A;  3B57 A;  4U95 D;  1DU2 A;  2W62 A;  4ZZC A;  3MXZ A;  5L3C B;  1LD8 A;  1M62 A;  4LFB T;  4GK5 E;  1UN8 A;  3HL6 A;  3AAA B;  5AQA A;  2JRK A;  1X81 A;  2UXX B;  2LSG A;  1NL4 A;  1TNU A;  4GZ5 A;  2FJE A;  2L0T B;  4JW1 A;  2UUC T;  3AA6 B;  4X1K E;  3CWZ B;  3I5P A;  3E34 A;  4ANJ A;  1DCE A;  1D8D A;  3MJX A;  2KCK A;  3EDU A;  5HXC A;  4FI5 A;  1HF8 A;  3RYI E;  3PS6 A;  4FHJ A;  5EN5 D;  4BER A;  4H7Y A;  4C0E A;  1L0V A;  4KBQ A;  3L22 A;  1MMN A;  4HEA A;  3CK9 A;  3ZKR A;  5AJD A;  3B7B A;  4LF5 T;  4JBW F;  1MQS A;  3Q75 A;  1XGW A;  5FWQ A;  5B1B E;  3FTX A;  3KD7 A;  3FTS A;  2LSU A;  3CIA A;  2FJA A;  4DUZ T;  1B89 A;  4EED A;  3JAE A;  3L3P A;  1E8W A;  5C2Y A;  1K1A A;  3LFM A;  3W15 B;  5FJY A;  3UKR G;  1XDP A;  2VSO E;  4Z91 A;  1KT0 A;  2R5S A;  2V6Y A;  4YSZ A;  2P9K G;  2KWI B;  3O4Z A;  3Q5X A;  4U31 A;  3PU8 A;  3OYX A;  3U3W A;  4UR9 A;  4UUC A;  1N33 T;  3TXN A;  3E37 A;  2L9B A;  2KZT B;  4IE6 A;  4YSY A;  2WSS V;  3H3M A;  1J1J A;  2A3D A;  3LK3 B;  1IQR A;  4YSX A;  3PNL B;  3EUH A;  4I9E A;  5AQH B;  3EIQ C;  2IU1 A;  3FDH A;  4YTP A;  5BXU A;  3I9Y A;  2DWZ A;  1YD8 G;  4V1A v;  2KIN B;  2QRX A;  3UFG A;  3CSF A;  4ILU A;  5A1L A;  2IY0 C;  1QLB A;  3ZPO A;  1WYC A;  2A2F X;  4M1P A;  5KJL A;  3RYC E;  4AQG A;  4AXH A;  4H9S E;  3QWP A;  5CMW A;  3PJA J;  3QOU A;  1OWL A;  5JRE A;  4K03 A;  3CK7 A;  1ZBP A;  5ENR D;  1KFY A;  4JL0 A;  2K24 A;  1HO8 A;  3NOC D;  2L9Q A;  5FYM A;  4AI6 A;  1NA3 A;  3L6A A;  2H6F A;  3QAR A;  5FY1 A;  3QWW A;  3RF1 A;  3LPZ A;  2CFZ A;  4ANU A;  4B94 A;  1YA0 A;  3QOF A;  3R6N A;  1Q2Z A;  3TLW A;  3FY4 A;  3OXG A;  3EHR A;  2A5E A;  1K1B A;  2R05 A;  1LF8 A;  4G24 A;  3KSQ A;  4RQI A;  3Q47 B;  1SZ9 A;  4EZJ A;  4YHH T;  2KXP C;  3T5V A;  4ILC A;  3Q15 A;  3BG1 B;  4IE0 A;  5FXZ A;  3OVU A;  4BJM A;  3CGH A;  1EPU A;  3PU3 A;  3ZLI A;  1MX2 A;  3DP7 A;  4DJA A;  2QY7 A;  4JI2 T;  3P4P A;  4U3C A;  3OJA A;  2XQ4 A;  2GRP B;  4AKL A;  3KEA A;  4B3T T;  4J0U A;  2GRO B;  3UX4 A;  1S94 A;  4NUR A;  1O1S A;  1UK5 A;  1JNZ A;  3S4U A;  2M63 A;  3T9K A;  5EIB E;  2X9H A;  3LBX B;  2XHE A;  4J6I A;  2YU1 A;  2R59 A;  3BUA A;  5J08 A;  1FEW A;  3AEB A;  5M72 A;  5CRU A;  5ENS D;  4EZ4 A;  1BR4 A;  5HQ8 A;  1TN7 A;  1OWM A;  3UIN C;  3RPU A;  3TLV A;  3HI2 A;  5HYA A;  1YKH B;  3J9X 1;  3D9N A;  3PEV B;  3PUK A;  2CRB A;  1WM5 A;  4KI0 F;  5FZS A;  1U4Q A;  2QGS A;  3D9K A;  3KAE A;  3N9N A;  2KMF A;  3BU8 A;  1NAF A;  4TUY E;  4UEL A;  2W63 A;  4EYU A;  3CHP A;  5FQ4 A;  3VHL A;  5AQ7 A;  1HFA A;  4I50 E;  2LAI A;  3JAD A;  4JV5 T;  3ZSS A;  3C3Q A;  3JUE A;  4AY6 A;  1N9A A;  2PL2 A;  2DHR A;  4GK0 E;  2OVB A;  5AQS B;  3UUX B;  3FEX A;  3EU9 A;  5EYP F;  2I2O A;  2E2E A;  3TAX A;  2XRY A;  1PY1 A;  2JAB A;  4H9N C;  4H9O C;  3MZK B;  4IL9 A;  4DX6 D;  2QVA A;  1JUQ A;  4FC8 A;  1WLX A;  3AED A;  3LSV A;  5KNH D;  2DCF A;  2WBL A;  2IOS A;  4MBG A;  1QQE A;  2JIW A;  1UJJ A;  3G2V A;  2FUP A;  3ZKJ A;  4IE7 A;  1BPO A;  3LJC A;  5F3J A;  2H6G A;  5AQQ B;  1RW2 A;  5BNW A;  2IDO B;  3I9W A;  1XNQ T;  3EHM A;  4X8Q A;  3SHF A;  3T8K A;  2ZIS A;  1Z0P A;  2WWV A;  1HS6 A;  1Y8M A;  3ZGQ A;  4BX9 A;  4HB5 A;  3MX3 A;  4G23 A;  5LG4 A;  3LK2 B;  3C72 A;  4I0U A;  4G1T A;  3N2G E;  2CXL A;  4B3M T;  4A3V A;  1NWM X;  2BKO A;  3KV5 A;  2CBJ A;  4L9I A;  2E9X B;  2MRI A;  4PJJ A;  1O5M A;  3R9M A;  1HTJ F;  2DCP A;  3CK8 A;  4FHK A;  4G2V A;  2VK9 A;  3UXG A;  3RSE G;  3CX8 B;  2VKD A;  4GYS A;  3UUN A;  3SZ7 A;  4APO A;  5LJN A;  5FIO A;  5FZQ A;  4WWP A;  3MGB A;  4J7W A;  5EZY E;  4DR1 T;  3O1H A;  2V26 A;  4Y6W A;  3HKB E;  5HEJ A;  5JDQ A;  2X0L B;  1TNO A;  4JPS A;  3H3A A;  3GW4 A;  1VCT A;  1W0B A;  2E5V A;  2BKG A;  3S7J A;  2H7O A;  4PS7 A;  4A3T A;  1TJC A;  3AU4 A;  1MX4 A;  5JMN D;  4TNV A;  4H63 H;  4O4L E;  4JI3 T;  5EX3 A;  3PUA A;  2VGE A;  1S63 A;  4AIS A;  4DX1 A;  2WXM A;  3AAI A;  2V7J A;  3PTR B;  1NP7 A;  2GRN B;  3L16 A;  2IHR 1;  1D1B A;  1VRB A;  2MAW A;  3TG4 A;  1SHZ C;  3MA5 A;  2X66 A;  3HA4 A;  3ZMT B;  4ANX A;  2A4Z A;  5ENQ D;  4DMW A;  5C2T A;  2ZLY A;  4MFR A;  2MHK A;  3APD A;  4O60 A;  5A6C A;  1HNZ T;  3TWV A;  3NRY A;  1YQ3 A;  1T7S A;  2VGX A;  5D2M C;  2CLY C;  2KXP B;  4GTT A;  2ACZ A;  3K9I A;  4G8K A;  4X66 T;  3ZHE B;  5J2U E;  1E96 B;  2V1D B;  2FUL A;  4KZC A;  1PC2 A;  5JRC B;  5ITZ F;  2EIL E;  2FEZ A;  4IRU A;  3MJW A;  4WUY A;  1U3D A;  1Z3X A;  2EIM E;  4RG6 A;  3T1H T;  2HYZ A;  4CEM A;  4LF6 T;  4HFB A;  3G06 A;  4HLL A;  1H6O A;  2XM1 A;  5IWA T;  3I4R B;  1LRZ A;  3ZYM A;  1XMQ T;  5KNG A;  1XMO T;  3IHV A;  3CKB A;  5AQK B;  4GYR A;  3HXB A;  4DO0 A;  4TUM A;  4BX8 A;  3ANW A;  3SNX A;  2KWH A;  3VLD A;  3CEQ A;  4YLH A;  4G8L A;  4WNG A;  2KCL A;  4DV0 T;  4QH1 A;  4BFR A;  2YHE A;  3KV9 A;  4U8V D;  5DAB A;  4AKG A;  3KBT A;  2Y69 E;  3PDY A;  3EI0 A;  3UQ4 A;  3P4W A;  3NBX X;  1N4P A;  1FMV A;  3B95 A;  4DX7 D;  5T8I A;  4GCO A;  2X6J A;  2V7L A;  3E30 A;  3HHM A;  4JI0 T;  3MYV A;  4BAY B;  4H7X A;  2YDR A;  3GN5 A;  5IHY A;  4HWC A;  3ZJ2 A;  3IEG A;  4KVM A;  1H6K A;  5CA1 E;  3QAQ A;  3ASO E;  1SA5 A;  4LF4 T;  1H0A A;  1OUV A;  1V54 E;  3NBN B;  1SQM A;  4Q69 A;  4TWD A;  1US7 B;  2M6B A;  3J5Q B;  3B13 A;  5B3S E;  5CGM A;  1L5J A;  3DWL G;  1KK7 A;  4ACK A;  3ETV A;  4IRE A;  3E33 A;  4BSX A;  4NAC A;  2XPK A;  3AEE A;  2LKG A;  3L54 A;  4CDN A;  3ABV A;  1ZV4 X;  2X9X A;  4XI9 A;  5B1A E;  1Y01 A;  5JDL A;  4YTN A;  4PS3 A;  4BJN A;  2WDR A;  2XPI A;  4U2Y A;  2ION A;  3AA1 B;  5EKQ D;  5HWX A;  4KXK B;  4PJL A;  3KBU A;  1I94 T;  3Q49 B;  2B76 A;  4PNI A;  1DVP A;  5LJM A;  3GWH A;  2X6K A;  4N2S A;  2P9U G;  3GZS A;  1S35 A;  3F57 A;  4F3V A;  4DR5 T;  1D0Y A;  2H89 A;  1UW4 B;  1TJF A;  4X1I E;  4HRL A;  3PUR A;  4IE5 A;  2I1K A;  2W66 A;  4BY6 A;  1MIV A;  2RD0 A;  5AN8 A;  3ZUV B;  2LOP A;  3RRC A;  3N5L A;  1N11 A;  4LMJ A;  1IJ6 A;  1MYO A;  4GTS A;  4ZFH A;  1U5P A;  1ZKE A;  3LY7 A;  4U96 D;  4JD2 G;  2H6H A;  3CHO A;  4PK6 A;  4JXT A;  1E7P A;  4EV6 A;  2UY1 A;  4LEU A;  3R7Q A;  4FJO A;  4UXN B;  4I43 A;  1FJG T;  5TAO A;  3W9G A;  3RRU A;  1BU9 A;  3JYS A;  3W9F A;  3SI5 A;  3C50 A;  1TYQ G;  3RAU A;  4L7T A;  1TEZ A;  5FY0 A;  4JHJ A;  2CHX A;  3R84 B;  3FTY A;  4N39 A;  2ACX A;  1GW6 A;  5FP3 A;  5KCM A;  4O2A E;  1FCH A;  4GZD A;  2B0O E;  3EHZ A;  3FZH B;  2WXH A;  4U33 A;  3EDT B;  1KLX A;  4J8F A;  5DQW A;  4HN9 A;  4AIF A;  4NIK A;  2WXN A;  5ENP D;  2XQ7 A;  2BVL A;  2ETB A;  4G11 A;  4MLP A;  2ETA A;  4DX5 D;  3FBL A;  4ZS2 A;  4XEI G;  4GTR A;  3MAC A;  4HFE A;  5LHI B;  2XEN A;  3WAK A;  4YND A;  5BPP A;  4L23 A;  4JHR A;  4WYV A;  1H2U A;  4KVO A;  3K3O A;  5FVL A;  2BKN A;  4YT0 A;  3RIF A;  4UWL A;  3ZHE A;  3PNT B;  1UN9 A;  3O48 A;  2J4G A;  3PRZ A;  4QH5 A;  4ATZ D;  1TNB A;  2CPT A;  2DLR A;  3EIJ A;  3FHN A;  3CVW A;  4DND A;  3RH3 A;  3RI5 A;  4PFP A;  4BT9 A;  4TV3 A;  2WXI A;  2CG3 A;  4QX8 B;  4HOU A;  4KBM B;  4FJY A;  4LML A;  1D9S A;  3AE3 A;  3P4Q A;  2Q9Q C;  5CB4 E;  3ASD A;  3O4X E;  3HRA A;  2AXV A;  4E7S A;  3JCF A;  4O1P A;  5HXR A;  3QKY A;  3CVQ A;  4HKA A;  2X51 A;  1KNR A;  3UM3 A;  3UU8 A;  4F6R C;  2G0U A;  2XPY A;  2V8S E;  2WB2 A;  3UM0 A;  1D8E A;  4MAL A;  3OXF A;  3MV3 B;  4CQI A;  3AEF A;  3HXE A;  1N0R A;  3RIB A;  5JDM A;  1SW6 A;  4QH4 A;  1ELW A;  2I1J A;  4HI8 A;  2X6H A;  2P58 C;  4B8A A;  5AEN A;  4G26 A;  3D9L A;  3KFW X;  5HXS A;  2C5J A;  3B7S A;  4FLB A;  4B3R T;  5JH7 E;  1FVF A;  1RZ4 A;  2QYU A;  4A56 A;  3RQW A;  5LP0 A;  2XHE B;  5H6Q B;  4DI4 A;  3SFD A;  4KHP T;  3VKH A;  3JQ0 A;  4E7Z A;  4UEM A;  4IYP A;  3ULY A;  2NW7 A;  5DBK A;  3U4T A;  3PZD A;  2WMO A;  4U0U A;  1NEN A;  3C4X A;  2PFV A;  4Q25 A;  2EIJ E;  2YQ8 A;  3HVE B;  5ABF B;  4WWN A;  2X9W A;  4AQY T;  1Z8U A;  4M3O A;  3T1Y T;  2QFC A;  4PJM A;  4HWI B;  3RO3 A;  4Q94 A;  4WND A;  3AS8 A;  3V2X A;  3ZFW A;  3FXE B;  3TG5 A;  3IHY A;  3AAE B;  5EYL A;  2XSA A;  4UWG A;  5D0Q D;  2EHO C;  1I6Z A;  2A72 A;  3AEA A;  2WXJ A;  3AS4 A;  5FT9 A;  2NXP A;  5KJM A;  2PQR A;  3FUI A;  2I6H A;  3R9A B;  2QYJ A;  2PM7 A;  4AEZ C;  4I1M A;  2M67 A;  3UU3 A;  4LFC T;  2LT3 A;  4C9B B;  4GML A;  1UJK A;  4ILA A;  3TLT A;  4HRM B;  4CYM D;  3ASF A;  3URZ A;  2Z6E A;  1H19 A;  3ONL A;  2P2C P;  4GZ3 A;  3ABL E;  2OV9 A;  3FU0 A;  3QC1 A;  3U64 A;  5LMU T;  2UXN B;  2KZT A;  5IY5 E;  4TXR A;  5AQU B;  4ZZB A;  1E1H B;  3A7M A;  3IA3 A;  2BG9 A;  3JXJ A;  1JWG A;  2L6J A;  3H37 A;  2J62 A;  3L13 A;  3L8R A;  5ARF A;  2Q9Q D;  4P0A A;  4GA1 A;  3ZW3 A;  3LY8 A;  3L08 A;  1D1A A;  4NIQ A;  2CXF A;  3X1D A;  3BQL A;  4U63 A;  2BZB A;  4JI4 T;  5CEA A;  3UQ7 A;  3CLJ A;  2UXB T;  5AQR B;  3EAB A;  5HEG A;  4AQF C;  2OA5 A;  4IGU A;  5JJT A;  4OFZ A;  2M6I A;  3Q73 A;  1IJ5 A;  3SBT B;  3ESK A;  3BQI A;  1OXJ A;  3AA7 B;  4H63 V;  2XAH B;  4RG9 A;  4HFV A;  3N9O A;  4J8S A;  1WDY A;  4LNG A;  4YDE A;  3JCK C;  4MS6 A;  5FKY A;  3RO2 A;  4AP2 A;  3DPY A;  3KIN B;  5CER B;  2XZE A;  3U66 A;  1WCR A;  3C98 B;  1FVH A;  1HU3 A;  3MK7 C;  4JC8 A;  3RC8 A;  4C48 B;  3CVR A;  3QC9 A;  3NQP A;  4YDY A;  4UVC B;  2XEV A;  4HFI A;  3RIU A;  3TWX A;  1J5W A;  2LSJ A;  2VTB A;  3ZU7 B;  3ZN1 B;  3O1J A;  4BA9 A;  4DBR A;  3D9J A;  4UI9 J;  1HCI A;  1SUM B;  5F5W A;  3G2T A;  3ZMU B;  5AQG B;  5LHG B;  2EIK E;  2YN6 A;  2YU2 A;  4G2A A;  3PZ3 A;  2WM9 A;  4CN4 A;  4EEC A;  2P9I G;  3CK6 A;  3VRA A;  3LBX A;  4J8D A;  4ZI7 E;  4E85 A;  1MND A;  4DV2 T;  1YW0 A;  3LYA A;  5FL0 A;  2KLQ A;  5JR9 C;  1OCO E;  3ML8 A;  1MX6 A;  4I2W A;  3DRA A;  3VU7 H;  5EX0 A;  3FH5 A;  5JHB A;  3C64 A;  1IZN B;  3AEG A;  3RKV A;  4H9Q C;  1OED B;  4HFD A;  5AFU L;  4JI7 T;  1BR0 A;  5CEC B;  2DNX A;  2NWB A;  2N2N A;  4DR2 T;  4C91 A;  1SZA A;  3MKQ A;  2LUH A;  3VR9 A;  3SS1 A;  2WXP A;  3A5X A;  3ZXP A;  1FT1 A;  2EHO D;  5F8P A;  4L0R A;  2GGF A;  2VL8 A;  1JCQ A;  1A5E A;  1EZ3 A;  2WS3 A;  3FU3 A;  2LM2 A;  3J5P A;  4MKT A;  5HCJ A;  4A1G A;  5G05 C;  5LOZ A;  3DSX A;  2YDS A;  3N9L A;  2NW9 A;  3SY2 A;  2CXD A;  4DPR A;  3IXE A;  3P8C D;  3FUM A;  4GMJ A;  2IW5 B;  2W4X A;  2A9U A;  3PJA A;  3QUJ A;  5FQ7 A;  4QHO A;  3OYZ A;  3ZJ1 A;  4UF0 B;  4QQI A;  1HS7 A;  5AQV B;  5L3G B;  5BUZ A;  4JI1 T;  5JDG A;  4NQ0 A;  2V7I A;  2HHH T;  2LE8 A;  3FUJ A;  3EAM A;  5G04 J;  5C3J A;  3IF8 B;  3TKL B;  3CVV A;  3UU4 A;  4CCA A;  4I17 A;  3OAW A;  3P1U A;  4DK5 A;  2B1E A;  4LCT A;  2XAG B;  3WXX A;  3RKG A;  4OYJ A;  5LA6 E;  1A17 A;  3NVO A;  4OYS A;  1T98 A;  2BUG A;  2V7K A;  2W2U A;  1EYH A;  3OTO T;  3ZRH A;  3V79 K;  5CFB A;  2FBW A;  1N95 A;  1KZP A;  4C0M A;  1Z6T A;  2HN2 A;  4FA6 A;  4X20 E;  4RVB A;  3PUS A;  3TWS A;  1MIW A;  4KT6 B;  1LKX A;  1H2V C;  2WY2 A;  2R03 A;  3LS8 A;  2RPA A;  2AXU A;  4JI8 T;  4A63 B;  3QNU A;  4KHZ F;  2ZM0 A;  3SWH A;  3UM1 A;  1SVX A;  2OOE A;  2H7V C;  2WZI A;  1MIY A;  5CBO A;  4I2Z A;  3S7B A;  4TX5 A;  4I4T E;  4EQF A;  5BXO A;  3T8O A;  2F4V T;  2NOX A;  4AKI A;  1YCS B;  5FTP A;  4FAD A;  3L9T A;  1O1R A;  3BQK A;  4EYY R;  5HXE A;  3QB5 K;  4IDP A;  4IDZ A;  1MHQ A;  3BEE A;  3FUD A;  5JJ6 A;  2JQQ A;  4OX9 T;  1LTX A;  3M65 A;  2GRQ B;  4UI9 K;  3QWV A;  4HWD A;  2MOZ A;  4PJN A;  2YNQ A;  4DID B;  4OVU A;  3VTY A;  3Q9N C;  2E9X A;  3AE6 A;  3NZP A;  3UUB A;  4U0Z A;  2K9A A;  3FEY A; 
#chains in the Genus database with same CATH homology
 2FO7 A;  3S7F A;  5JDH A;  2V0P A;  3RU0 A;  1JWF A;  4JZY A;  2Y8D A;  5KX5 E;  3QDN A;  2W00 A;  3QNK A;  3MZL B;  2LEH A;  2X3M A;  1D0Z A;  3ONX A;  3B7U X;  4IN3 B;  4G25 A;  1HE8 A;  2YIN A;  1OWA A;  2MBG A;  5CMY A;  3D9I A;  5HWY A;  2Q9Q A;  4KMO A;  3FB2 A;  4GPK A;  5BV1 A;  3JQ1 A;  5EK2 A;  3F2E A;  3PEU B;  5JDN A;  2R17 C;  4LER A;  4CZZ B;  4DI3 A;  3LDZ A;  4OHF A;  1Z3Y A;  5BW8 C;  1HG2 A;  2MTQ A;  3CHM A;  3TXM A;  3ENE A;  1V9D A;  3I3N A;  2XQY A;  5LCY A;  3VTX A;  2IF4 A;  4AV7 A;  1QZ2 A;  4GA2 A;  5L2L A;  4O6F A;  4AKR B;  3CVY A;  3ZCJ A;  5JDF A;  5DQV A;  4GB9 A;  3RRN B;  4WWO A;  2KAT A;  5DIZ A;  3PVL A;  3RK6 A;  3D3M A;  5T3R A;  2VWA A;  3HKC E;  3FFL A;  2WXR A;  2ZM8 A;  2PZI A;  2WWU A;  4KP3 C;  3CKD A;  3IBE A;  3CVP A;  2BDE A;  4QXH B;  3NZS A;  2VJ8 A;  4XZ4 A;  2X67 A;  3DBS A;  1MNE A;  3C4Z A;  2HR2 A;  4ADZ A;  4ERR A;  2VYI A;  2VAS A;  2WXK A;  2XUE A;  2VKJ A;  4EPZ A;  4CI2 B;  4OVV A;  2EHO B;  4QWN B;  3AU5 A;  4MBQ A;  4I55 E;  3GMI A;  2WQ7 A;  5JR9 A;  4UQY A;  3HIZ A;  3UUM A;  3R7R A;  2J4B A;  4I1A A;  3U78 A;  4K0R A;  3KV6 A;  3SFZ A;  3RYH E;  1WYB A;  3HVE A;  3UT4 A;  3ETU A;  2ZM2 A;  4AY5 A;  4N3A A;  1OXZ A;  4TN7 B;  5ADX L;  3JC6 D;  2DBA A;  2JMK A;  2PJQ A;  2E0I A;  1E90 A;  5JJ7 A;  2IC6 A;  3APF A;  2FBN A;  1WR6 A;  2ILR A;  4MHC A;  3LJ3 A;  4K0U A;  5CCM A;  3AVR A;  2HH7 A;  4H9R C;  5J90 A;  2P9B A;  4I6E A;  1H2T C;  2HO1 A;  1NA0 A;  2LSI A;  5DJQ C;  4CRW A;  5ARG A;  3TL5 A;  4N5C A;  1KT1 A;  4XAX B;  4CXY A;  3HDX A;  2L0I A;  1G73 A;  5LXT E;  5FMN A;  3ZYK A;  4JLE A;  3CHS A;  3Q5M A;  3FH8 A;  4AM9 A;  1HX8 A;  3MCX A;  3CHQ A;  4ZI2 D;  4N2Q A;  3FP3 A;  2Q9Q B;  5BMV E;  2NTY A;  5FNV E;  2X9Y A;  2JLB A;  3CX6 B;  4ATG A;  4EAH A;  3ZPJ A;  4EOZ B;  3FU6 A;  2OV8 A;  4ME2 A;  3JUI A;  2AW6 A;  5KMG P;  3EVY A;  1KNZ A;  3CQX C;  5HAX A;  2E9X D;  3FXD B;  3OTN A;  4U72 A;  4AVX A;  5A23 A;  1OWN A;  2VSN A;  2GW1 A;  2C0S A;  2E8I A;  2LSV A;  4EB6 E;  3CR3 A;  1IYG A;  2I9C A;  4ZI2 C;  3VLF A;  3N71 A;  1H7C A;  3K3Q C;  5FXX A;  4JA9 A;  3KVB A;  3HKD E;  4EIW A;  2WQ6 A;  2J08 A;  2YHC A;  2KZ7 B;  2XCB A;  2E9X C;  3O9X A;  4PK4 A;  4CDR A;  4TV8 E;  3LVQ E;  5LX8 A;  1UCU A;  2DWK A;  3CVU A;  4B0Z A;  4X1Y E;  5CHE E;  1VDY A;  4E6H A;  4KYO B;  5LGT B;  2XQ0 A;  1CUN A;  5JR9 B;  1BR2 A;  3CQC B;  1AJ3 A;  2CE7 A;  2D0U A;  3K8P C;  4O8S A;  3UT5 E;  3FTZ A;  3QJZ A;  3JC6 C;  4CXX A;  5L3E B;  4XKC A;  3TGO A;  3ONK A;  2FI7 A;  1QUU A;  4GCN A;  3C4W A;  3CML A;  2C5I T;  3LK4 2;  2VGX B;  4O4J E;  5A7D B;  3TJP A;  4PW8 A;  3NZQ A;  2XAF B;  1ELR A;  4JA7 A;  4QXC B;  1XNF A;  3CX7 B;  3ML9 A;  4I6J A;  4CDM A;  3RX6 A;  5JRC A;  5EK3 A;  2D5U A;  4HOS A;  2AVP A;  2IFU A;  3RRM B;  1UX5 A;  3UT7 A;  3EDV A;  5CA0 E;  3LVR E;  5LGN B;  1OWO A;  2OVF A;  2NP9 A;  4ABN A;  3AVS A;  3PE0 A;  4BT8 A;  4HOR A;  5J2T E;  4EZL A;  3MA9 A;  4WNK A;  5LBM A;  5JQG E;  2J9Q A;  1FIO A;  2PG8 A;  4EBA G;  4ASK A;  2KM4 A;  2XGM A;  3E08 A;  4JEH A;  3PE3 A;  2KC7 A;  5FY7 A;  2C2L A;  2LAH A;  5E75 A;  3WI3 A;  1B7T A;  1DNP A;  3LY9 A;  3RYF E;  4FJZ A;  2KND A;  3Q9D A;  4QFV A;  2Y6X A;  4ILG A;  3QK0 A;  4CGW A;  2KCV A;  3CVX A;  2IQC A;  4YFS A;  3D9P A;  3PH0 C;  3PUQ A;  2J07 A;  3N9M A;  3S2A A;  2W61 A;  3K3N A;  1W3B A;  5AYW D;  5KJN A;  2WXQ A;  2Y48 B;  5L3B B;  4ZHQ E;  3N2O A;  4JEU A;  2PQN A;  4N3B A;  2LHN A;  2Y4U A;  2N1G A;  4YHJ A;  3C98 A;  5FQ8 A;  2GK9 A;  4UQX A;  4I6G A;  4XKB A;  2J09 A;  5C1D A;  3RKO A;  4PS8 A;  5GON E;  2XAS B;  4I9C A;  4A55 A;  3BG0 B;  2J4D A;  1LVK A;  3ASH A;  4ZI3 C;  3FTU A;  4TUU A;  2AXZ A;  2XAQ B;  3UUL A;  1OWP A;  4BTB A;  2SPC A;  4QXB B;  2RG8 A;  2WAU A;  4AQF A;  3G2U A;  2CHW A;  3ANW B;  2UY1 B;  1X5B A;  3ZCI A;  4DVD A;  4MRU A;  4APF A;  4UV9 B;  4PFO A;  3ZMS B;  3F31 A;  5AIJ A;  2Y3A A;  4AJW A;  2RA1 A;  4U04 A;  4OK0 A;  1X79 A;  4N78 D;  3FBZ A;  3KDS E;  4NUV A;  3MV2 B;  2XGS A;  2WMN A;  1Y64 B;  4XIF A;  2LJL A;  5HXH A;  1INZ A;  1ZHC A;  3CHR A;  2D2S A;  3AA0 B;  5HI7 A;  4PH4 B;  2CWO A;  4AXP A;  2Q7F A;  2IAK A;  2EHO A;  1UX4 A;  1WY6 A;  4JVS A;  4UV8 B;  4HGA A;  2JEK A;  2XGO A;  3LXU X;  2X6I A;  4H9P C;  3IHR A;  3D9O A;  3UQ3 A;  5LFA A;  2CWY A;  3E4B A;  4W9R A;  4U74 A;  1HG5 A;  2WXF A;  4GZC A;  3DJB A;  1MMA A;  5BV0 A;  2LNI A;  4O4H E;  3B7R L;  1HXI A;  5J1G A;  3ZIM A;  1HZ4 A;  2LO6 A;  5KJK A;  3Q2M A;  5ETW A;  4I43 B;  3VLE A;  4A1S A;  3ZXS A;  5JVD E;  2LSY A;  3ZYL A;  4GAA A;  2UWJ G;  4CI1 B;  5ANR A;  2A5U A;  3OXL A;  3BK9 A;  4AOF A;  3HR0 A;  1EF1 C;  3GZ1 A;  4EZK A;  4WBO A;  3ZN0 B;  2C0L A;  3ULQ A;  4HOT A;  3FTW A;  4XE0 A;  3N9Q A;  4HS2 A;  4JEU B;  2L8K A;  4Q96 A;  2WPV A;  2IC9 A;  2XAJ B;  2C5K T;  4UWF A;  4GOU A;  3KV4 A;  4PK5 A;  2MOW A;  4L5G A;  2FF4 A;  4ZOL E;  3HKE E;  1G8X A;  3ZVV A;  4AKH A;  2EQX A;  4G63 A;  2BF0 X;  2CMR A;  3LEW A;  4CT0 A;  5EDS A;  3LKU A;  4BTA A;  4CI3 B;  3G2S A;  5L3D B;  4Y6C A;  4B8C B;  2VSX E;  3UPV A;  2OND A;  2ODU A;  3UUX A;  3PRE A;  4DLQ A;  5FZR A;  2CG2 A;  4U8H A;  3FUE A;  2V5F A;  4GYO A;  2V4L A;  5LBQ B;  1BR1 A;  2HPL A;  2MYS A;  2CFU A;  4FUL A;  2W0G A;  4KMC A;  4WAF A;  2C0M A;  4GA0 A;  3PDN A;  4LRZ A;  1IHG A;  4C90 A;  3DTO A;  4XBF B;  2J1D G;  3I1A A;  4QX7 B;  3NF1 A;  4FP7 A;  2JMH A;  3ZC0 A;  2WQH A;  4R7L A;  3C51 A;  1JPL A;  2LM9 A;  2N9D A;  4JHK A;  5FXV A;  4BWR A;  3CV0 A;  4ZS3 A;  1D1C A;  1VOM A;  3OBV E;  3LG7 A;  2WVI A;  2K48 A;  3N2K E;  4U0S A;  3D0T A;  1E8X A;  4UVA B;  4LUN U;  3FUF A;  5LP6 E;  1FMW A;  3U3I A;  4P0B A;  2HPJ A;  3APC A;  4EXT A;  5L3F B;  2VQ2 A;  3RC3 A;  3CPZ A;  2IOL A;  2XCC A;  2YK0 A;  2VKH A;  4TRQ A;  5AJL A;  3KS2 A;  3RRW A;  1UG3 A;  1QSD A;  1YKE B;  3EHN A;  3S7D A;  3KEZ A;  3ZN3 A;  2LHR A;  5G05 J;  3P7I A;  4Z8X A;  2LOS A;  4B6X A;  3PUG A;  2LSK A;  1U3C A;  2VTB B;  3V5S A;  4YJ3 E;  2D0T A;  3ZEF A;  4CT4 A;  5JHA A;  5LGU B;  2NW8 A;  4IE4 A;  4ILH B;  4IST A;  2GRL A;  1HH8 A;  4O4I E;  1E8Z A;  2NTX A;  3SF4 A;  4JUY A;  2CEA A;  1E7U A;  4F7A A;  4UI9 C;  2PM6 A;  3IKO B;  3SRZ A;  3VKG A;  3KVA A;  4V3I A;  4RSY A;  1N52 A;  5G55 A;  3SD5 A;  3MKQ B;  3I0O A;  3Q4A B;  4GYW A;  2XTL A;  5EK4 A;  3SOL A;  4XX5 A;  4B89 A;  4TZ4 C;  4IIJ E;  3E22 E;  4GZ6 A;  3L09 A;  3ESL A;  5KDM C;  2HM8 A;  4UWK A;  2ZU6 B;  2CM0 A;  1MMD A;  3B7T A;  2QA7 A;  5IYZ E;  4TV9 E;  3AB3 B;  5D0O D;  4JEH B;  2X6F A;  1LVF A;  1P5Q A;  1SA0 E;  5LHH B;  4HOQ A;  2BTD A;  4EBA A;  3IBP A;  1O3X A;  4F53 A;  5FQ6 A;  3CVL A;  4UWH A;  4WW0 A;  4NRH B;  3UFE A;  2NSZ A;  4ANV A;  3L17 A;  4P29 A;  2IJG X;  3E0Z A;  4UVB B;  4WNF A;  3UT8 A;  2RP4 A;  1NZN A;  3ZYQ A;  4DBQ A;  4DMV A;  4DLO A;  2NC9 A;  3FUL A;  4HFG A;  3CVN A;  3FUH A;  4YJ2 E;  3MKR A;  1PAQ A;  5BT1 A;  5ENN A;  2I59 A;  4L2L A;  4HE8 A;  4D10 C;  1D0X A;  4U07 A;  2J49 A;  5T4Y A;  3HYM B;  3G2W A;  2YEV C;  3I0Q A;  3QB2 A;  4ILI A;  5ANL A;  1QNF A;  3NZU A;  3ZC1 A;  5LNK A;  4HVB A;  1IAP A;  1ZEE A;  1MMG A;  3I4G A;  4UIG A;  5E0O A;  3ZMV B;  2CCQ A;  4HXI A;  3RJV A;  1N54 A;  2ZMA A;  4GYY A;  2BVM A;  2CA5 A;  4CXW A;  5H6R B;  3LCA A;  4WBN E;  3P2B A;  3V5U A;  5E76 A;  1E7V A;  2K5B B;  1WAO 1;  5C8Y E;  3GZ2 A;  4GIW A;  4ACL A;  4PAG A;  3FUK A;  4WNE A;  4O2B E;  4KZ0 A;  3D9M A;  4EZH A;  4XI0 A;  2H3R A;  3ASG A;  4UF0 A;  3AS5 A;  3MEK A;  2VGY A;  3FU5 A;  1Y6I A;  4J2C A;  4FLH A;  2CHZ A;  4CGV A;  4QKN A;  3PUJ A;  3ZEF B;  3PE4 A;  4GU5 A;  4PDX A;  2XPZ A;  4J8E A;  3Q5W A;  3FH7 A;  4URK A;  3J7Y q;  5LCW J;  4KUM B;  3CQG B;  2AWI A;  3DPD A;  2WXO A;  3EJN A;  3QK6 A;  1ELK A;  1EDU A;  5M4Y A;  4MLK A;  4ISS A;  4HLE A;  4L2Y A;  3UTK A;  4I1O B;  3MKD A;  5CCL A;  2DWG A;  4ZI3 D;  4XZC A;  4IHJ E;  2VSY A;  2CLY B;  2X38 A;  4HTE A;  4NUU A;  5FXW A;  3CKC A;  2VKO A;  3T8M A;  4YVQ C;  2Y4T A;  3WAJ A;  4ANW A;  2DI4 A;  3GA8 A;  3N9P A;  3UMV A;  1ZU2 A;  5LCW C;  3FHE A;  3O1I A;  3IV0 A;  4L1B A;  3GN5 B;  5G04 C;  5LYJ E;  4IUL A;  2KT9 A;  2V7M A;  2X68 A;  2JPF A;  1IQU A;  2ODV A;  2DIW A;  3IEE A;  3FTV A;  4YVO A;  1E8Y A;  3FUN A;  2WXL A;  4FU3 A;  2VB6 A;  1WRD A;  4PUC A;  4UQZ A;  4F1S A;  3ZMZ B;  1S0P A;  3SBS A;  4N3C A;  3GYZ A;  3T5X A;  2GRM A;  3CST A;  3SGH A;  2PBI A;  3OKQ A;  2JJ9 A;  2XRZ A;  4P09 A;  5G2N A;  2WXG A;  4OYK A;  5LOV E;  3U9W A;  3NRX A;  2ES0 A;  2L3L A;  3FWV A;  3B57 A;  2W62 A;  3MXZ A;  5L3C B;  1UN8 A;  4GK5 E;  3HL6 A;  3AAA B;  2JRK A;  2UXX B;  2LSG A;  4GZ5 A;  2L0T B;  4JW1 A;  3AA6 B;  4X1K E;  3CWZ B;  3I5P A;  4ANJ A;  3MJX A;  2KCK A;  3EDU A;  5HXC A;  4FI5 A;  1HF8 A;  3RYI E;  3PS6 A;  4FHJ A;  4H7Y A;  4C0E A;  4KBQ A;  3L22 A;  1MMN A;  4HEA A;  3CK9 A;  5AJD A;  1MQS A;  1XGW A;  5FWQ A;  3FTX A;  3KD7 A;  3FTS A;  2LSU A;  3CIA A;  1B89 A;  3L3P A;  1E8W A;  5C2Y A;  3LFM A;  3W15 B;  5FJY A;  2VSO E;  1KT0 A;  2R5S A;  3O4Z A;  2KWI B;  3Q5X A;  3PU8 A;  3OYX A;  3U3W A;  3TXN A;  2L9B A;  2KZT B;  4IE6 A;  2WSS V;  2A3D A;  3LK3 B;  1IQR A;  3PNL B;  3EUH A;  4I9E A;  3EIQ C;  2IU1 A;  3FDH A;  3I9Y A;  1YD8 G;  4V1A v;  2KIN B;  3CSF A;  4ILU A;  5A1L A;  3ZPO A;  1WYC A;  2A2F X;  4M1P A;  5KJL A;  3RYC E;  4AQG A;  4AXH A;  4H9S E;  3QWP A;  5CMW A;  3QOU A;  1OWL A;  5JRE A;  4K03 A;  3CK7 A;  1ZBP A;  4JL0 A;  2K24 A;  1HO8 A;  2L9Q A;  5FYM A;  4AI6 A;  1NA3 A;  3L6A A;  3QAR A;  5FY1 A;  3QWW A;  3LPZ A;  2CFZ A;  4ANU A;  4B94 A;  1YA0 A;  3R6N A;  3FY4 A;  3OXG A;  1LF8 A;  4G24 A;  3Q47 B;  1SZ9 A;  4EZJ A;  3T5V A;  3Q15 A;  3BG1 B;  4IE0 A;  5FXZ A;  4BJM A;  3CGH A;  1EPU A;  3PU3 A;  3ZLI A;  4DJA A;  3DP7 A;  2QY7 A;  3OJA A;  4AKL A;  4J0U A;  3UX4 A;  1S94 A;  4NUR A;  3S4U A;  2M63 A;  2X9H A;  3LBX B;  2XHE A;  4J6I A;  2YU1 A;  2R59 A;  5J08 A;  1FEW A;  5M72 A;  4EZ4 A;  1BR4 A;  5HQ8 A;  1OWM A;  3RPU A;  3HI2 A;  5HYA A;  1YKH B;  3J9X 1;  3D9N A;  3PEV B;  3PUK A;  1WM5 A;  5FZS A;  1U4Q A;  2QGS A;  3D9K A;  3KAE A;  3N9N A;  2KMF A;  1NAF A;  4TUY E;  4UEL A;  2W63 A;  4EYU A;  3CHP A;  5FQ4 A;  3VHL A;  1HFA A;  4I50 E;  2LAI A;  4AY6 A;  2PL2 A;  2DHR A;  4GK0 E;  2OVB A;  3UUX B;  3FEX A;  2I2O A;  2E2E A;  3TAX A;  2XRY A;  1PY1 A;  4H9N C;  4H9O C;  3MZK B;  4FC8 A;  1JUQ A;  1WLX A;  2DCF A;  2WBL A;  2IOS A;  1QQE A;  1UJJ A;  3G2V A;  4IE7 A;  1BPO A;  3LJC A;  5F3J A;  5BNW A;  3I9W A;  3EHM A;  3SHF A;  1Z0P A;  3ZGQ A;  1HS6 A;  1Y8M A;  4BX9 A;  3MX3 A;  4G23 A;  5LG4 A;  3LK2 B;  4G1T A;  3N2G E;  2CXL A;  4A3V A;  1NWM X;  3KV5 A;  2MRI A;  4L9I A;  2E9X B;  4PJJ A;  1HTJ F;  2DCP A;  3CK8 A;  4G2V A;  4FHK A;  2VK9 A;  3CX8 B;  2VKD A;  4GYS A;  3UUN A;  3SZ7 A;  4APO A;  5LJN A;  5FZQ A;  4WWP A;  3MGB A;  5EZY E;  3O1H A;  2V26 A;  4Y6W A;  3HKB E;  5JDQ A;  2X0L B;  4JPS A;  3H3A A;  3GW4 A;  3S7J A;  2H7O A;  4PS7 A;  4A3T A;  1TJC A;  3AU4 A;  4H63 H;  4O4L E;  5EX3 A;  3PUA A;  2WXM A;  3AAI A;  2V7J A;  3PTR B;  1NP7 A;  3L16 A;  1D1B A;  1VRB A;  3TG4 A;  1SHZ C;  3MA5 A;  2X66 A;  3HA4 A;  3ZMT B;  4ANX A;  2A4Z A;  4DMW A;  2ZLY A;  4MFR A;  2MHK A;  3APD A;  5A6C A;  3NRY A;  2VGX A;  2CLY C;  2KXP B;  3K9I A;  3ZHE B;  5J2U E;  1E96 B;  2V1D B;  2FUL A;  4KZC A;  1PC2 A;  5JRC B;  2FEZ A;  4IRU A;  3MJW A;  4WUY A;  1U3D A;  1Z3X A;  4RG6 A;  2HYZ A;  4CEM A;  3I4R B;  1LRZ A;  3ZYM A;  3IHV A;  3CKB A;  4GYR A;  4DO0 A;  4BX8 A;  3ANW A;  3SNX A;  2KWH A;  3VLD A;  3CEQ A;  4YLH A;  4WNG A;  2KCL A;  4BFR A;  2YHE A;  3KV9 A;  5DAB A;  4AKG A;  3KBT A;  3PDY A;  3NBX X;  1FMV A;  5T8I A;  4GCO A;  2X6J A;  2V7L A;  3HHM A;  3MYV A;  4BAY B;  4H7X A;  3GN5 A;  5IHY A;  3ZJ2 A;  3IEG A;  4KVM A;  1H6K A;  5CA1 E;  3QAQ A;  1H0A A;  1OUV A;  1SQM A;  4Q69 A;  1US7 B;  3B13 A;  1L5J A;  4ACK A;  1KK7 A;  3ETV A;  4BSX A;  4NAC A;  3L54 A;  4CDN A;  1ZV4 X;  2X9X A;  4XI9 A;  5JDL A;  4PS3 A;  4BJN A;  2XPI A;  2ION A;  3AA1 B;  5EKQ D;  5HWX A;  4KXK B;  4PJL A;  3KBU A;  3Q49 B;  4PNI A;  1DVP A;  5LJM A;  3GWH A;  2X6K A;  4N2S A;  3GZS A;  1S35 A;  3F57 A;  4F3V A;  1D0Y A;  1UW4 B;  1TJF A;  4X1I E;  3PUR A;  4IE5 A;  2I1K A;  4BY6 A;  1MIV A;  2RD0 A;  2LOP A;  3RRC A;  3N5L A;  1IJ6 A;  1U5P A;  1ZKE A;  3LY7 A;  3CHO A;  4PK6 A;  4JXT A;  2UY1 A;  4LEU A;  3R7Q A;  4FJO A;  4UXN B;  4I43 A;  5TAO A;  3RRU A;  3JYS A;  3SI5 A;  3C50 A;  4L7T A;  1TEZ A;  5FY0 A;  4JHJ A;  2CHX A;  3R84 B;  3FTY A;  4N39 A;  2ACX A;  1GW6 A;  5FP3 A;  5KCM A;  4O2A E;  1FCH A;  4GZD A;  2WXH A;  3EDT B;  1KLX A;  4J8F A;  5DQW A;  4HN9 A;  4AIF A;  2WXN A;  2BVL A;  4G11 A;  4MLP A;  3FBL A;  4ZS2 A;  3MAC A;  5LHI B;  3WAK A;  4YND A;  5BPP A;  4L23 A;  4JHR A;  1H2U A;  4KVO A;  3K3O A;  4UWL A;  3ZHE A;  3PNT B;  1UN9 A;  3O48 A;  3PRZ A;  2DLR A;  3EIJ A;  3FHN A;  3CVW A;  4DND A;  3RH3 A;  4PFP A;  4BT9 A;  4TV3 A;  2WXI A;  2CG3 A;  4QX8 B;  4HOU A;  4KBM B;  4FJY A;  2Q9Q C;  5CB4 E;  3ASD A;  3O4X E;  2AXV A;  4E7S A;  5HXR A;  3QKY A;  3CVQ A;  4HKA A;  2X51 A;  4F6R C;  2G0U A;  2XPY A;  2V8S E;  2WB2 A;  4MAL A;  3OXF A;  3MV3 B;  4CQI A;  3RIB A;  5JDM A;  2I1J A;  1ELW A;  2X6H A;  2P58 C;  4B8A A;  5AEN A;  4G26 A;  3D9L A;  3KFW X;  5HXS A;  2C5J A;  3B7S A;  4FLB A;  5JH7 E;  1FVF A;  4A56 A;  5LP0 A;  2XHE B;  5H6Q B;  4DI4 A;  3VKH A;  3JQ0 A;  4E7Z A;  4UEM A;  4IYP A;  2NW7 A;  5DBK A;  3U4T A;  3PZD A;  2WMO A;  4U0U A;  3C4X A;  3HVE B;  2PFV A;  2YQ8 A;  4WWN A;  2X9W A;  4M3O A;  2QFC A;  4PJM A;  3RO3 A;  4Q94 A;  4WND A;  3AS8 A;  3ZFW A;  3FXE B;  3TG5 A;  3IHY A;  3AAE B;  4UWG A;  5D0Q D;  2EHO C;  2A72 A;  2WXJ A;  3AS4 A;  5FT9 A;  2NXP A;  5KJM A;  2PQR A;  3FUI A;  2I6H A;  3R9A B;  2PM7 A;  4AEZ C;  4I1M A;  2M67 A;  2LT3 A;  4C9B B;  4GML A;  1UJK A;  3ASF A;  3URZ A;  2Z6E A;  1H19 A;  3ONL A;  4GZ3 A;  3QC1 A;  3U64 A;  3FU0 A;  2UXN B;  2KZT A;  1E1H B;  1JWG A;  2L6J A;  3H37 A;  5ARF A;  3L13 A;  2Q9Q D;  4P0A A;  4GA1 A;  3ZW3 A;  3LY8 A;  3L08 A;  1D1A A;  2CXF A;  3BQL A;  4U63 A;  2BZB A;  3CLJ A;  4AQF C;  2OA5 A;  4IGU A;  5JJT A;  4OFZ A;  1IJ5 A;  3SBT B;  3ESK A;  3BQI A;  3AA7 B;  4H63 V;  2XAH B;  4RG9 A;  4HFV A;  3N9O A;  4J8S A;  3JCK C;  4MS6 A;  3RO2 A;  4AP2 A;  3KIN B;  3U66 A;  3C98 B;  1FVH A;  1HU3 A;  3MK7 C;  4JC8 A;  3RC8 A;  3CVR A;  3QC9 A;  3NQP A;  4UVC B;  2XEV A;  2LSJ A;  2VTB A;  3ZN1 B;  3O1J A;  4BA9 A;  4DBR A;  3D9J A;  4UI9 J;  1HCI A;  3G2T A;  3ZMU B;  5LHG B;  4G2A A;  2YU2 A;  2WM9 A;  4EEC A;  3LBX A;  4J8D A;  4ZI7 E;  4E85 A;  1MND A;  1YW0 A;  3LYA A;  5JR9 C;  2KLQ A;  3ML8 A;  4I2W A;  3VU7 H;  5EX0 A;  3FH5 A;  5JHB A;  3C64 A;  1IZN B;  3RKV A;  4H9Q C;  5AFU L;  1BR0 A;  2DNX A;  2NWB A;  2N2N A;  1SZA A;  4C91 A;  3MKQ A;  3SS1 A;  2WXP A;  3A5X A;  2EHO D;  5F8P A;  4L0R A;  2GGF A;  2VL8 A;  1EZ3 A;  3FU3 A;  4MKT A;  4A1G A;  5G05 C;  5LOZ A;  2NW9 A;  3N9L A;  2CXD A;  4DPR A;  3P8C D;  3FUM A;  4GMJ A;  2IW5 B;  3QUJ A;  5FQ7 A;  4QHO A;  3OYZ A;  3ZJ1 A;  4UF0 B;  1HS7 A;  5L3G B;  5BUZ A;  5JDG A;  4NQ0 A;  2V7I A;  2LE8 A;  3FUJ A;  5G04 J;  3IF8 B;  3TKL B;  3CVV A;  4CCA A;  4I17 A;  3OAW A;  3P1U A;  4DK5 A;  2B1E A;  4LCT A;  2XAG B;  3WXX A;  4OYJ A;  5LA6 E;  1A17 A;  4OYS A;  1T98 A;  2BUG A;  2V7K A;  1EYH A;  3ZRH A;  4C0M A;  1Z6T A;  4FA6 A;  4X20 E;  4RVB A;  3PUS A;  4KT6 B;  1MIW A;  1LKX A;  1H2V C;  3LS8 A;  2AXU A;  2ZM0 A;  3SWH A;  2OOE A;  2H7V C;  1MIY A;  4I2Z A;  3S7B A;  4TX5 A;  4I4T E;  4EQF A;  3T8O A;  2NOX A;  4AKI A;  5FTP A;  4FAD A;  3BQK A;  4EYY R;  5HXE A;  4IDZ A;  1MHQ A;  3BEE A;  3FUD A;  5JJ6 A;  2JQQ A;  3M65 A;  4UI9 K;  3QWV A;  2MOZ A;  4PJN A;  2YNQ A;  4OVU A;  3VTY A;  2E9X A;  3NZP A;  4U0Z A;  2K9A A;  3FEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...