2WXIA

The crystal structure of the murine class ia pi 3-kinase p110delta in complex with sw30.
Total Genus 276
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
276
sequence length
919
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVDCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title The P110D Structure: Mechanisms for Selectivity and Potency of New Pi(3)K Inhibitors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 276
structure length 815
sequence length 919
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 2wxiA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wxiA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2wxiA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wxiA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 2wxiA04
4G11A 1WFJA 3PS6A 3L4CA 3F00A 4ICWA 2WXRA 3L17A 1BCIA 3FDWA 1UOVA 2CJTA 2FK9A 2WXIA 4EZKA 1QATA 5G2NA 3T8MA 1DQVA 4NS0A 1E7UA 3DBSA 1UGKA 4TV3A 1CJYA 4QAMB 2WXMA 1DSYA 3M7FB 4FULA 5JHBA 3HHMA 1W16A 3NZSA 2D8KA 2X6KA 1TJXA 4WWPA 4LCVA 4LT7A 3ENEA 2CM5A 1DJYA 4ANWA 2V4LA 4BFRA 2X6HA 3QR0A 4FHKA 4A55A 4JPSA 3FBKA 3PRZA 4KZ0A 5T8IA 3F05A 4IQHA 2NCEA 4XZ4A 3RDJA 4PH4B 3PYCA 3RPBA 2DMGA 4FJYA 2CHZA 3R7RA 2I9CA 1YRKA 2WXNA 3IM1A 4IHBA 4QJ5B 3L54A 4TS6A 4ANXA 3KWUA 3N5AA 2WXJA 4L1LA 4NPJA 3JZYA 3P2BA 4HVBA 2X6JA 3QJZA 5CCJA 4FJZA 4KZCA 2BWQA 4XX5A 3NSJA 2WXFA 4BGDA 4UWFA 1DJIA 3SD5A 1A25A 2K4AA 1E8ZA 3ML8A 3B7YA 2ENQA 3ML9A 4WWNA 4TUUA 4OYSA 2Z0UA 4F93B 1DJGA 3HN8A 3ZVVA 2KI6A 3S2AA 2CJSA 3DPDA 5JHAA 5CCHE 3GPEA 2WXGA 3TJPA 4ICXA 5KJ7E 3LJ3A 4L23A 4F1SA 1TJMA 4L2YA 4UWGA 4WEEA 1W15A 2A5UA 4QJ4B 2CHWA 2X6IA 4GB9A 4PS7A 4QJ3B 4J6IA 4NP9A 3NZUA 4Y1TA 5CCGE 2A4ZA 1DJHA 1E7VA 4FLHA 5ANLA 4L1BA 4PS3A 1DJZA 1V27A 4EZJA 2DMHA 1K5WA 4ANUA 2K45A 3L9BA 4LDCA 3IHYA 3L13A 2N1TE 1RSYA 2CM6A 4AOFA 3F04A 3HIZA 3QAQA 4PS8A 4FHJA 3CSTA 4WAFA 2YOAA 3W56A 5H4ZA 2JQZA 2EP6A 2NQ3A 1BYNA 4V11A 2Y3AA 4Y1SA 4OVUA 2X6FA 3KWTA 5EDSA 2CHDA 2K8MA 4AJWA 4F92B 5ENNA 4FA6A 2LHAA 4ANVA 2ZKMX 1E8XA 3QR1A 2WXOA 3TWYA 2QZ5A 3CSFA 3ZIMA 1E8WA 2X38A 3QARA 1UOWA 4KITB 5G55A 2Q0ZX 3TL5A 2WXLA 3ZW3A 3L08A 4UWLA 1GMIA 3PREA 3QK0A 3LS8A 2K3HA 3APCA 2YRBA 2UZPA 2FJUB 4NPKA 3APFA 2Q3XA 3OAWA 1HE8A 3IBEA 4WWOA 2WXKA 4MJJA 2WXHA 3R7QA 1RH8A 4UWHA 2B3RA 1DJXA 2ISDA 2ENPA 1RLWA 2QZQA 4F91B 4HLEA 3F01A 3APDA 4URKA 2NSQA 2R83A 2CHXA 3OHMB 4UWKA 4DK5A 3L16A 4XE0A 2RD0A 4OVVA 2ENJA 1DJWA 3PFQA 2WXQA 4FADA 4DNLA 3W57A 5H4YA 4EZLA 1E90A 1BDYA 2WXPA 4GNKB 1WFMA 1E8YA 3MJWA 1QASA 1CJAA
chains in the Genus database with same CATH superfamily
2BIIA 3VXRD 3N1FC 4ZPVB 1IAOA 1FHGA 2NCMA 2MWCA 1MAJA 2D2OA 2PXYA 3MLWL 4CU6A 5LFAA 2WBXA 2CBTA 3CSGA 2VGXB 1I3UA 2FLRT 2J8SD 5B1KA 2X28A 4KAQH 1SE4A 4JFUA 2YRLA 3MKKA 5DHVH 3WCYA 5J56B 4LDTB 5J90A 1OARH 2NXZB 3K46A 3I84A 4TUJB 2DQTL 1OD9A 4K5AB 2QR0A 5HYJA 3U4EG 1YD8U 1JPLA 3RPBA 1J5CA 1DCQA 3DX9B 3TBTB 3B8YA 2XWTB 2ARJA 3RGBA 4TS6A 2A0LD 2X70A 5C2BL 3EDEA 2VXSL 2NX5D 5DJZB 1V7MH 2OMZB 1IGCL 4X7EC 2EVJA 1C78A 2XTSA 1DVPA 4KMQA 5JO5B 5KYWB 1RULH 3N50A 4GN1A 2K4AA 5I18L 5CJ8A 1DQQB 1A6ZB 2WQSA 3LXCA 2IJ0C 4MGXA 4QHUA 3SDAD 4BH8B 4JY4B 1UJ3A 5E03A 3U9UA 1Z5SC 4LRIA 5FF6A 3F85A 2FJGB 1H9DA 2OFQA 4YUEH 4DSYA 2XV3A 3JWOL 4MD0B 1GZPB 3IDNA 1EZVX 2D73A 4XZUA 5HDOA 4HS8H 2B5IC 3AY4A 1XH1A 4KJQD 3BVXA 1TYGB 1C5CH 4LU5L 3O3DB 1N5AA 2ZJSL 3PWPE 1IJ9A 2XWRA 4DIXA 4F33B 2GBMA 4R4NC 3VWKC 1NMCC 4QJ4B 4IOIE 4N5QA 4E41A 3SQBA 3D09A 4G26A 4G8EB 2ZICA 3ZKXC 3HG0D 1OTSC 2VABB 3BKJL 1DR9A 1T20A 3PVLA 4JPIA 5HDBE 1FNUA 5D1XA 1A7PL 1E5YA 1AQ8A 4MAUL 4YSUA 2DIBA 4K7PH 3ZXSA 2NMSA 5EBMB 4PEEA 2GBAA 1BF5A 3IAM1 3MC0A 4DXFA 5B1AB 1JGVL 3ARWA 4GTOA 5B7EA 4DO6A 4ODVH 1LD9B 4G80A 3F6JA 4ZFFB 3O6KL 4AIFA 5LHDA 4XE5B 1H4RA 3EGRA 2VH2A 2WZ0A 1ZAGA 2H6PB 3BFOA 4ES8A 4UV4H 4PLKD 1KCRH 4BCZA 4LLQA 1CYGA 2D2CC 3HG4A 3CFEB 3OXLA 3NSYA 4BTBA 4W9DA 4WV1C 1JXGA 1CDUA 2YMXH 1P2CA 4YDZA 3LMJL 4IRSB 4QWWD 5E9DA 5D7SH 3MV8B 1SBBA 5IY5E 5CILL 5J08A 1UCBL 3D5OF 3MXWH 4YFDB 3QWOB 2IALB 2GK2A 2GTZB 3IGFA 3WBDA 1RY7B 4PJDB 1WYWB 3N6YA 5EU6E 2MP2A 4HXDA 5D8JL 3S4SB 3QQXA 2AJ3B 5GXGB 4ONGL 3VAWA 4AV4A 2RPVA 3QDMD 1U8NA 3UIPC 3ASOB 1JGDB 1MX2A 1KFGA 2W0LA 4G1MB 1MH5A 4F58H 5BV7B 3AE8B 1F6AB 3VXMA 4GRLD 3ZO9A 1XQ4A 3EU5A 3L16A 4JREB 2ITDB 4IIQC 3S7GA 2NY7H 2QADB 3V60A 5TTRA 4FF9A 5GIRB 1WAPA 4HKZB 3RVUC 3GUTB 1EWCA 3BPOB 2X4PA 4MCYB 1ZHKA 4FYRA 2BVQA 4Z0XB 2NXYB 2EE2A 3LS5L 3GWJA 1FO0A 1QSED 1RU9L 5EX0A 5F93C 3JXIA 3BVWA 4DHJD 1EZLA 2EACA 4B27A 1E6EB 3ZSTA 3GZNB 3NFSH 1GXEA 4DPBX 3TCTA 1TJIH 5DRXA 1TCMA 1F4YH 2ZCKH 5IR1A 2DQEH 2YJQA 5FB8B 3QHTA 2O72A 2IV9A 2GGFA 1VZ7A 3J5QB 1KWKA 5AVVB 1RLBA 3IAQA 2V5RA 1JF6A 1OK8A 1T03H 3S3BB 5JPNC 4ACKA 4OTXH 3PWUB 3Q2CA 2EDKA 1DFBL 1WWCA 4OJFL 2CO1A 2EO7A 2C7UB 1E0ZA 4TQ8A 5EBWB 1LWJA 3VTTA 1WI0A 1ZK9A 1PUTA 5FC9A 4LLMB 5K9QG 2G2PA 2G60H 1Z5LB 1GOGA 4I2XB 2R29H 4O9HL 4D0CA 4IW4C 3W37A 3T8VA 4HJIA 5KVMC 3D4ZA 2W81C 1J12A 3CBKB 3WS6A 5CD5C 5JZ7D 1RZFL 4MGZE 1CF8L 2QEJC 4NQEB 4DN3H 5BMIA 1OAKH 4CCAA 2H47C 1DVTA 2APFA 2H1LM 2MQGA 4E9LA 3CVWA 2BWDA 2QQNH 1A4JA 3W9DA 4KDTA 3ZE1E 1P5UB 2XEEA 1ZV5A 2DIJA 2RFXA 4S0SD 4DKAA 4S17A 2HTKD 4DTGH 4A2DA 4J6IA 4B94A 1BVNT 3RB5A 3ROLA 3BUYB 5CCGE 1ZT7A 1MCJA 1TEZA 4H8WC 2R0LL 4IU3A 4HLJA 1TGZB 5D1QC 3RQ3A 1PGXA 1AZBA 3JQ0A 4BSVA 1D3CA 1T0MA 2Z91A 1SA4A 3HI6H 4JXTA 4HRLA 4GLSC 1ZK5A 4KTEH 1WGDA 3RVXD 3GSQB 1N18A 4PJDF 1X1MA 2BRRL 3KWTA 4LIQE 4YJZL 3KSQA 4YSQA 1OTTD 4PLNC 5JQ6H 2MJWA 2J4WH 4UYPA 3PWPD 3L3IB 2V3SA 2ASQA 4S0RA 4WJNA 3EOYG 1E28B 4L29A 3B95A 1QA9B 5IJBC 5D4JA 4UOQA 3ZKNC 4ABQA 5GRYA 2VH5L 5T1DH 4PVMA 4KUZL 2L8JA 4LBEB 3AE6B 2ZPKL 1PDKB 3ESPA 4M4RA 3QEQB 1OB0A 4YZFF 3APNA 2HVJA 3GT6A 2ZYSA 5DJXB 2OSWA 3RI7C 1WZ1L 2X1XR 4IJ3B 3B2FA 2QQLH 2XV0A 3MX3A 2I5YH 5L6YH 1WS7A 2D3NA 5KSAC 2CKBL 4H20L 4TQ1A 2J57A 2A9CA 3ALBA 1AQDA 1QASA 4UI2A 1XX9C 3WSQL 2C34A 4NGHL 1JNLL 2JB5L 3M63B 3D1MC 4XWWA 4P3CH 5B4MD 1S7UB 3UBXG 5KBNC 2G3QB 1G4RA 3ARPA 3JVFC 4FRWA 3DQVA 4MMYA 3DHUA 2X9YA 4MJ5A 2D8KA 1KB5A 1VESA 5EU6D 3EYUH 3ENEA 1T83A 2J6EH 1PCSA 3MR9A 1O1TA 1BF2A 2H26B 1OT4A 5AW9B 1JZHA 1ZB1A 1R3KB 3B9EA 4PRHA 2MNUA 4DX6D 4XI9A 3B2UC 3P4MB 1A70A 1KZYA 2KJ6A 2G0LA 4UT9L 5B1JC 4UTAL 4A1SA 5GSVA 1FFPB 1OV8A 2YN5A 3ZE2E 2VLKA 5L2JB 5EZJB 1S9WA 7FABH 5IM7B 4E2OA 5ENPD 2MIZA 3GI9H 1BPVA 2Y2YA 2XENA 1BECA 3DGDA 3O4ZA 4QXTB 1R47A 3AACA 4AIXA 5BW7A 2C7FA 4P8QA 1AKJA 2KNBA 4YZWA 4FQIL 1KRHA 4FLBA 3GIZL 2QSDA 1G87A 1KCUH 1FNAA 1GOFA 2DKSA 2JXMA 1JD7A 2P8MB 2V7NA 4P5TC 4P5MA 3TWTA 1WWBX 1IAIL 4XGAB 5JHAA 1FO0H 1JZEA 2AEQL 3CIAA 4NEHB 1ZANL 6TAAA 1C4CA 4RMAA 4PGZA 1I7ZB 5KVEE 3P2DA 3TLRA 1F86A 2ADFL 3BT2H 4W9CC 1KIQB 2VB5A 3IMWA 5CJ5A 1NGXB 4MJIB 4UTBL 3WY4A 3W2DA 3F58L 4HDQA 3GINA 1AR1C 1QX1A 5AZ2H 1SQMA 5E2TL 3R1GH 1XAKA 1BD8A 2E59A 5A2AA 3W11C 4KRNA 3JSVA 1TQUA 4WFGE 2WLLB 4A6YB 1WFUA 3HXBA 3GBEA 4GG8B 4E9WA 4Z7IA 4YHML 3C3OA 4AE1A 4MGKE 3WIMA 3HVNA 2Z7UA 4JDEA 4Y4KA 4XNYL 1KN2L 3CSTA 4FA7B 1WXMA 2DX5B 4WH4A 1TU2B 5H4ZA 1UZXB 2OCFD 1D6EA 2XX0A 4X6DB 4HEA1 4HH9A 3H3BC 5ADPL 1FHNA 4O1OA 1BVZA 1URZA 2BCKB 4LHUD 3FHEA 3HCVA 1U36A 1BVOA 3WNMA 1CLYL 5J1SC 4GIOA 3SBTB 4KROD 1Q10A 1Q9LA 2QT6A 4LDOB 3IJEB 3QUZD 4RETB 3BISA 5GS0H 4KRPB 4Q2ZB 3PEVB 2D9QB 2I60L 3V30A 1CDGA 1EEZB 2GBRA 2W5PA 3FU0A 1JI1A 3RNAC 1WBXB 4LG6A 1Y0LA 4R0LB 1NC4B 3ZDYE 4OIIH 3MV3B 1TNYA 2I1KA 3X23A 5J11B 4I1NB 1E2VA 4Y4FD 5E23A 1JV2B 4QYAA 2XTJE 3GSWB 3FW6A 1SE3A 3B56A 2G9HA 3GF8A 3ISYA 1N5YL 2XQBL 2R51A 4YHPA 1A1OB 4HZAA 4DQOC 3BJLA 4MHHG 4G7YH 2DQUL 3NUKA 1LNUA 4B41A 1H6FA 2R61A 2KXPC 3QUHA 3DBRB 1OP3H 5AUMA 1A6TB 1NDMA 5BRZA 3CD4A 3N71A 2CNZA 4XO3A 1U8LA 3L8QA 4OD3H 3S3DB 1QFWH 5IMMB 2PYEA 2A73A 2FSEA 1JRUA 4I0CC 4US8A 5IK3A 4G9DA 1Y1DA 1KN4L 4YH6A 2ROYA 3CVBA 1MCIA 3AXLA 3WO4B 3HRDD 2VLLA 4JZYA 4HCPB 1ZE3C 5JQIB 4FXCA 5DFAA 1ZV2A 1GGBH 1L7IH 4F3FB 5MEQB 4NSKB 3PG2A 5M94B 4Z68A 4CDNA 3ABGA 4GMLA 3O0RH 1XGQA 4AYGA 4I0PA 3EYSL 4EQFA 5DA4A 4DQAA 2N9XA 2MYOA 2FT7A 5KBPA 5D4IA 4BFJA 1TQVA 4PCSA 5DEZA 1AQKH 1WQVT 4LSQH 5I6MA 2ZKWA 1G7JB 1S8DB 1G5AA 4P2AA 4WUKL 4B50A 2R1WB 3VFMB 1LE5B 1L3WA 1AMYA 4EUPA 2WGNB 1TJEA 4NPYB 3HVEA 3GSVB 3RIBA 4P5KA 1KB5H 1PYWB 2DEYX 3PWVA 4X6DF 5PCYA 1HG2A 4JDTH 3V6BR 1OUVA 1QFUL 2KH2B 1SF3A 4QCIA 3GLEA 4X8GA 1M6OA 4FLHA 1K51A 3HS0A 1U42A 3MKRA 1MCKA 2IDYA 3APMA 3TX4A 3NG0A 1HYSD 4XN7A 5IUCA 3MRPB 3V4PL 4KKLD 2DIAA 3H54A 4BV1A 4J3OF 3U1QA 4TLSA 3B9KA 5B7MA 1R4MB 5F3HB 1L9RA 2EUZA 3VHTC 2NY0D 4EKUA 1FZJA 2PPAA 3JXJA 1CFBA 3VX0A 2JWYA 2Y5TA 4ZFQA 1P7EA 1AGDA 1A6AA 1JXKA 1KUMA 1T5XB 4H7VA 3RGVA 2LGSA 4EVNB 3PGDB 1ZWIA 3ILDA 4OW0A 2EIJE 4NYLB 2QGCA 1CN4A 2ZP0T 4YDIH 3WNPA 4DAGL 1CXLA 1B2WH 2QBWA 3CLJA 1EHLL 1GOZA 3ECVA 4PRNA 4ZW8A 1PLGL 4ODSH 4FI7A 4D2KA 4EOWL 4IK7A 4DDGD 3BQUC 1UYWH 4OVZA 4PJGB 2B59A 1JF1B 4QT5B 1WZMA 4PRIB 4FABH 1DFXA 2ITCB 3GK8H 1WTLA 4WFGD 4PVNA 3W2DH 1YNLL 5FK9B 4LNIA 3SYAA 4JFOA 1UZ8B 4PB0L 5L2KA 5HSFA 2ZNVC 1DP0A 3IS0X 3VDAA 4AZUA 2HJLA 4ZTOH 4WY7L 2NY3C 4JN1L 1SVZA 4MSMB 5E1HB 4PI2A 2BSDA 3R4DA 1F8TL 3C5ZB 4I2ZA 3GKZA 4C4KO 1NCGA 5DQJA 4GYOA 1SEQL 3RNEC 4JUTA 3NSDA 4OBRA 3NQIA 3EFFA 3QORB 2WMPA 4L8BB 3MLRL 2ERJC 4BEIA 4RGMA 3IMRA 2MCNB 4K2UL 2INNE 2M1MA 3CHOA 5I8OH 4BZ2L 2CLVA 2DBJA 5HVGB 1WIPA 4JPSA 3F7VA 2KLRA 3SDYL 4GG6B 4XN1A 5LAXB 3BQVA 2DLGA 3K8MA 4F2MB 1XB8A 3EJPA 4YLCA 5IB2B 3RFZB 1B6UA 1GNUA 1AGBB 2FJHA 3VH8A 3W39A 2XWZA 3LX9A 2WXNA 3SDXA 2IPKD 4XKCA 1IEAB 4ZUSA 2WLHA 3NCMA 4PJFB 3CDZB 5E1AB 1ZLWK 3WEXA 4JK0D 1KIPA 5KWYC 5J13C 1K2DA 12E8L 2XTJD 1T1ZB 3UIOC 2Q8AH 4MQ7B 5DJ6A 1CD0A 2Y7QB 4JHUA 4WQOB 2JK5A 4HFWA 2ROXA 4A7QA 3ARQA 5AAPA 1AXTL 1KBBA 2XKNB 1WM2A 2LXAA 2JIXA 3QG6A 2IPTH 2WHVA 4FAAB 1OAXL 3B43A 3DROB 1U3HB 2X4TA 4FLSA 5I16B 2DZJA 1DQLL 2ATPB 4HXBH 4AIEA 1ZDXA 1H8NA 2O5XH 3MYZA 3K9PB 5G5HA 3V05A 3L22A 4DK6A 5HHXL 2KDMA 4UZGA 3FPXA 1EEQA 4P2QE 3CN2A 1OSZA 3NJJA 4WFHE 3ORJA 1T22A 4RBPH 2MOQA 2RIKA 1U3NA 1YJ1A 1XGPB 5BYRA 3QZMA 4Y1TA 1YYLH 1QW8A 1OW0C 1YCSA 4J4PC 3SZ7A 2ZF9A 2YK1L 1YEKL 4Q6IB 3ZXVA 4NJCA 4KXZH 1NI3A 3V4VL 2J8UE 2X09A 3ARDD 3EHMA 3SOBH 2K8QA 3WIIL 3CLEH 1VFBA 2JLPA 1IAIM 4EEEA 1J8HB 4UM8A 3QJHB 4PJGF 4NCC2 2F18A 4IHOA 2BYVE 2QJLA 3IDIB 3P4QB 5EC1A 4F53A 5HDWA 2EH7L 2IAAC 4NQKE 3MLXH 3UC0H 3E7JA 4APFA 1IHBA 1F1DA 4WSGA 1SJED 4BOZB 3NAWA 1FBIH 1QFWM 2EEBA 2VDOB 2X2JA 3I50L 4HK3J 4PM1A 3ZHNA 3MBWA 5D2NB 4G8KA 3BPNC 1RVFH 2KANA 5T5NG 5KAQG 3AG2E 4YAQA 3RDTA 1JTOA 1XGYH 2PW9A 4ZNEE 2KC7A 3CMOL 4XNMA 4EUPH 2BP3A 5IB4B 4FQQB 5KANI 4IIQB 4ZS7H 2SAKA 3ZKQD 2J55A 3LDBC 5TDNA 3LIUA 2VSDA 3IU3A 3NCYP 5DZNA 2RQ8A 3UJTL 4BWUA 1CWVA 1CLCA 2OA9A 3QJSB 3P4NA 3MX0B 4LKXA 2NZIA 4ODXA 4ELMB 2P43B 3SGDH 4ETQB 1EAOA 5DS1A 5LVEA 4KHXL 1KSRA 3CFJA 5B1CA 5HYQB 4WW2C 4EZLA 3TT3L 3DGGA 2UX7A 3B6SA 3T0EA 5EZLB 3SZ6A 1REIA 1QYGH 2AK4A 1IKOP 1IM9B 2YPLE 3S97C 2C7HA 3OZ9L 1PY0A 3M7OA 3SFZA 1WBZB 3AS1A 3MRGA 1NEUA 1RUAL 3WKYA 4EIGB 5IGXH 1HOCB 1U93A 3G6DL 4YXLH 4KXBA 4YHIB 3UYOD 4YPGA 4CDHA 4F1PA 1RK0A 1ONQB 4JM2A 2VUYA 1HJCA 2GI0A 1PJ9A 3ISMC 3CFUA 3MRMA 4DVRH 4YMPA 5MENA 5J9PA 1DVUA 2KDIA 5KS9E 3SBRA 1IPGA 3EF7A 3OJVC 1LM8B 2IGLA 1XO3A 2WO4A 1QD0A 5EO9A 4M1CD 4NAQA 3WUWA 2Q2LA 3VAEA 4BKSD 1SLXA 1CFSA 4WEMB 3VYPA 1OLLA 2ZPNA 4FGMA 1NUGA 1A1NA 3FUFA 2YXWA 4L8SA 1MFMA 2IADB 2IOIA 3X17A 2G1EA 1A8ZA 3DYOA 5DJYB 3OPUA 3WN5A 2WQ7A 3O2VL 4YDMA 3S3PA 4HMCA 3T1WA 3DHJA 3OC8A 5JW4Q 2HX8A 4S1SL 5CZKA 2X4OB 3TBLD 4BBNF 1LO2L 4WUUE 4LESA 3DX8B 1VDGA 3NH7L 1YQBA 1ZJBA 4XPTL 4UB0L 5E99H 3E1ZA 5CS7A 3NRFA 2P42B 4Y0GA 2NTFA 2QZAA 3IDJA 4CGTA 3WANA 1B88A 2BNUA 7PAZA 5KJ7E 1B4RA 5BMFL 4N86A 1W8NA 2FTAA 4FXTA 4FQ2H 2L04A 2WDRB 2XS8A 2FRGP 4GW1A 2GITA 4YSSA 2HH0H 4CT0A 1RL1A 1AHWB 4LKCB 5C0AB 2DWQA 3TNNA 4AYMC 1DE4B 5FUOH 1OAZL 4DLQA 1RWSA 3TJEH 2BJMH 3KLDA 4XO9A 4NUGH 4QKXB 3QFGA 3EH2A 1AP7A 3U6XS 1PFCA 2BFVH 4QQIA 1WV7T 4ZPVA 3H85A 1T7WA 4S1QL 2WYTA 2EJ1A 2CA3A 3PWLB 4KX7A 1UUSA 3X1GA 4G8GE 2VGXA 3VA2C 4BHUI 5IEKB 2EO1A 2C0LA 4OFDA 1MHEB 2NT1A 5E6ZA 1JNHB 3L81A 4G70B 3O6LH 35C8L 3IJ7A 3NPZB 4P2QD 2DZIA 4OBSA 4WFHD 2G4SA 4QTHB 4TUJA 3VFSB 1NMBH 3ERXA 3EBHA 3I4GA 3IBEA 3DX9A 5BOPA 3TBTA 3DVIA 4R7VA 2XWTA 4MJJA 1ZSDB 1BJMA 4IMKC 1Q9WB 1DJXA 3C08L 1CYWA 3Q1EA 1NENB 4LQFH 2OMYB 5DJZA 3WHXA 1KTJA 3W1SC 3IMVA 4WCYL 5JO5A 5KYWA 1WF5A 4NIKB 1DJWA 1H6EA 4F7CB 2WXQA 1UBQA 5E6PA 1DQQA 1A6ZA 2RACA 2JVCA 1E6JL 3TVMB 2JV6A 2ODIA 4LB8A 4BH8A 4JY4A 4ICWA 4LSRL 1BX2B 2FJGA 4LEXL 4XPFL 3UZEC 2WXIA 4ATGA 1GZPA 3KHQA 3UMNA 4Y5VA 2XPYA 1Q1JL 2Y0SA 4NLAA 3O3DA 1OT2A 2NR6A 1FLRH 4F33A 5FYKU 4F80A 5T3ZH 1R5VB 4WI0B 2JKNA 2MPAH 4HC1L 3ZUNC 1T1XB 3CVIH 3PUCA 5L7XH 2IWKA 4RVBA 2C1PB 4L5FE 4G8EA 2LUMA 1WUZA 3PRZA 3RJDA 2VABA 4YSCA 1HOEA 4Z7UE 1EEYB 2E7DA 3PYCA 3D9LA 1Z66A 4XVJH 1L5PA 2IGTA 3SKJL 4IHBA 4R97B 5F2FA 3U0TB 5BMHA 2AERT 2TSAA 5EBMA 3N5AA 1IBZA 1SMDA 4HVBA 4OM1H 4P5TB 1PKQB 5TQ0L 1LD9A 2YPLD 4ZFFA 4YSDA 4JPWL 5FYJE 2CAKA 4EMZA 2RA1A 4R9HA 3ETRA 2H6PA 2HFTA 3WFDL 1NIDA 1KF9B 4KT6B 1JPST 1JK9B 4HJJH 1HIML 5DT1H 5I8KH 3CFEA 3WS3B 5ICZB 4W9EC 3FO0H 1DCLA 4CU8A 4IRSA 3CVVA 4H8PA 2ICIA 4WK4B 5CSZB 3ZYOA 3U9PH 4RMUA 4ITKA 3QWOA 2Y69E 2IALA 2VSNA 2GTZA 2ED8A 5C97A 5L8KB 2N4FA 3Q0HA 1OCCE 2IBIB 3S4SA 2AJ3A 1AG6A 1B89A 4BYHA 2BB5A 3MVSA 3VVVA 2OMWB 4XN5A 2O61B 2L05A 4G1MA 4NBXB 1F6AA 1NGYB 3EDKA 2PM6A 2CUAA 3BIKB 4LAJH 4MB4A 5AL0A 3RUGF 3RO2A 2BS4B 2ITDA 2E74C 2ICWI 5BZXA 4JR9L 1YEIL 4PLJC 4AWJC 1YPZB 2H9GB 5B38B 3OPZL 5GIRA 1F56A 3DUSB 4HKZA 1IVLA 4RIRB 3ULEG 3PHSA 5FM5M 3GUTA 3CTTA 2V5QC 4MCYA 4WUUD 4Z0XA 2QHRH 1WD8A 5L0QB 1JGUL 4ZUTB 2JB6B 4GT0A 4UNVA 1LK3H 4YSAA 3KVQA 1RUQH 2ZWYA 3NOBA 2BY3A 3NIDB 4F92B 1R0AH 1H8CA 1HT6A 2ICES 2A6IA 4QHNB 5FFOA 3BDBA 4YDLC 3QNXB 2WXOA 4N8VG 5I6XB 4QXGH 3U6RB 4GS7B 3V9FA 5HHMB 5HY9B 4G50A 2H1PH 2X3CA 4OLXL 5FYLE 5FB8A 3SN6N 4ARCA 1T0YA 4HWNA 1IM3B 1E42A 4A7VA 3ZRFA 2CCLA 1NBYB 4JCMA 5IMOB 2VXTH 1ZTMA 2OK0H 2UWJG 1TYQG 1P4BH 2GTWA 3C8DA 3PWUA 1XT5A 1D5IL 3AEAB 1YHPA 2C7UA 2DQHL 3D34A 4G6MH 5EBWA 4PJHE 4XN2A 1JMXA 3BWSA 3ZBMA 2WPGA 2H32B 1P53A 4N2CA 3NZ8A 4X5RA 3CXDH 4LLMA 2CGRH 1KLUD 5ACZB 5I5RA 1Z5LA 4I2XA 4LEUA 4XP4H 1RPUA 2CGYA 4G8GD 1CK0H 5H94B 4ZO9A 3OJ3A 3V6EB 1EZUA 4XT1C 3T77B 5IWLC 2PP7A 2WM0A 1VRSA 1W8OA 1EQWA 2EEDA 2WLZA 4NQEA 3DBSA 3CR3A 1OE2A 5I1HL 5AB1A 2E3TA 3PP3K 1GKOA 3WNNA 2BNQB 2SEBD 2L52A 3FOLB 2RKKA 5EX3A 2IC2A 4N68A 5DC0A 1P5UA 4OAUC 3BKML 4YS4A 1TPXC 3MBEB 2X6VA 1KB9J 1EXHA 1Z9MA 3L5XH 2DLBA 3BUYA 1HZHL 5MEOB 4KTGA 1MHHE 1WFYA 2INDC 3DSFH 1XD1A 2LQRA 3VWJB 2VLRA 2DQDL 1OY3B 1QRNA 1H5BA 2P5PA 1A6VH 4XP6H 5L88L 3GSQA 4PJ9C 1SZAA 4AGMA 4XCNB 1CE1H 3AE2B 4LCIH 1W3BA 2Y3NA 4LPCA 3OR7B 2WXFA 4LL9A 4NC2B 5GZOA 4HWIB 3MLUH 2EIEA 1IUZA 1KENH 5T1LB 1ZA6B 3FRUB 3INOA 1JZFA 1N11A 3FJTA 2QLYA 4W4OA 4WI7A 3L3IA 3WFZA 3JWNC 5C08B 1E28A 1YNTB 5JHLA 3QDAA 5KZCB 1Z7JA 2NRDA 3ZXPA 1YPZF 3QCVH 3NB2A 1FGNH 3S5ZA 2CJNA 2HT2D 5H37G 4JWSC 3CWIA 4ICXA 2D4FA 4LBEA 4JQIL 2EE0A 4F15C 1MEXH 1PDKA 1HH6B 4G5AA 5I6NA 2PWDA 5FDWB 4A7GF 3QEQA 2MEKA 5HKPA 1IARB 2A6DB 3AAZB 5EN5D 1QKZL 2G3XA 3E9UA 3I9GL 5DJXA 5AWNH 3SDDB 4CSPA 4MM3B 7CGTA 2LUEA 4UCFA 5KVGE 3BWZA 3G04B 3BC9A 2W92A 3H55A 3LQMA 3KPPB 3FF8A 3TEUA 2V5FA 5FYJD 3DSTA 2A9NH 2IFFH 3P69A 2GY7B 2WINB 3O81A 4HJ1A 4LHUG 2A0LC 3V6OA 3ZN6A 4DN4L 5B3SE 2VDLL 5DMGD 1L0YB 1N2RB 1P7KB 2XRAH 2P80A 2PNNA 1MCSA 2QDFA 2VJ0A 2XZCL 3SDAC 2KYWA 1R33A 3QR1A 1FIGL 2VNCA 3ZIMA 4EBAA 1TNNA 3OB0K 1NKRA 2DDQH 1HEZE 3SZKC 3KEAA 2H26A 1NMAH 1X3DA 3HLAB 1R3KA 5GGVH 1UQSB 1NCDL 4KJQC 3P4MA 4NFBA 4FNTA 2BLFA 4JFYB 1AS7A 4DP1X 5EUKB 1XCXA 1ZGLM 2C7NB 2QKIB 4Q9BA 5FM8A 5IQLA 1TN7A 1FFPA 1PZ5A 1TJGH 1QAWA 2NW2A 4FL4B 4TQEL 1BFVH 5L2JA 5EZJA 2WLBA 5DHMC 2WQXA 5BJTB 5IM7A 3TN0B 2XEVA 2E7CA 3SDCB 1TR7A 5BV7H 3OAZK 1A7QL 1R7SA 4G6FD 3V10A 2NSQA 1D9KB 2NY2D 2VQUA 2BP5M 4OJYA 1MHXA 1WRDB 2EIKB 2R39A 4QXTA 2BF8B 2C7MB 3T4YB 4B8AA 1GMEA 5EC2B 3RTQB 5D1ZD 3RY5A 3MP9A 2ERJB 4L4VE 4XOAA 3SE8L 1Z3RA 3FO9B 4DHZE 2F8YA 3ZDXE 2XOTA 2P8MA 4QOKB 1CXKA 3ZJUA 3HFML 5KYYB 3HG1E 3LKQB 1JGEA 3PEUB 4MNGE 4HB5A 5BO1H 4FYQA 4XBGB 5FYLD 1TJHL 4HJTA 3CFQA 4EE2A 1XCTL 1I7ZA 3HE6B 3C87A 1IBGL 4MCMA 5GGRY 4A7UA 1M4VA 3IAS1 3FB7B 3FTVA 4CGVA 1QLBB 1KIQA 4JL0A 2A9MH 4LNOA 1NGXA 3L6AA 1MELA 1WH0A 4MJIA 4HS2A 4K8RD 3K2IA 1VJSA 2ZCHH 2ZUYA 1V05A 1KEGL 1WT5A 1DVZA 2Y5BB 2XACC 3KJ6L 1W91A 2WLLA 3EJRA 2WBJD 3INUH 5DK3A 1YNTF 4A6YA 4DGVH 4AQ7A 2I9CA 1DDTA 4WENB 4MXQD 3WEMA 2DLFL 4YL4A 3U7YL 5KJRL 4X9HA 3OXRB 1TU2A 4GW4B 4GRLC 2VO5A 2D9CA 3HVDA 1CDCA 4X6DA 5I1CH 2F7RA 4IDIA 2BW5A 3QA8A 2BCKA 3P3YA 3CVXA 3HAEB 5MI0B 4BK8A 5CF3A 3S3SA 4HPMB 4KVGB 1NWOA 1THCA 4I85A 3POCA 4HEMA 1A6UL 4P3DB 4HBCL 3EHVA 4BDVB 5IB5B 4EFOA 4N8PA 3VFRB 2N7BA 4LSDA 5LXGH 4X8JB 3TAXA 3BVNA 3IJEA 2V1YA 2KI6A 3V9EA 2FCQA 4JZNB 4Q2ZA 2ONQA 1HO8A 5GJSL 3O65B 2VLJE 4H5SA 2BK8A 1IYGA 4DGYH 2FNJB 2NYKA 1GH7A 2AYOB 1EEZA 3V5DB 2EDJA 5G5GA 5KWDA 2EVFA 4G24A 1KXHA 3EJUA 3SO8A 1C12B 4R0LA 1NC4A 3R19A 3RNKB 2NY5C 2UY7B 4N3UA 1NEZB 3ABZA 2ATAA 5AZGA 2Y4TA 5KBLA 4XVSL 4DXGA 1UT9A 3BAYA 4Q89A 1U2CA 1Q0XL 4RFOH 4HALA 4NKOB 3PJLA 5DK0B 4WNDA 4BK5C 4KTDL 4E0RB 1JV2A 1YECL 3GSWA 2HT4D 3GHEH 5JW3L 1PSKL 1KBGL 1A1OA 5E9NA 2ICEB 4AJWA 1D3ZA 1RZGB 3AKLA 4B95C 1HILB 2BC4B 5CJBA 4M0WB 4J3VA 1YY8B 1A6TA 3LZNA 3SO5A 2XCCA 1BYPA 5JZ7C 3TH4T 5JHLH 3AG4E 2MTAA 1FNSL 3G5XB 2YA1A 1WGKA 3DVGX 3WY1A 3D12B 1DLFH 1I7TB 4HUWB 5IMMA 5HYJE 1KV7A 4NDMB 1I1AA 1OVZA 3LIZA 3CVQA 2FATL 1VENA 2HTKC 4KKQA 2HJKB 3MOAL 4OCXL 3UGXA 3FT3B 4F3FA 5MEQA 4B6WA 4KPHL 4NSKA 5EB9A 5IMLB 1XLQA 2KQMA 1NKOA 3D51A 2BNRB 4LNRB 1DBML 4AYDC 3QR2A 4M8VA 4ZMTA 3V52L 4PWKA 1N4RA 2WO2B 3L17A 1SHWA 3HPJB 4MT5A 1G7JA 5I1IL 2L3ZA 3EGDB 2R1WA 4JHBA 1OTTC 3VFMA 3X3GL 1LE5A 1EHXA 2KKCA 5J17A 1LEGB 2HTLD 5SWSE 3ATAA 3GSVA 2VWEC 1PYWA 1QFHA 1UXMA 4HXAH 4FLQA 4PJAE 4YNYB 4W9FC 4J23A 3RY4A 4HKXA 2Z8RA 2NVUI 4E41E 3B34A 5ISZE 2ZUWA 2RG8A 4FA8A 4JY5L 2H45A 1J1OL 4KSKC 3JV4B 5CHFA 1BUIC 1CU4H 5D1XE 4KI5E 1GYWA 4FJYA 4S0TD 4WW1B 1JV5B 2BS2B 4HPHA 1Q38A 3MRPA 1VRAB 4HCFA 4K9EH 4L4VD 4U6HB 5DDHB 2YLMA 1ASQA 5F3HA 1R75A 5I6KA 3UDWC 4WJQA 1IE4A 4JFDB 3AS4A 2JKTM 2FZ3A 5E51A 3TA4D 1T5XA 1RAMA 2FIFA 2BSBA 3HG1D 4OD1L 4EVNA 3PXJA 3PGDA 5HVFB 5HYFA 4NYLA 3H1UA 3EFOB 4ODUB 3ARFD 4NWUH 5CGYD 4YWGH 3TWSA 5A2KH 3ABLE 2AAVA 4KYOB 3QNFA 4AUUA 5E9DE 3W9FA 2YQBA 2MNJB 4C56C 4WI9A 3B7TA 3DPDA 4YHLL 5JR1L 2J72A 3S7BA 2ZXDA 5I8EB 3JYBA 4PJGA 2HRGA 3ZUCA 3Q15A 1JF1A 1R1CA 4QT5A 4NOBA 5GZND 2LRWA 4PRIA 3K9OB 4NWTL 2ITCA 3UXFA 1UD8A 2UZXA 3ARTA 3TBWB 1FAKT 3ARUA 5FK9A 4Q8BA 5BYSA 4I3RL 1UZ8A 1QNFA 5F1SA 2K3UA 3EJSA 2WBKA 3BG1B 2C5DC 4L1BA 2ZCLL 4A6YH 5CEZH 3RX7A 5JUEH 1N64H 2FJFB 3ZYLA 2GAZB 4ENEC 2QKSA 3I5PA 4N2EA 5GJTH 4F7TB 4JPKL 1N70A 1LILA 1E4XL 3QZOA 2I69A 3QT2A 3C5ZA 4YE0A 2Q86B 1EUUA 2C9WB 4L37B 4ZHOA 3U7WL 4KKPA 4GBXD 2B08A 3I9AA 5EDSA 2LE9A 3QORA 4K3DH 5I74B 3RY6C 4A7SA 5KVFH 3K5SA 4KQ3H 4L8BA 4KZEH 5F8RC 3EBIA 2VLJD 3C5JA 4JFEB 3A6CL 3ESVF 5LBSA 1MG2C 2IMMA 4GCNA 1YEHH 4KQ4L 4U6XB 3FU5A 4J3OH 4XWGH 5E4OA 5AYQA 5LAXA 4F2MA 5FLUA 4GG6A 1SXSA 5IB2A 3RFZA 1UG3A 4R2GD 4YC2C 5C07B 1AGBA 4J12A 4TKNA 4CJ0A 3SGKA 1KMGA 5AKTA 4LVOB 5C6TL 1IEAA 4YHKH 3STZB 4PJFA 3CDZA 3QZNA 5E1AA 1QOGA 1KZPA 1XT9B 2J1ZA 1X4XA 1S7QB 3QRGL 4Q9CA 3ULVF 3A4RA 3R0MA 3BDYH 3IRCA 4ERSL 4MQ7A 2GBKA 4JZJC 2PXYD 4UMSA 5FPIA 2DLHA 2Y7QA 4WQOA 4FADA 3TF4A 2HJFB 1Q0YH 4HIIB 4MVBC 4X8CA 1KH0A 1N95A 4RMWA 4K7FB 1G9NH 4XCCH 2XKNA 3RZWA 4CILA 5J8OA 1JYXA 1U3HA 3E0GA 4P59H 5HHNB 5I16A 2ATPA 2F7QA 1OALA 4OZHF 1M05B 4JO3H 2AFNA 4OGXH 3WG7E 2VZUA 3OB8A 1OE3A 4MACA 1BMZA 3OJ2C 2PN5A 4NCDA 3BUTA 2P5EA 5HYJD 4KROC 4IOSD 3Q5OA 2A1WL 3BAEH 3C60B 2FR4B 2VMCA 4XO5A 1XGPA 4IKJA 5IJKC 5IOKA 4KVMA 2LV4A 2GC4C 4Q6IA 4NQXB 3LIZH 4MMXB 3VUXA 3NPSB 1HF8A 5CGBA 3QJHA 1WHOA 3AS2A 1ZTXH 3P0VL 3LH2H 3RRQA 2JXXA 5DUJA 3N30A 3IDIA 4M3HA 1O5PA 4BE5A 4V33A 2EXTA 3K7UA 1V81A 4UV7L 4FFVD 4ZZFA 1MFAL 4A1GA 1BJ8A 1KTCA 5K69A 4MRCA 2ZSWB 4Y4FC 4PGCB 1ETZB 3GPSA 5D2NA 4Z7NE 3DBXB 2UUDK 2AXGB 3EJTA 3GNMH 1B4TA 5SWSD 3DVFA 1EV2E 4D0BB 4RF1A 4E41D 5ISZD 5B8CA 2ZKYA 1C7SA 3CQQA 3QPKA 2QFCA 4PU2A 4FQQA 2EILE 5E6IB 5FOJA 5D1XD 1NZRA 3QZBA 4KI5D 1SW6A 1AO7B 2FGZA 1LXMA 1UVQB 2OP4L 4YHOL 5F1OB 1RZKC 3EO1B 4ETQA 3MX0A 4GAAA 4NRYB 3NQPA 4ELMA 2CLZB 1OEZW 3WGUB 4U0RC 3AXCA 2M19A 1D5MB 2HXAA 5HYQA 2LU3A 5SV3A 4L9LC 3RNGC 2K7PA 4KOBA 4RCOA 4HS6B 3MCG1 4FLOA 4FKEA 2QL1A 4LFHD 5EZLA 4E9RA 1IM9A 3JW0X 3KSLA 1B4LA 3L3OC 4KKBD 1KXTB 1WBZA 4Q0XL 1NANI 1HOCA 1J8SA 4YHIA 5E9DD 1AWCB 2K8MA 1SFDA 2PR4H 3QG7L 3V7MA 1ONQA 3MXVL 3QUYB 5HDQH 3U1SH 4FCAA 3MSPA 3OLGA 1NWPA 1FA4A 2R4SL 2EUXA 3QUXB 3GP7A 2AJAA 1ZS8B 2EQXA 4TF4A 4A2GA 3LJNA 2IO5A 3GKWL 5D71H 2WLIB 3TA3D 1A14L 4PRHE 2YFNA 3P4SB 2PZIA 4XB8A 2JUOA 3LKOB 1ZGLP 4BFIB 3GSOB 5IHUL 1JK8B 3NJMA 2VLKE 2GIYA 2LMCA 5INDB 1KBPA 1JIBA 4Y19E 1RH8A 4UWHA 5JIKA 2IADA 1X7SA 3HW7A 5C3IA 4NJAH 2W82A 4OCNC 4OI7A 3K2UH 1FT1A 4Z76B 5DJYA 2GBUA 2DZNA 2RFAA 1JTPA 1PG7W 2VN3A 2Q5BA 4BX9A 4OVVA 1F18A 2YUWA 2AJXL 2X4OA 3ZPJA 4ZNCD 4KKLC 2RTTA 4TTDD 3PZ8A 1DSFL 3DX8A 3P11H 5EE3A 3MBXL 2NY0C 4GUPB 3HJEA 2PW2B 1OAUH 4HK3N 4RGNB 2YA0A 3E8VA 5DPRA 3PL6C 5JZEB 3BWUF 1N4PA 4IKNA 1IL1B 4UNUA 3QIBB 5JXAL 4BSWB 3GQFA 1K3ZA 4MB3A 3MFFB 4HA1A 2ZWLT 5SX5H 3WKML 4ETYA 4UTCA 4X9GA 2ZOWA 5LBSH 2O2VB 5JPMB 3GJFK 1RRBA 1YY9D 3L3DB 4A3PA 5DI8B 2NTTA 2QQKH 1AHWA 4LKCA 5C0AA 3LEVL 2Q7YB 4LVHC 1BBDL 4KH9A 4M6ML 1EVUA 3FQTB 1WJ3A 3BGFC 1CZ8L 2Y7SA 3R7RA 4I6LB 2UWEE 1PD1A 1A6WH 2Y5PA 2NY6B 3NN8B 4JHWH 3G2UA 2GROB 4Q4IA 3MUJA 4X4KA 1W0WB 3HTLX 2DRUA 1J5DA 2OBGA 1XDTT 5D7JC 3PWLA 4W6WB 1OQOA 2Y1VA 3GRWL 4YR6B 1T6WA 4F15B 1SN0A 3DOHA 1MHEA 4LP4A 3QQ9D 1JNHA 5EFIA 2B20A 1J9TA 3ZTDA 4HFGA 1X6LA 5HYIA 2L9BA 1NL4A 3QCUL 3S2AA 3VFUB 4QTHA 3B2MA 3RX8A 3VFSA 3GPEA 1R3HB 3C72A 1FGVH 4LSPL 3ZT7A 4PW9A 1AFVL 3LCYA 1ZSDA 4RZCB 1Q9WA 3FSVA 1I1YB 5D96C 1X5JA 2OMYA 4QJ3B 3M1BB 1U8PB 3S35L 1BZEA 1ZXIA 4NIKA 4F7CA 5M95B 4O4YL 2LGXA 3U30B 1FZOB 2KS0A 3VH4B 5F7YC 3TVMA 1AY1L 1T89C 2XTJC 4BXSV 4WU5B 4X7SL 4J7WA 1JJUA 4LU5H 2Z0DB 1WFOA 2ZJSH 3NFNB 3ULUE 1A7OH 5EORH 5F7LB 5F7UA 3LSOB 5E0FA 5HPOA 2VDOH 4J8DA 1RZJH 2VL4A 4LSVL 4PH8A 4GMTH 1MCCA 5HPMB 2O6VB 4LTUA 1R5VA 4WI0A 3EFCA 5BRZE 2XBDA 1T1XA 4H8WL 3MUGB 3CV0A 2ZVOA 2MRIA 4U4IA 4TULL 2C1PA 3LB6D 2COVD 4UT6L 1GGUA 1A7PH 1JDDA 2PYEE 4MSWB 4FMVA 5HI1A 2WYZA 1EEYA 2XX1A 3VGDA 3TPKA 5M7QA 4JD2G 1NOAA 3CLFH 1S9VB 3U0TA 3VTUA 4GI8A 2OEVA 2DMBA 3C6LB 2P7TB 4O5LL 2APSA 3KDPB 4GTTA 3PP4H 2VR6A 2JJSA 3OTTA 2Q8BH 5DQDL 4Y1AB 4EAEA 5IJVB 4URKA 2G5UA 1DVSA 3OHMB 3VQ2C 1SM3L 3FP3A 2GRMA 3ARDC 1ASOA 5KYNA 1BV8A 1IC1A 3WEAA 3Q6GL 3ZKSD 4PCKA 1JK9A 2EDLA 4U6TA 5ICZA 3WS3A 2YMTA 2VQ1B 5BRQA 3SD5A 3NAAL 4GXFA 2N7JA 4AL8C 2LGYA 1UCBH 1KELH 2C5LC 4E71A 4XC1H 4ODBD 5FUCE 5CSZA 4F5CA 3O2DL 3PV6B 4PRHD 4GH7B 1BHGA 2I07B 3TWVA 4ONGH 3M17B 1UZ6F 4Y5XB 2J20A 3DX2A 1NCWL 3SQVA 3HZYB 4UQAA 4NENB 3T0XA 1N0LB 3UTQB 2I25N 4DEWA 2VLKD 2MBBB 3UTPE 2OMWA 3AT9A 4Y19D 4B5ZA 2O61A 3NVZA 1I7RB 4W9JA 1NGYA 3BIKA 3FSAA 2XA8L 3PUJA 4FNQA 1P84J 1RMFH 5FGBC 3TO4B 1MVKA 3TWRA 1YPZA 2H9GA 5B38A 3X0WA 4TKWA 3U2SB 3DUSA 1NLDH 4RIRA 2EINB 1A9BB 1MRDH 4M93B 1TBEA 2J4DA 1NUNB 5TE4L 2V8MA 3CIQA 4ZUTA 2JB6A 2FUHB 5JIPA 5DFVD 4WEUD 3SKNB 1L0PA 3O3EB 2M1KA 2BDNL 3U52E 4OB5L 3AEFB 1TZ8A 1NA0A 3WNKA 4QHNA 5G4NA 3L1OL 3PGCB 3U4BL 3QNXA 4AX3A 3U6RA 3JYUA 1V80A 1CFVL 5J12B 5HY9A 3UBXI 4CC4C 2F68X 3HBPA 1IM3A 2YUZA 2OR8A 4FBJB 3CLWA 4EJ1C 1NBYA 1X4YA 4M7LH 5IMOA 4MBRA 4MXVE 4OKVB 3MCLH 4GTQA 3LKNB 1PJWA 4X7CC 3AB0C 3TONA 3FT4A 3VFGH 2DZOA 3PIQB 5LGHH 4ATWA 2LWPA 2FGWL 3KZ8A 1TO5A 4M1CC 1LDPL 5CEAA 4Y4KD 3BVGA 1BQUA 2FEDD 2F8XK 2XYBA 4HISA 3ASFA 4DX7D 4O9HH 5IKCB 2IANB 2JELH 3VDZA 4FI8A 5ACZA 2WD0A 2YSTA 4BUHA 5H94A 3TEZA 2HD5B 5K59E 2FWUA 5E1QA 3RIAF 2CO7A 4C4VB 3L1EA 3T77A 3BESR 1A2YB 3LHPL 5AYUH 4N5UA 1XO8A 3WFBL 4Y88A 3FBQA 2YD9A 4XBMA 3EJQA 2BNQA 2P5WB 3FOLA 2VN7A 2AWIA 3UCQA 2MJ3A 1DVXA 4UOZA 2CR0A 3UYRH 1G7IA 4K71C 4Q9QH 4GIAA 3MBEA 1IBHA 3A3YB 3PY9A 1SIJA 4U1IB 1NAML 5HHVL 2EIZB 5MEOA 1Z9SB 4FFWD 4HLZG 4QXUL 3VWJA 4TVPH 1A3QA 2ADYA 4NZRL 2KAJA 3SDXE 3NJLA 1WEJL 1L5GA 4R3SB 1U8OB 3V62A 2BRRH 5MP6H 3K5RA 2V4HC 3EDFA 3ZPDA 2A38A 1MYOA 4XCNA 4JGJA 2Y2WA 4ZSOB 3BAKA 3BDXA 5H2BB 1Y07A 3QDNA 1VFOA 1JMZA 1ET6A 2G9HD 3OR7A 3DX3A 1HN1A 1J1XL 1NA8A 3ULUD 5ENOD 5T1LA 2KLGA 1ZA6A 3CXHK 3KD7A 2F8XC 2FBRA 3U66A 5C08A 5A16B 1YNTA 5BRZD 3BAWA 1BFTA 4PR5B 1HAWA 2D7PA 2BVOB 4M6NH 4F8PA 3E34A 5FUZH 3AS0A 4O2FB 3IDUA 2PYED 1HH6A 3GXDA 3IFOB 5FDWA 3NZSA 4BT9A 2A6DA 3AAZA 1D7CA 2YAOA 4MM3A 1HZ4A 2ITEA 3JT0A 3SDDA 3DSVA 4YDOA 3ZNZB 1CDHA 4WNQB 4A67A 3G04A 3RWFB 4OZIA 3FNKA 1H8SA 1X5HA 3OKEB 3ASDA 3KPPA 4O1PA 1MPAH 1UC6A 2WINA 3B5HA 4JFZL 3VGAB 1JNLH 2JB5H 2KWDA 4US9A 4I0PD 1L0YA 3U6XA 4DQOL 4IC7B 2VR4A 3PNTB 4JRYB 3NABL 2X3MA 3A4EA 1M1XA 1P7KA 2MRYA 2Q76B 4C56B 1GB4A 4KWUA 2H8PB 4GQZA 4ZMYA 4GSQA 3C3QA 2GB2A 2CKNA 3AROA 3P73B 1MFBL 1IGML 1IT9L 3VB9A 4X7DC 4DGUA 1NYRA 2EEXA 2YKKA 3LXAA 1CIUA 1IC7H 1FCCA 3HLAA 3KBFA 4I6PA 1UQSA 3UTPD 3REWB 3ZJVA 2RFMA 4Z0BL 1CTNA 1KXVA 1HCZA 3BN3B 4JFYA 3UJJH 4F9PC 3V8CA 1KTLB 5EUKA 1BREA 5C1DA 1SUHA 2QKIA 1XSJA 4WJG3 2A74C 4W93A 5HG2A 3IT6B 5BJTA 2IY0C 4QTFA 3TN0A 3SDCA 2BOLA 2LHDA 1D9KA 3B9KD 5DZPA 3HKFA 2Z1KA 4FQIH 4H8QA 3TCAA 5AOIA 3T4YA 2GBVA 4WJOA 3CFCH 3HC0B 5EC2A 5EZOH 5GGTL 4UF7C 3RTQA 2IOOA 4TUOB 3T0EE 3FO9A 3RRUA 3D30A 1BZ9B 4ALAH 4DUIA 4XB3A 2ZJDA 3CVHB 2Y5CA 1GIGL 5KYYA 2NQ3A 4AMWA 3LKQA 3CHQA 4K07A 3CAFA 4XBGA 1YNKH 2IJGX 2ADFH 2J71A 4UQCA 4LMQE 2LAAA 3HE6A 3QEHA 1D7BA 1L9QA 3VFOB 1OQXA 3FB7A 5D2LB 1D6VL 2F74B 5MENE 2R8SH 1LMKA 3B9VA 4ZXBD 3UADA 1LK2B 4I1PA 3W9EB 4B9YA 4YOKA 1Y1UA 3X11B 4HUVB 3P4PB 2FYYB 5BS0B 2BHUA 2R2LA 1C5DB 1ERNA 5CD3B 3WA0A 4YGVB 3RJOA 1RFKA 3RJVA 2BY0A 1ROCA 3NTCH 1N62A 3WFHB 1JFQL 2F0CA 3NIGB 4PBVC 2Q10A 4HCNB 4GW4A 1LQSR 2FHCA 1L9OA 2P9RA 2QVIA 2XWJB 4F37K 4BQ6A 3OC5A 3MJ6A 4GRWB 3HAEA 5I1KL 1UXSB 3BINA 4PWFA 4P3DA 3ZE0B 4BDVA 5IB5A 4WHTB 3VFRA 3LQAC 4E9SA 1UD7A 2GRNB 1FORL 4X8JA 2CO4A 3AQXA 5EA0L 2YAPA 3VFPB 4JZNA 1K3IA 2H89B 1P4UA 4KBQA 5L4IA 1VZGA 4X5PA 3V5DA 4LSTL 3FFCE 2YGPA 3BUDA 2R02A 5A43C 1C12A 4BFRA 3N06B 3RNKA 2UY7A 3KH4A 1NEZA 1TSHA 3VUYA 4P16A 4W70A 4KV5F 2VGEA 4F57H 5DFWH 1PX4A 1PD6A 1HKLL 2WYQA 1TKGA 5DK0A 4A3TA 5ANHA 4E0RA 2ZCBA 3NF1A 1LO5B 4XNBA 4Z78B 3FU7B 5LQBL 4NPJA 4G23A 2DQUH 2JIXD 1PGBA 3FXIC 3FCGA 1XD0A 2AI0L 1OPGL 2ICEA 1HINH 3LNEA 5HD8D 1TETH 1CTMA 1HILA 2BC4A 3P2TA 4OGZA 4M0WA 3CZUB 3Q7AA 5IQNA 1YY8A 3QXWA 2NTSP 5ID1B 4M43L 4CRPA 2PTTB 1H3WM 1Y7VA 4RCAA 3G5XA 5LAPA 3G2SA 4AUJA 2BGFA 4PGDA 3VJ6B 1I7TA 5I6PA 3BH8B 5A40E 4NDMA 1CFNB 1K4CB 1FNEB 1P5VB 4NNPH 1PZ2A 3VI4B 1V5OA 2HJKA 4MJ4A 3FT3A 5I73C 1BOGB 5FYJU 5IMLA 3RHWK 1DBKH 4BRVA 3HZKB 4NZUL 4HG4J 2BNRA 4LNRA 2OLDA 2XN0A 3S34H 5I71C 3VRBB 4E5XB 4ZRKA 1PEZA 1OQRA 4I87A 4DETA 3HPJA 2G9KA 4FZEL 3BUIA 5AKVA 3QUML 3EGDA 4QO1B 5DEGB 3RDTD 3T2NH 1TSRA 1GZQA 5JW4M 4A66A 5IBUB 3NIGF 2CKHB 4ABNA 1JS4A 2XN9E 4YNYA 4QRTB 1QQEA 1OM3L 2HKFL 2V4IB 1B9KA 2E9GA 4IYPA 3CK0L 2B1AL 2JKLA 2Y7LA 5CLTA 4GRWF 1PEWA 2QSTA 2HT2C 3HVZA 3L10B 1U8JB 4TQHA 1V1PB 3L3GB 3L2NA 3JV4A 1DBBL 4H1LB 3RPFC 2K9UA 2VE6A 5I1JL 1FH2A 2XY2A 3QIUB 4NKDB 4M4PA 2BEDA 1JV5A 2W95A 4KJYA 2VDRB 5DDHA 4U6HA 2WX1A 3T0ED 5B1AE 1N54A 3KPMB 1QFOA 4JFDA 8FABB 4ONHB 1INDL 2LNIA 2W59A 3WFCH 1U92B 3EU9A 2UXFA 3FU9A 1MFDL 1EHLH 1DOYA 4L9DA 5I5MA 1EFXA 3MA9L 5DMGC 4X9YA 3EFOA 2ZT9C 2L0FA 2VR9A 3F62A 2WVVB 5A6CA 3FMGH 1E65A 5MEND 3VTMA 3TBBA 5D3DA 2GVYA 3MV8E 4HFUL 2L76A 4EZKA 3HC4H 5I8EA 1FG9C 3Q47B 4E6HA 4PJDE 1N8ZB 1QOAA 2KX0A 2VSOE 3BGFB 1A8JH 5G05J 3OJMB 3PLUA 2MEJB 3TBWA 1DDHB 5FGRA 2WZAA 3SBWA 2HWZL 3TYGL 2W60B 1MG4A 2X9XA 1SXZA 1D2PA 4GLRH 4P23D 3TG4A 4JN1H 4NURA 4TSBL 4HD5A 5C0CE 4J3UA 1F8TH 2FJFA 2GAZA 3B7SA 5EU3B 5AW5B 1UENA 4JKPH 5L8LB 1DEEB 2G4GA 5TK4A 4F7TA 3OZKA 4N39A 3PJNA 1BT0A 2CR5A 2Q86A 3LZPA 5AW4B 3V0WH 3RKDD 2NY2C 2O6FA 4L37A 5AYWD 3VI4F 4YZFE 2AJSH 1RKRA 1WUNT 3HAEH 3U64A 1PAQA 1EGJA 2FUQA 2I7SA 4HI8A 5D1ZC 4ZTPL 1IBXB 2VYRE 4K55A 4LPVA 2Y7MA 4C4UA 1AYFA 1N12A 4JFEA 1SOSA 3W0WE 2JI1A 5K9QI 3T5VA 4POZD 5D96B 4ABWA 4GA0A 3FFCD 4NAJA 3V55A 2QGDA 4U6XA 4WI3A 1MOEA 2GUOB 2X2UA 3ZKJC 5C07A 3IJ8A 4QGTA 3UG5A 2BF0X 3BEEA 2DI7A 4WEEA 5I1DB 4RISH 4K8RC 3STZA 5HYSB 1HNYA 2R4RL 1DEDA 3Q8BA 3AKKA 1TQCC 2Z3FA 4LFHG 4PS7A 1S7QA 3CH1B 4PMFA 3GMRB 1F3RB 2UYZB 3IJSB 2A4ZA 3EOBB 5GS2H 3US9A 5ANLA 3ZT5A 4Y6CA 1DHKA 3O3BB 4G6JL 4I2XE 2HJFA 4MXQC 1QNZH 2GC7C 1CVRA 3MGTB 4HMEA 4PWGA 4JO2L 4K7FA 5ILTL 1FFOB 3VXSB 3AGVA 4KGRA 1G84A 2HVBA 1ENFA 4OU3A 4C58B 2YOAA 4BT8A 5HHNA 5KYUA 3TT1L 1IBFA 3DX1A 1BMGA 3QXTA 2XPZA 4JFPB 4NQEE 1QTSA 4R5VA 1MFCH 1M05A 3NSXA 2MCAA 5HHXH 4LDTD 4JQVA 5EU5B 1A6PA 4Y16B 3PHOB 4KNTA 2Y06H 1BM3L 2ZOUA 4P29A 1KGJA 3C60A 2FR4A 5JTWA 4AYFB 2YK1H 1YEKH 4NHCL 4I6EA 4IBUA 3ARZA 2OQJB 2GSMB 3RNQB 2HG0A 3T3PB 4M29A 4NQXA 5GGVY 2Q7AA 4I89A 4S11A 4QDGA 1DJSA 1QI4A 2WVUA 2KWCA 4FFZL 1K1AA 4I9WE 1UWGL 5HTSA 1DOIA 5I76B 1BOYA 3CVCA 3D9AL 5I66B 2QY7A 1G1YA 2VRKA 2UWQA 2PQRA 4UQEA 1SPDA 4GEJA 2I32A 1ETZA 4PGCA 3RPKA 4CMHC 1NL0H 4A3VA 3DBXA 3HG3A 2AXGA 3UM3A 2HT4C 2XN9D 3Q3GB 4FG6D 4XMPL 3MLVL 3ISRA 3FDWA 4D0BA 2AXVA 1NH6A 4NC1E 4X6EB 4JFVA 5D55A 1X5LA 2V37A 1TEGA 3H0TB 3ULVH 4U3XA 1AW7A 1RLFA 5E6IA 1DSYA 1ICTA 4P4RB 1FL6B 2JCCB 2BP0B 2L0DA 1AO7A 1UVQA 2LOEA 5C3TA 5CRUA 2K39A 3EO1A 1TQBC 3B1UA 1UM6H 2X7LB 4J6RL 4NRYA 3JTSA 2CLZA 5FA3B 3D9IA 2H5UA 3TT3H 4AEFA 1D5MA 3GXIA 3NGBC 2CFUA 1FVFA 2BY1A 2D3JA 2WYIA 4BE6A 5JNYB 3V6OE 3F7LA 4HS6A 5E5RB 5DD5H 3X3FL 4L2LA 3ZDYF 2CBPA 5IUSA 3IEAA 1ZT1B 2CBQA 1KXTA 2WSDA 1WAO1 1V54B 4IRSD 2DYRE 2R9HD 1QTYT 1YEFL 4PJEB 1VEOA 5F6IB 1Z9NA 3MV8D 2KERA 3QUYA 4GUQA 4ZZKA 4Q9RL 1MCNA 4ACLA 3QUXA 1ZS8A 3T5WA 1EWHA 3DO3A 5CZVL 2CU9A 1U2VG 4U1MB 1A65A 1HVXA 4UI9K 2O5NA 2WLIA 2PP8A 3HN8A 3SCMB 5CU9A 3EIFA 3CC1A 4OIBA 1OP5H 2V8LA 2WV3A 4N3TA 3RIFF 2HTLC 3LKOA 2FBWB 4IOFD 3GSOA 1JK8A 3QJUB 5C0CD 3X2QB 1L6XA 5INDA 3Q78A 1IAKB 2BIMA 2Z0BA 4ES9A 1OF2B 3SD2A 3T2PA 2FECI 3FONB 4Z76A 1CL7I 4S1SH 1TXKA 2PR9A 4JB9H 5DEJA 2NXYD 3MODH 1Y6KR 3K71B 4OGQC 4ARIA 3ZMRA 2JKXA 3ZZSA 4Y5YC 4I6GA 2DQGH 2YN3A 4E9XA 1Q2ZA 1SXTA 4YBHA 3T3PF 4GUPA 1XF5B 4N5CA 2PW2A 1HXYB 4HIXL 3W0WD 4RGNA 1QWNA 4PB9L 2L83A 5HKHA 1UNSA 1EGJH 2X6FA 3O13A 5FYKL 3QIBA 4BSWA 3RP1A 1WXQA 3ARFC 1PPIA 3MFFA 5CGYC 2PCPB 3LPOA 4PWIA 4NNYB 3FUMA 3CKBA 4JHAL 3A67L 4L3CB 1AGCB 2O2VA 5JPMA 1CGTA 3BEWB 5CAYB 3L3DA 4G7VL 3ZW3A 5DI8A 4R7DB 1E5AA 4N1CA 1AQMA 3HM3A 3D3MA 2LTQC 4P49A 4H0HB 2Q7YA 2WDQB 5CEZE 2A2QT 3U8ZA 3FQTA 3WALA 2MHKA 1MG8A 1URLA 4QRQB 4JJ5B 1KBWA 5GS1C 3WIFB 2VTBB 3D4CA 1X5MA 5E2UL 4MH0E 3NN8A 5T5FL 4X6DE 1W0WA 1FNFA 2JCCF 3LXFA 3KLSX 5KVFE 4NQED 2ENJA 5HXMA 35C8H 4YR6A 4HEME 5KNHD 4M6OH 3GZQA 1OAJA 2JY6A 1WDYA 2FLMA 1L9NA 4GBXC 4FXGB 2ZSVA 5ACMA 1RSFA 3VFUA 1UN8A 3I5JC 1QATA 3NS8A 3G2VA 3LKRB 4QRPB 1R3HA 4Q52A 3SE9L 4NN6B 4ZFOL 3EJNA 1RPKA 2HTHA 5FDYA 5J57B 4RZCA 2QPDB 4W68A 2WWKO 4XPBH 4EDXB 4PJEF 4BELD 4QHLB 1OAYL 1I1YA 3M1BA 1VHPA 1G1KA 4I9WD 4ASWC 3WV0A 4WJPA 4R2GC 1E6JH 1U8PA 3SFXA 4I18C 2XGMA 4LLYB 4H2AA 2ZX8A 3U30A 1FZOA 1HFUA 2N7EA 4LSRH 3MTNB 4XPFH 3I4RB 1QR4A 1IU1A 3DVNB 2W80C 3P2BA 4NQTA 4WU5A 1X81A 2PXYC 3W5UB 1YEJL 3NFNA 4GXUN 4K5LA 5AAWA 3UTOA 3LSOA 5AB9A 5A2LH 4C7ZA 2FX7H 1CXHA 2FWSA 2J8HA 2EZ0D 4BUQA 3WELA 5HPMA 2O6VA 2BY2A 1FE8H 3MUGA 1UELA 2HR2A 1VGKB 1PG7L 3JQOB 4B9PA 4HOXA 5IESL 4ZX5A 1BWMA 2XFXB 2VKWA 4GUCA 4MSWA 2YOCA 3FHAA 3QRLA 5IFAH 4N58A 5EE1A 1X5AA 2Y1LE 4GSDH 1AI1H 1BXUA 1BI7B 5H8YE 3C6LA 1A7NH 2P7TA 4FP8H 3TSSA 3ALXA 5IJVA 3U48A 4OLZL 4NUQA 4Y1AA 3BU8A 5DYFA 4EQ3A 3N0AA 8CGTA 1HIMH 3MLZL 1MX6A 2P80D 4MBGA 4LQ1A 2FIRT 3QQ4B 1TIFA 1MY5A 1C7TA 5ENRD 2H3KA 2VQ1A 3R0NA 4HH8A 1ET9A 4EHMA 1UJ3C 4XXCA 3BQOA 2G30A 5F7WC 5FS5A 2WVTA 4FHJA 4LRIC 4LP8A 4DOHB 2YSSB 4P1BC 4OF5A 2AITA 3PV6A 3GZ1A 4XNZC 1L9MA 2I07A 1TOXA 1I9RH 3AY4C 4Y5XA 5JW5B 3HA0A 4G8FB 4JLRB 4ZAKB 4PUCA 3HZYA 4OFVA 2RBLA 4NENA 1N0LA 3UTQA 3SY6A 4Z8FH 1DZBA 3L82A 1ZLDA 1B0IA 2XG5B 2OYPA 1I7RA 1UH6A 2EH8H 1CGWA 1A66A 3AV8A 3ZK0A 2HRPL 4HJUA 5I2IB 3TO4A 2IH1B 3DSWA 5D1XC 4BHUA 4EZMA 3DJSA 1LFDA 4KI5C 3G08B 3WHE0 4JG0L 3U2SA 4JA9A 1A9BA 5JIHA 5HHPB 2NQCA 1HX8A 3Q44A 5CFHA 3SKNA 2PF6A 3O3EA 4YDKL 5TPWL 4X6CF 3Q8FA 3NZ3A 3UTSA 4H7YA 1AIZA 3PGCA 3TIXA 1AZCA 5DZ9A 2PO6B 5DWUH 4OUUB 3OJ4B 2XIDA 3COOA 4KKBC 4W9DC 4DWFA 3LKSB 1RERA 3WJLA 3R2TA 1QP1A 3HE7B 2BVYA 4MA1C 2HLEB 3D8MA 4U4BA 1JRHL 4PJGE 2WJ7A 4M7JH 2D07B 4TSCH 1G7LA 4OKVA 3UH8A 3U7DA 2HAZA 3LKNA 4MS8D 5CEZD 5G4MA 5F9OH 2V5SA 3PIQA 1U0QA 3ZQWA 2GW1A 1IC0A 1RZPA 2R2OA 3FT0A 5TE7L 3PTFC 1OM9A 3LEYL 2IU1A 3RL1B 4A2FA 1KJ2B 2IANA 2UXGA 3VACA 5IKCA 5DLMH 3Q5YA 3MREB 3C6EA 2X6MA 3KYKH 2QGBA 2XVGA 2YD0A 4EUPG 1SVCP 1WPCA 4R90H 1XTMA 5JORA 4C4VA 1NBZA 3GI8L 4DHLA 3BVUA 2IO3C 2PM7A 5IEHB 1A2YA 1KPUB 4KNUA 1UURA 3TV8A 3I3BA 5AKSA 3CQFA 1F6FB 2WZPA 3BKMH 4KRPD 1KCWA 4TTDC 4J3OD 1DTUA 2P5WA 2OZ4L 1U95B 4AQ8A 2ADIA 4YSOA 3I63C 2SODB 5KSVB 2ETWA 1CO1A 4U1IA 2VDMB 1JXJA 2G2NA 4F2ME 3LVEA 2EIZA 3UM0A 1NC4D 2DQDH 3BUBA 3MLTB 1AD9B 2OTPA 1Z9SA 4FQ1L 4TNWK 4U31A 5AB0A 3VD0A 3SPGA 4N4YB 1QO3B 1FD6A 1JPTL 4LCUB 2ZG3A 5EO1B 5ALCL 4FHBD 2LFIA 4PJFE 1AZVA 1U8OA 1YY9C 4R3SA 2WQWA 1OP3K 1UM4L 3VTAA 1KT2B 1L7YA 3DXKG 4ZSOA 3D87B 5H2BA 3VD1A 4KO7A 2OL3L 5AD0B 4BQCA 4PJXB 3OF6A 4JWUC 1FC1A 2BCMA 1IKFH 3LN5B 2JZPA 5BVPH 3IHYA 5I6OA 1EF1A 1U58B 5FWQA 2BSSB 5A16A 3OL2A 4HCIA 1OCZB 4UQ2B 3NSCA 3WS6C 3BRGC 2J0JA 4KRLB 4PR5A 2A99A 2JWZA 4HT1H 3JVZX 4JQIH 2BVOA 2CH8A 3Q8CA 4Z23A 1AH1A 1XEDA 2KXJA 3VA6A 2UZYB 4O2FA 1D7FA 4GFTB 1IUEA 2NY5L 3IFOA 4KDTC 4GKLA 4KOCA 1I9IL 2MQCA 5HVWA 1BXVA 4PJIF 2H6UA 4XHQA 1EHAA 3EOAB 1IGJB 3EZJB 1AXSB 4WNQA 4M7ZB 3K6IA 1S3RA 1OE1A 5AUKA 3A1QB 2WAQA 3NCJH 1CL7L 1H6KA 1DUZB 2DB8A 2GK0B 1JCRA 2YGOA 2WXKA 4G5ZH 1J8HE 2G0KA 1AZNA 4PJBB 4PRBB 4QAWA 4JRYA 2ISDA 2D03L 4I1MA 4LNBA 4JDVB 3QUMB 5DK2B 4K5MA 4RDQG 1DL7L 2Q76A 1JG9A 1LWRA 3LZFH 3BIBX 3IFPB 1W8EA 2H8PA 4XCFH 4FD0A 4EIUA 1BAFL 3DBLI 3P73A 3N9GL 3O4LB 2FQEA 5D2NE 4RFNC 5JIIA 1TTUA 1WIOA 4YO0B 1PYWD 3UBHA 1UT2A 4KK6D 1SLVA 3TUOA 4DP7X 3AU1B 4P4KA 1FRGH 1A4KB 2AEPL 2N56A 5DD0H 3VH8G 1S78D 1SA5A 5K5YA 3REWA 3PRMB 4MGYE 2HVKB 4KGJA 4TQEH 2BVPB 3GXNA 5G04J 1U41A 1KTLA 4TV3A 5E76A 3PNLB 2RHEA 3QIWB 4OQ1A 3T3MB 3GXUB 2Y6TE 4N1EA 5FIOA 3B9JA 4G7SB 1I31A 4NM8H 3LB6C 2KLSA 1F4WL 4OV6F 1VLXA 3OJDB 3AULA 3FH7A 4KHTL 5KN5B 3ZOAA 1RIUL 3FBKA 3L7EB 3MRNB 3SE8H 3JWDL 4OZCA 1EIBA 3HC0A 5DMIL 2EUWA 3BFQG 1INEL 4TUOA 4XRCB 4N2NA 2AK1L 3BUAA 1YRKA 1BZ9A 4RH4A 3CVHA 4KC3B 1DQDL 3OQRA 4RGOL 2JZZA 2Q20A 3QEGH 1IBGH 3S37H 1DBAH 1EYHA 2OXHB 2OMNA 3GEWB 5D70H 4I2WA 3SFEB 1DYQA 2AL6A 1DN2A 3VFOA 2ZX9A 2W9NA 5D2LA 2WWKT 2F74A 3T0AA 3O3AB 2CU1A 2R0WL 1T83C 1LK2A 2IEPA 4ZBJA 3W9EA 4MBOA 3X11A 3KJ6H 2KZTB 2GMIC 2FYYA 3G2TA 5BS0A 1IIIA 2D7MA 5JJ7A 2X0UA 4OM0H 3GS4A 1C5DA 3AE7B 5CO1A 2GJPA 4YGVA 2EAEA 1IC4L 3VFVB 3I2CH 3IFLH 1WR6E 4GU5A 2QSCL 4M5ZH 2DAJA 1IFHL 1BQSA 2GTQA 3O4OC 1FNGB 4H88L 4JRXB 1IIKA 3C5ZD 3KW7A 3A5VA 4IJTA 4LDEB 5C09E 3VM5A 4G1TA 2XWJA 1GC1H 3LS4L 1CXIA 5DJAB 3ZHKA 2WCSA 3EO9L 4XVOA 1K5WA 4PS3A 1UXSA 3QORD 5BW7C 4XP5H 1P1VA 3C98A 3H9SE 4XMLH 3FCUB 5IG7B 1A1MB 1A0QH 1YYMH 2C3XA 4WHTA 5BXUA 3EHNA 2R27A 5D72L 2QHOA 5DFVC 3TOPA 3ZL4L 3VFPA 2FLBT 4OUOA 1L0VB 4PJBF 1J5OL 2XCBA 3ZDTA 4PIRF 1NGQL 2LZ6A 3UO1L 3T0BA 1CS6A 2IYDB 2BB6A 3AEEB 3US1A 3ARGB 3UFIA 4J2XA 1JN6B 5JIQA 5C0AE 5GGRB 4TOYL 2W91A 3ARSA 1WF9A 2F37A 3A47A 4NT6B 3VYNA 2L0TB 4N22A 3KYNB 1ZKAA 3GMNB 3BD3A 1KBGH 1LO5A 4Z78A 3FU7A 3KCPB 4R4ND 2FEDC 4Y4KC 3WNLA 2JKIS 2XV6B 3M1CA 4KKJA 2F61A 5B39A 4U6YB 3T3MF 2Q3AA 1ZLUH 2GCYB 3LN9A 2GJ6E 5T1KB 2VDPL 4RBPK 2IDQA 3P9MB 2BINA 4NO5B 3RUGE 1B3IA 2HLFC 1JWSB 5F9WB 4LZKA 5J0BA 4IWPA 5D3IB 4YSZB 3CDYA 5ID1A 2PTTA 5GS3A 2LXCA 2F53B 4DEPB 1TVDA 4OCRH 3VJ6A 2C9AA 3BPLB 5D9SB 1ZOYB 1F3JA 3BH8A 3O6FB 4ZMVA 2FATH 2QSVA 1CFNA 1K4CA 1R24B 3MMEB 4IKLA 1FNEA 4P46B 1P5VA 2FEEL 4P9HL 1I4FB 3TCXA 4TVPE 4AV7A 2CRIA 1AN8A 3RZFA 3VI4A 3NACH 2B77A 3QVAA 1W16A 1GUAB 5EBLA 4KO9A 1G6RL 1QLEL 2BZ7A 2PKOA 3AU5A 1J8HD 1MIML 1IAMA 1BOGA 3VXUB 4FHKA 4A55A 1L4IA 1DBMH 5JOEA 4FFWC 3HZKA 3MV11 3WGVB 1FVHA 2IVFC 5LG1A 4MGIE 3Q7FA 1RIHL 1ID2A 4E5XA 5KVDH 5FV2A 2IO0B 4AS1A 4WURA 3QE5A 1J11A 3VW3L 2J5LC 3WXWH 4QO1A 5DEGA 5TF1H 3DXAB 4C0MA 1L9TA 4NN7B 2AP2A 1KY6A 4P57B 1QBML 2YAQA 2W9LA 4QRTA 2GJZB 3VMNA 1DJGA 3FRPG 1XHHA 5E8DH 3RVUD 3OZLA 1U8JA 1V1PA 2XZAL 3L3GA 4H1LA 1FH5H 4NZTL 2KZ1B 1YQVL 5ICXB 4Y2OB 4FEMA 3RBSA 3TWCL 3QIUA 1VA9A 4LLUB 4NKDA 1H6TA 1L3NA 2DWYA 3RWJB 4UNTA 1T04A 2C26A 3C6SB 3A33B 3KPMA 4LIQL 1PKQE 2ARJQ 5AZHA 3Q9PA 2OYMA 4TNVK 3Q4AB 4ONHA 2BUGA 3S98A 8FABA 4ZOAA 1U92A 2VZTA 1E7VA 1DLHB 2HN7A 3DV6B 2FH6A 5DHXB 1QNIA 1ZUD2 4I0PC 4TUKL 3MGBA 4P2YA 1E5BA 2N1TE 2WLKA 2YEQA 3N55A 3T8KA 1KCVL 4DX2A 2WP3O 2WVVA 3CVHH 3QULB 5JR1H 2O5ZL 3HIZA 3QAQA 1MWAL 3ABKB 5FW7A 4LK4A 3DX6B 3SY0B 4HPYH 5KTEL 4X5QA 4CN6A 4N20A 4F5CE 1C4AA 3VMOA 4QMEA 5B39B 1IKNA 1O9WA 2LHAA 5IOIA 1RZKL 3BRFA 2LSUA 4PV9B 5FX3A 2XZQL 5GGSY 3KUCB 1FG2A 1WH3A 2W60A 1GGCL 3TYFB 4Q58C 1GMIA 2DY2A 1ZLSL 1LD8A 3X12B 5C09D 2MCG1 3X14B 1DNPA 3HS0C 1MIEH 2P4AB 2KZRA 5EU3A 1SOQA 1YPZE 1DEEA 4ACTA 2IWFA 4ZMLA 3ZT6A 4F8LA 1EEUA 3PDGA 4OZBA 4EI5B 3H9SD 3B37A 3FK3A 4GTSA 3B9KC 3BG0B 4CADB 3F01A 1G7MB 1Q72H 3TJHD 4X4XB 2GG1A 4GRWH 3RKVA 1CCZA 3RGVC 3E8UL 1IBXA 2VC2L 3A6CH 1ROEA 1WZLA 4KXAA 1K3ZD 1E90A 2GFBB 3QDGB 3I57A 4HMDA 5HHME 1OGSA 4Y8DC 3UGBB 4MZRA 2IFUA 3KGUA 3IFNL 2UXTA 3S88L 2X4QB 2X05A 5FR3A 2GUOA 5LNEA 1ADQA 4GI6A 4LLDB 4XMWA 3D2UB 4NAMA 5C0AD 3T6ZA 5L4JA 4P99A 5I1DA 4PG2A 5JHBA 5CJOL 2EXWD 5HYSA 4KRMB 5IVNA 1UA3A 1WSPA 4QRRB 3CH1A 3GMRA 7PCYA 1MN4A 3IJSA 1LQBA 3ZU7B 3EOBA 4G0NB 1OGPA 4WI5A 2NCEA 3KWVA 2EDHA 3O3BA 3BKYL 2AEWA 2GJ6D 3MGTA 3VXSA 1FFOA 1KNOB 2KPWA 3Q2NA 2WSKA 4PY7B 5F7DB 3UM1A 3S4SG 4JFPA 1R19A 5LCVL 2BFGA 1HSAB 1J48A 5EU5A 3L3HB 3E2HC 4Y16A 5J4MA 2BNQE 3PHOA 4PS4H 3BZEB 4RGMC 4GPMA 1WGHA 1ETA1 1JWUB 3C09B 4KVNH 2HRHA 1QUPA 2NCNA 4TVPD 2X70B 1YEGH 4AYFA 3IMBA 3ARVA 4OT1L 1DVFB 3QC8B 4YDEA 4J8RB 2V9TA 4WQMA 3UTTB 2OQJA 3RNQA 1MJ8L 1WMHB 3VQMA 1B0WA 3LYYA 1DSWA 5DIZA 5KSBF 1IGFL 4HGKC 2KTFA 1QQDB 2AMUA 3D4GA 3BLBA 1O7VA 2VZSA 3TVMD 4QRBA 3QC1A 3LVTA 4UV7H 4DW2L 1VKXB 2YVCA 1IZKA 3TZVB 5I76A 3TBCA 4BCYA 1QOFA 5D2MC 5AVRB 5I66A 4XP9H 4XNZB 3AQZA 2ETAA 3AG1B 3TCLB 4A6QA 3O6ML 4GDLB 3DNKA 1MAKA 5F96H 2C60A 1XFPA 4DGIH 5C08E 3EDDA 3OKMB 3Q3GA 4UT6A 1YNTE 4BINA 1MJDA 4CSZA 4X6EA 3EOTH 2W1NA 1CGUA 1FM0D 3EH5B 3N40P 3H0TA 3LN4B 4BD4A 4AXWB 4LLAA 4QY8B 4PJ8B 4HS3B 4YHOH 4P4RA 4E42B 4I1OB 2AJZB 2LO6A 1FL6A 1J7VR 2JCCA 1OLZA 3L2LA 4NUJB 3QPXH 5HJ3B 3VD2A 4KGTA 3HXDA 1PZ3A 3UG3A 1T0NB 4G80B 4P5TD 4WJ5B 5GSRB 2X7LA 3RZCB 5FA3A 2OMVB 2OVFA 3P02A 3UINC 5JNYA 3I3NA 1FAIL 1WGRA 1OWNA 3ZYYX 2OHFA 3UX4A 1NAKL 3UMVA 2WVIA 2VDRH 2NDGA 2XXFA 4LL1A 4Q0XH 3KL3A 2DMKA 3MXVH 1IFRA 1EAQA 3F6IA 4ZK8A 2ZZUT 4PJEA 4DJMA 2KQ4X 5AVXB 1SBSL 4XE0A 1BJ1J 3DRTB 1OWOA 1X5BA 1P6FA 5I1LB 2KL6A 5IHLB 3AMZA 1BGXL 2XWCA 1O9ZA 4GMSL 4A2HA 4U1MA 3OG4B 5AQ9A 3SCMA 4CGUB 3QWPA 5I1GL 3RDTC 4L3EB 3NIFB 3VXMB 4D3CL 2R1YB 3T8MA 2B0SH 3W5NA 1E4WL 1N7ML 3WMSA 1NBVH 3VXTB 3ALWA 2G75B 1NSNL 2X10A 4U04A 3M7FB 4MWFB 4ABUA 5AJDA 1IAKA 4XMVA 1OF2A 3M8OL 3MC9A 1UD4A 2D7TL 4FP7A 3QI9B 3FONA 2MQJA 1WR1A 2EIKE 1I4QA 5DUPL 3Q8AA 1XIWB 3EYOB 3LKPB 5CGMA 4AL8L 1ELWA 5LXHA 4H4NA 1MREH 2DHZA 1S5IL 5EE0A 3ZQ9A 3T0EC 2ETBA 2Z93B 3MRJB 3MN8A 3QWQB 4HX1B 4QOKE 5J6HA 1XF5A 2G3ZA 1HXYA 1MJUL 3NK4A 4J8QA 5A23A 1GPOH 5HHMD 3S3CB 4BZ1A 2YGVA 1KYOJ 3ZDZB 2V7HB 4MLPA 4JM2C 5AAMA 1HC1A 2OSYA 2PCPA 1GJIA 1RJLB 4NNYA 3TXAA 4L3CA 1AGCA 5AAOA 3KXFB 3BEWA 3M07A 4OZGB 3EUUA 4MLIA 4OFPA 4UINH 2DL2A 1CZ8H 1ADQH 2W94A 2YLHA 2K6DB 4O1NA 2F7PA 3UKUG 3PZ1A 2AABL 2IGFL 3AITA 5IA7A 5FO9B 2FIDA 3QNKA 4I9EA 4LVNC 1D4BA 1ZHLA 1BZ8A 4QRQA 2ZKXA 4JJ5A 1NFIB 4JRLA 2OEWA 5F21B 3WIFA 2VTBA 4L8SC 4AYSA 5I0YA 1ZKHA 5E6NA 15C8L 2WKLA 1W80A 5KBKA 1IRAY 3OMZA 4EBAG 1KJVB 1P9MA 2LLNA 2OULB 4ODWB 4OFQA 3WN5C 1V55E 4J39A 4KSLC 4WFFE 3KDMB 3EZ8A 3STBA 4G1EA 3HC3L 3IHPC 2BNQD 4N2QA 3IS1X 4GIVA 4AUQC 1JMLA 2LLGA 3O2WL 5D7IB 3V6CB 2E27H 4BERA 3R8BB 2OV8A 4C59B 3DMMB 1ZE3D 4YXHH 5D6CA 4FXGA 3S5YA 3MBED 4LSPH 4FQHB 5KSUB 1AFVH 3LKRA 4QRPA 1LTXA 4HORA 4PGEB 3CFNA 5IBTL 3WU1A 1A5FL 1QBAA 4IDJL 1CLOL 1T0MB 2FT8A 4GFXA 1E27B 4POZC 3SKUD 3VWJD 2YGNA 4QHLA 4MTMA 3M6DA 3WKNA 1CJEA 1EZVY 3KPSB 2GI9A 4O4YH 2H6OA 5IHWA 5GRXG 3V9CA 1D8DA 4U1LB 4FKKA 4LAQL 5C7XL 3N44B 4YWGG 4LLYA 3KLQA 4BVUC 3QIJA 5T33L 2H0JA 2VITB 2ZOLB 4RSYA 3KR3H 4MXWL 5T1LD 4KKNA 1MXDA 1G0XA 2VRAA 3DVNA 5HGHB 2WQ8A 4BWRA 2LU7A 2O4EA 2F7OA 4ZQKB 1E6OH 3Q9UC 5C08D 1OB1B 2TAAA 2XVBA 4LSVH 1GGTA 4NB7A 3ZEFA 3WKPA 3L95B 1FXTB 5DVMA 2UZIL 3C3RA 4LSUL 4LJOB 3R66C 2VDQL 3JTTB 3HBZA 2KFKB 3U0WL 1ZCRA