2WXIA

The crystal structure of the murine class ia pi 3-kinase p110delta in complex with sw30.
Total Genus 276
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
276
sequence length
919
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVDCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title The P110D Structure: Mechanisms for Selectivity and Potency of New Pi(3)K Inhibitors
pubmed doi rcsb
source organism Mus musculus
total genus 276
structure length 815
sequence length 919
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 2wxiA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wxiA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2wxiA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wxiA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 2wxiA04
4PS7A 2X6HA 2FK9A 3T8MA 2NCEA 3B7YA 4FADA 1TJMA 3L4CA 4G11A 2NQ3A 2ENPA 2R83A 2WXGA 4Y1SA 4KITB 1YRKA 2WXLA 4A55A 3NZUA 4GB9A 4L23A 3QARA 2WXIA 4ICWA 1UOWA 3APFA 3ZIMA 2DMGA 3PS6A 1DJGA 1E8YA 2NSQA 3ENEA 1DJXA 4LDCA 4GNKB 3NZSA 1UGKA 2YOAA 4LT7A 2Q3XA 3QAQA 2KI6A 3KWTA 2CHDA 2ENQA 3TJPA 3PREA 5ENNA 1DJYA 3CSTA 3M7FB 1WFMA 4QJ4B 1RLWA 4IHBA 1DJWA 4XX5A 2K4AA 3OHMB 4FHJA 3FBKA 4UWHA 2X6JA 2K8MA 2Q0ZX 4F91B 4KZCA 3PYCA 3F04A 2UZPA 2CM5A 5CCGE 5KJ7E 4QAMB 4AJWA 3LJ3A 4URKA 4ICXA 2CJTA 2JQZA 1GMIA 4L2YA 3CSFA 4JPSA 4PH4B 4OVUA 1BCIA 5ANLA 2B3RA 5H4YA 1V27A 3MJWA 3QK0A 4HVBA 3P2BA 3TL5A 2D8KA 3L54A 4FLHA 3SD5A 1QASA 2K3HA 4F92B 1A25A 4WWNA 2CJSA 2QZ5A 3ZVVA 4FJZA 2CM6A 3NSJA 4EZJA 4F93B 2DMHA 3JZYA 4UWKA 3N5AA 1RH8A 4OYSA 4ANWA 3PRZA 2FJUB 1DQVA 4ANXA 1RSYA 3GPEA 3HIZA 3PFQA 1CJAA 3RDJA 3DPDA 2WXMA 2QZQA 3QR1A 3APDA 3R7RA 1UOVA 3HN8A 3DBSA 4WEEA 1E8XA 1E8WA 2V4LA 1BDYA 3TWYA 1E90A 1TJXA 1CJYA 1E8ZA 4NS0A 4NPJA 1DSYA 3RPBA 5G2NA 5G55A 4WAFA 4FA6A 3QJZA 1K5WA 3F05A 4FULA 3HHMA 4KZ0A 4TUUA 2WXPA 1DJIA 3KWUA 3APCA 2WXFA 3L13A 3ZW3A 2LHAA 2RD0A 2WXQA 2Y3AA 3IM1A 2Z0UA 3LS8A 4NPKA 5JHBA 3F01A 5CCHE 4Y1TA 2A4ZA 2WXOA 2ISDA 5T8IA 4UWFA 2I9CA 2A5UA 3OAWA 4L1BA 4DK5A 2X6FA 4HLEA 1QATA 1WFJA 2BWQA 2WXHA 4WWOA 2ENJA 4QJ5B 4ANVA 4J6IA 3S2AA 4FHKA 2X38A 4BFRA 4PS8A 4PS3A 4AOFA 4MJJA 5H4ZA 4F1SA 1DJHA 2EP6A 3F00A 2CHWA 2CHZA 3ML9A 4EZKA 2YRBA 3W57A 4XE0A 3ML8A 2CHXA 4IQHA 2WXNA 3FDWA 1DJZA 3IHYA 3L17A 4EZLA 5JHAA 4V11A 2N1TE 3L9BA 4FJYA 2X6KA 2WXKA 2WXRA 4OVVA 3W56A 1E7UA 1W15A 4UWLA 4LCVA 1BYNA 4TV3A 4ANUA 4BGDA 4DNLA 2K45A 2ZKMX 4TS6A 1HE8A 4QJ3B 4L1LA 3QR0A 5CCJA 3L16A 1E7VA 2X6IA 3IBEA 3L08A 1W16A 4WWPA 4XZ4A 3R7QA 4UWGA 4NP9A 5EDSA 2WXJA
chains in the Genus database with same CATH superfamily
5KSUA 3R0NA 5IBLC 3WE1A 3H4FA 3P9MB 2CKBB 3KYOB 2X7LA 2ZOTA 3QJFB 4KTDL 5IJKC 4HKXA 2XENA 2HWZH 3V6FB 4F57L 1JWSB 1WZKA 1V9JA 3ZGQA 2MPVA 4OZGA 3S3BB 4GTRA 4K7FA 1QWHA 4M0WB 3MTXA 1FVHA 4O02H 1I85C 4Z3HA 3B8SA 1N5XA 3ROOA 5FHAL 2FO8A 3SE9H 2Q3XA 3JWOC 3UP6A 5BMHA 3B2VH 3C75A 3ULUD 3TBWB 1TPXB 3DGDA 2Z91A 5J2RA 5I74B 2WQRA 2OBGA 1H0DB 1B6UA 3OZLA 3WFBL 5CMAB 5K9QI 2RR9A 3MRCA 2KHAA 4EUPB 1E9MA 4HX1B 4WEMB 1ZKHA 1ILSA 2VZUA 1XF5A 3P54A 4GAJH 4UU9B 5C07B 3IKOB 1ZBPA 1WBZA 1WFTA 2KQ7A 3GJFB 4U1NB 1RV6X 3CDGB 2Z8WC 3KH3A 5CGTA 2FCBA 4PBDA 5D2NA 5DR5L 2X05A 1LGRA 1RFAA 2QSCH 1AD0B 4KKIA 4BQCA 1Z9PA 3UXFA 5GRZA 3STLB 1ZGUB 1RJLA 1OAYL 4TQ1A 2DQDL 2DZNA 2RFXB 5GGUB 3FSVA 3EBGA 3THMH 3VXRE 3DSWA 5JDJA 4NNJB 3R4DA 1D5XC 4FFWC 1INZA 1G9MH 4HK3J 1X5MA 3W9EA 4R7DB 2L7QA 1YEJL 1A64A 1A0QH 2CGYA 5CIPH 1BM3L 4JM2B 4WW2B 3RPBA 3A9KA 5GJSL 3WFDL 1XNFA 3PJSA 2BKKB 1KXQA 2CXKA 3I3DA 1MLBA 3LIZH 2CJUH 3STBA 4DZ8B 2WWZA 2FATL 3HNVH 2QY7A 1YEIL 1T0SC 4NUGL 4JFYB 3W0WA 2ESVA 1OAZH 4YN3A 2KPWA 4ODSL 4K7SA 1NTDA 4AH2A 2NUPA 4GTOA 1QATA 1N8ZA 2EC9T 2W9DH 5BXFB 4CMHB 1AGEB 1LNUB 2L7UA 3DHJA 3BRFA 2RSUA 1UUPA 4BSZB 1AGFA 1RJCA 2ZX9A 3ZNZB 3ZO9A 3BP7B 1S6NA 2HN7B 3I3NA 1AWCB 1IKFH 5ESAB 4PMEA 4HCPB 3IHVA 3FB7A 4GYWA 4W4OA 4W9FA 5FO9A 1EDHA 3I6KB 3V05A 4XB8A 5AB2A 3KUZA 1T1WA 4HPOH 3N9GH 4TNWK 4QUOA 3C5SA 5BOPA 4LEXL 3EHVA 3BH8B 4O2CB 1PEWA 4LAJH 1E4HA 2Q1EA 3VQ2C 3WJLA 1HE8A 4AM0A 1STEA 3L4VA 1R46A 5CFHA 1MG8A 2IDUA 2X6UA 4G2VA 2OEWA 1E5UI 2A0LD 2FNBA 3Q5OA 2QQLH 1RZ8B 1L7IL 2ENPA 4QTHA 2QL1A 3ASFA 2IJ0C 1QFWH 4J3XA 1OQXA 2CHNA 3D9PA 3K8LA 1NFKA 2XWBB 4XNMB 5E2VH 4FRWA 2X6VA 3F12A 1X9LA 4IOIE 1OZUA 1ZTMA 4MMYB 3GZPA 4RZCA 2WDRB 4Y19E 4WHYG 4DQOL 1C5BH 2LSVA 5AUMB 4BCXA 4LPUA 2ILRA 3BD3A 4BFKA 1AQ8A 1N94A 3IMTA 4DP4X 1L5GA 1TEGA 1MREH 5I75C 2BNQD 1ZD6A 1AR1B 3BDYH 4JY4A 3UJTL 4UQ3B 5G5GA 1T21B 1KYUA 2Q20A 4OZGE 4BWRA 2D5GA 2QFPA 1XCQL 3V4VA 4NQXB 5DBKA 5KANI 4X4XB 1MCOH 1U8IA 4YAQB 3BE1L 3UYRH 2XRZA 4FLHA 3SD5A 2X4TB 4XGZB 1TEYA 1HCVA 1O1TA 3ZVVA 1Q0EA 2FBJH 4GO9A 4JL2A 2BOLA 5FKAB 4UQEA 3U2SC 2VMFA 2Y07L 4A7GA 4NO5B 3ULUH 4WFEE 5FOJA 2CG2A 3A6BH 3I9GL 1NZNA 4BFIB 5I18L 2C7UA 3GMOB 2Q6WA 5IMMB 5F7DB 4KHXH 4X4YB 4ODTL 1GUAB 1NGYB 3ARUA 4O4YL 4A6YH 4MA3A 3KUDB 1PZCA 4JREB 4NKIH 4DPAX 4HLLA 2NY1C 3UQBA 5D2NE 5JHMA 3VRJA 1A21A 1OALA 5D1XB 2W91A 1P4IL 2K78A 4H1LG 3Q75A 2JVCA 1U3DA 5GISL 4WUUB 2HFEB 2HKFH 4U6XB 1HNYA 3AEGB 2IV9A 3HCVB 5HHXH 5KVMC 3LX9A 1T6WA 3SO5A 3SBPA 1MAMH 4KDVA 4PRBA 4XBEH 7PCYA 2W81C 1TPXC 3WTYA 5IR1B 2J4WL 3MV01 1A6TA 2JJWA 4XWGL 4HOQA 4HWIB 3U6XA 1R3KB 4XVJH 2NOYA 3NOGD 4BZ2H 1A7NL 2K3TA 1S63A 2XIDA 4J3VA 2JWUA 1EYHA 1KXQE 3TVMB 4TYUA 1IQWL 1DQLL 3MRBA 4XE0A 5EO0B 1KRHA 2N9XA 4JFFA 2W38A 2D3CA 1QPKA 5EPMB 3WIHL 4P2RD 3WYRA 3ARGB 2NCMA 5L0QC 1DVYA 3W0WE 2ESVE 2VNCA 1JYNA 4I1AA 2LXCA 1YQ4B 3N1FC 4HHAB 2BVPB 2Y69E 3FZUC 4OJFL 5JW4N 1HO8A 4JCWA 5FHBH 3MROA 1DCLA 1EBPA 3E34A 1L9OA 3IV0A 1S9XA 4M6MH 1XO3A 3ZTCA 5DS8A 4L4VB 2ARJB 1BYOA 3QCVL 4QNPF 3O6KL 4MGXA 3PV7A 4PBVC 4N2KA 3FN0H 3C2AH 3FB5B 2L52A 2BK8A 3WN5A 3GB7B 4WW2C 1KPUA 4XPGH 1JF1A 2BTEA 1F4XH 4YLBA 3RQ3A 3QFJD 5KN5B 1UOWA 3JV6A 2VRAA 2X12A 4QRRD 5G5DA 2EECA 5I17A 4RRPG 3BHBA 1VGEH 4CGWA 3QXDA 3FO2B 4PMFA 5F7AA 4DPCX 5JNYB 2ZYRA 4XCYA 5H37G 3OKYA 1JWFA 3VXNB 2BNQA 3WBDA 4GSUA 3L9TA 3WO4B 4PGBA 3CDYA 3NJLA 3A6CH 3TN0B 3GK8H 1JPGA 4TL4A 4I0PD 5IW1A 5F7NC 4G80B 3QNZA 4MXVF 3ZUNC 5AG8A 1RZGA 1BV8A 3LNIA 4ETQB 1INEH 1SZNA 3I84A 4YHIA 1Y0LB 4MJHA 4BZ1H 3IDUA 3H1ZA 3QIUA 3ZJTA 3LKRA 3SDCB 3DGGA 3Q3GB 4LSUH 5C0AD 3VH8G 3MV2B 2QKIB 3LRKA 1NBYB 2ZSVA 5J1AA 4LKXA 2IO3B 3C19A 3APNA 3V55A 4C00A 2E5EA 2R0ZL 4ILDA 4WK4B 3M1OA 3SCMB 1T0YA 2BP8A 3B37A 5EBMB 2CRZA 2A83A 1A9BB 3ARBD 3QOUA 3DO7A 3WXWL 2V37A 4DXGA 4O6FA 2JSFA 2ZXGA 5ENOD 5B1JA 3G5YA 1A1NA 4RH4A 2XEVA 4MKMA 5CECB 5BO1L 4GAAA 1KN2H 1MFCL 5I8KH 4V1DD 1FFRA 4FQ1H 2AQNA 1F56A 3VWJA 3AMZA 4U6VH 3FONB 4GDKA 1KTKA 3FPXA 4XPFL 3F5WA 4BKLA 1SBBB 2BS3B 2Y3NA 3KYKL 5I28A 1SLXA 1C1YB 5D6CB 1DBBH 2UXGA 2GITB 3T2QA 3QNXB 1HYRC 2EEAA 4N5CA 2JIXA 3IS0X 3GTVA 4OZHA 5C9JB 2NY2B 4CQNA 2FCMA 5ESQA 1GHFH 1EVTC 2CAKA 4H88H 5ADOL 4DX5D 1MH5A 2QPDB 3BUAA 3O6LH 4LNGA 4A2GA 1A4JB 1IPGA 1WIAA 3E8UH 2OJ1A 2YAOA 2FBWB 5HHNA 2D0GA 1E4WH 2J73A 1AC6A 1LWHA 4JK0D 1R3IH 4DSYA 3VXTA 1JN6B 3KPMA 1AR1C 3RLSA 1UT2A 3P4NB 5I0WA 2F5BH 3LDZA 4ZFZA 4NC1C 4EBAG 2P9RA 2OA9A 2JRHA 2W60A 3Q05A 4FQIH 1KTCA 2JE8A 1QVOB 2F8OA 4OTXH 1Z9MA 4MGZE 3TXMA 4IS6B 1S3SG 3NZHH 4IBVA 4UQXA 4FQHB 4GS7B 3PDOB 1NFDB 3W56A 1N0XH 4XVTH 2Q10A 1UM5H 2JK5A 3Q9PA 2QC8A 3MBWA 1ZGLB 5FKAC 2GUOA 4G8IA 4NQKE 1T89C 1TMCB 4NO2B 1G7IB 3LNGA 1Q0YL 3VXWA 1FYTD 3JWOH 3QR0A 4NZ8A 4DO6A 2F15A 3IBEA 2NBUA 2FK9A 3SPVB 3CVNA 4G6AD 4JFFE 2P8LB 2WQWA 4K7PL 3QFJA 3ZKJC 4NPYB 4QRRA 3NFPA 3M95A 3V3XA 1OQQA 2GSMB 2VUYA 4XEIG 2IG2L 1JGUH 2IH3A 4OGZA 2AKRB 5I66B 5D1XC 1T6VN 3B3IB 4I87A 3WXXA 1TQVA 4S1RH 1A9VA 2YARA 3CK7A 2IO1B 4BY6A 5DC2A 3BVMA 2EH7L 5D6DA 1FAIL 2HLAA 3L2NA 4ZPVB 2L6JA 3R18A 3W1SC 4I0PA 2B4CC 5CCKH 2GRPB 1SDDB 2X89D 3IFLL 2RG8A 1F4WL 2PM7A 3EOTH 3HRPA 1WFMA 3CDCA 1BJ1H 1A1MB 4YXHH 5AW8B 4J7RA 4P5TD 2HPTA 4KZCA 4H7XA 3TVMC 3VX0A 3LJ3A 4RMSA 2DZKA 2Z35A 2BO0A 4WY7H 3T8XA 4MRBA 5T5FL 3ARBA 3ARXA 5GGVL 5T1MB 1L0XA 1ZHKB 3ARGC 3BAJA 1E40A 4X42A 3HR6A 2BNQE 5DEGB 2BH0A 3Q9NC 1JPEA 4N0UA 1IAIM 3VUWA 2P2CP 2CO3A 5C07D 4JX1C 2GVYA 3GEWB 3O6FA 4F9PC 4LMQE 3NVWA 1E27A 4V1DA 5GS1A 1FNEA 4F8NA 1GY2A 1PCSA 1W72A 3FZUD 4ZYKA 2H6UA 1A6ZA 2A9DA 1JRPA 1I3UA 2HJLA 4HETA 4XTRD 3BLBA 2YGPA 1O1RA 3O2WL 3P77A 3OF6D 4F7KA 3F05A 3O13A 3OKNA 4QRTB 3N91A 4JM2D 3ULVE 2NPTA 2WXQA 1M2OA 2ZOKB 4Z7AA 2DWQA 3RU8L 1L9QA 2E27H 2C8NA 1UWGL 3QQ4B 4RH6A 3AS4A 1GGBH 2XICA 1JP5A 4HWZA 3WO4C 1Q1OA 4X9BA 1FGNL 2AEOA 1KGIA 4XWWA 2KVRA 1KTKE 4K3EH 2J5LC 5I73C 3EYFA 1D9KB 1ASQA 4AGNA 4BD4A 3BEWA 2OI9C 5C6PB 1F90L 3UO8B 1W72H 5DHYB 5TE6L 1MI5D 1T80A 4PRDA 4OZHE 1VB9A 3W57A 2KLRA 2M83A 3LKPA 2KANA 2IO3C 1GGCH 3LZFL 5C8JA 1ED3A 1I9JL 1KTDB 1FORL 4RISL 4DEUA 1E9PB 3SCMC 2VE6B 1AP7A 1TNUA 3HZKB 1KWKA 2EIME 1JPTL 5IKCM 4GXVL 3DHPA 3OKLB 4MSWB 1SXBA 4FP8H 3HC0B 3VW3H 1IHGA 3ONKA 1XB6A 2OOBB 1IM3A 4PJ9A 5F44A 3LDZE 1KXHA 1YN7B 2H3KA 1TZGH 5GGSA 3TM6A 1P4LA 4JO4L 5D7EA 4BRJA 2N7AA 1NCBL 2FO1A 1ORQA 2VDLH 3K0YA 1G0DA 4OD2A 4RFOH 1AP2A 1WUZA 2ICEA 5EOQH 1TYJA 2CO6B 2DTSA 4P5KB 4WV1B 5L4FA 1RURL 1MZZA 2X10A 3U0TB 1YC7A 2CRMA 2EIKE 1UD8A 1OAXL 3IPBA 4HIJA 4I13B 4OKDA 1OWPA 3PS6A 3CV0A 4L8BB 3VG0H 4A39A 1BP3B 2NY2C 1Y18B 3WDJA 2WVTA 3A4SC 4LDOB 3MKGA 3UZVA 4PLJC 4UT7L 4PJ7A 4U1KB 1FL3B 2R1YB 4LNRA 1B2YA 4JL0A 4XI0A 3T0EB 1T1ZA 1A14L 4AV5A 4P5TA 3WOVA 3QFJE 4G6KH 2C9RA 3MR9A 5I82A 4IRUA 4QRRE 3LKOA 2DD8H 3F83A 2OSYA 3R9AB 1MCPH 2PPAA 3T0VA 5AYTA 4IBWA 4LLYA 4DP2X 1WFIA 1K1AA 4YZWA 3VXSA 2RBLA 2REXA 3G04A 4QHNA 4X7SH 2HTME 1DUZA 3RN9C 2R1WB 3QJUB 3V52L 2OCCB 4AM0Q 2LQRA 3EYQD 3VDAA 5B4MC 3FFDB 1MIML 3JUYA 4MD5A 5JH5C 4GA1A 4HRMB 5AW3B 1IBHA 4PGDA 2KCVA 1KBVA 2I7OA 3HNTH 1IEBA 4G9DB 2QDFA 2VDKL 1RSYA 1KIUA 1YNKL 3KPTA 4X5WB 5CU9A 1MJ7H 4ZS7H 3W9FA 1E4XL 5AB0A 4DP1X 3QDNA 2AV1A 2VR7A 4FFYH 3MC0B 4NJ6A 5DEJA 3CFUA 4XCFL 1JWMB 4B53A 4X6BB 4A2LA 2HD5B 3PDNA 2ITCA 3SBRA 3VYOA 1B0RB 1GOZA 3DVGY 3Q43A 3AI5A 4Q74A 4N0UE 3ZU8A 3LIUA 1IC5L 1BBJB 4HUVB 1E50A 2BLFA 4EUPH 2KJRA 1JZGA 1ZEAH 3V5HA 1KIQA 1PLGH 2FJSA 1MNUH 4V1DE 1TVBA 5LJYH 2EADA 5ETUB 1NA8A 1U8CB 2D7TH 4JAMA 5JPNA 3SHSA 5E6NA 3GJFH 2JQRB 4DI3A 3DGCR 4RAVB 4XMVA 2GT9B 3ZN3A 3B13A 4Y2DD 4WUUD 2L9BA 4ALAC 5T3ZL 4LK4A 1U21A 1MI5A 1HF8A 4HAGA 4WJOA 3IDJA 1H4RA 4JA9A 1T7WA 3BZEA 3DVNA 4IG7B 1GIGH 4LRNH 4UZSA 2GBJA 4P9HC 2DDQH 3L5IA 3ML8A 5I19H 2WPVA 2VXTL 5D71H 3FRPG 5FK9A 2B0SH 1SE3A 3FH5A 1OIOA 1SLUA 3AS5A 4LSTL 3MKQA 1I1CA 2H5UA 4I9WD 4ZUVB 3TX4A 2JLPA 2HYMA 5M72A 1N64L 2WQ6A 2AI0L 4UWLA 3G6JF 4DX7D 3IRZA 3SPGA 4Z3GA 1NANH 4YTPB 4P3DA 4B9ZA 1CFVH 4M43L 2MQJA 1URZA 5J7CC 3II2A 4MA8L 1ET6A 1CIUA 3C8HA 3KG5A 5DD0H 2F53B 5A1AA 3VAEA 3INOA 1ACYH 3D1MC 4GPVA 2DYPA 3QORC 3TEYA 1RLFA 3F62A 3QZLA 3ARSA 2Y2TA 4APFA 1DVFB 4CBPA 3LMJL 3LRSA 3VFSA 1OW0C 1FFUA 2IPTH 1YVLA 4WF7A 4GMSH 4QXGL 3N55A 2Y5QA 4FHBD 2DM4A 3DWGC 2DRUA 4JFWA 2E74C 4GKLA 3US1A 5BZWB 3LZNA 1FL5A 2BOBA 2Q2LA 2YMXL 4JO8A 4MAUL 4YVUA 1WGOA 4KKRA 3UM3A 3RWCB 5HHOA 1Q10A 3LYAA 1UZ6E 3BPLB 1QRKA 4RMQA 4YSAA 1F00I 3F6JA 2FO1E 3MRKA 3NIGF 4AWJA 2AXFB 4X83A 3WEMA 3FTGB 1IX2A 1F0ZA 3Q1SL 5CINH 4IGBA 4IU2A 2NBWB 1PG7W 1HZHL 4GU2A 1D9KC 3JYCA 5FT9A 3RPIB 5JORB 3HZVA 5IQ9B 1PBYA 4HLZH 3FH8A 3TN0D 4YS4A 3VRBB 2AQ2B 3SHQA 2YO3A 1C79A 1OCCE 3QG7L 3VXMD 2XV6B 1Z5YD 3B7RL 3WSQH 2O6VD 4MDIA 1QFPA 2J6EA 2WAHA 3MNWA 4KO5A 2IBIB 2XQYG 3VFNB 3GBNL 3BG0B 1OTSD 5J06A 4JPVL 4PJ7E 3SDCD 3R0MA 1BGXH 2XBTA 1NGWA 4I48A 1CF8H 3VFKA 2FX8L 1OV8A 2FLRT 2XKNA 3BVWA 3GI9H 3OAUL 4B9YA 4E41D 2P42B 4U0UA 3SCMD 1CF1A 4GTTA 3L95B 5DHMC 4EI5B 2GBKA 5I1CH 3M46A 2BHFA 2A6KA 4GLSC 4K5AB 3VU1A 1RUQH 2ZX8A 2IONA 5LDSA 1DP0A 1T0PB 5E6OA 3F3HA 2VR4A 4HJKA 3VXSE 5EC2B 1KEGL 3JTSA 3MV11 1RJYB 1U30A 4WV1C 1E90A 2BWES 1SOQA 1VFOA 3IMUA 2PTTA 3H8NA 1PAZA 3DLQR 2C5DC 5BJTA 5FYLD 3RL1B 2D7MA 1BQLL 3E8VA 5EZPA 2J6EH 2VN3A 3SDDB 2J1KA 4JW3A 4L8DB 1I35A 1OT1A 4I3SL 4Y2DA 3ZZLA 5L4IA 1GYWA 5I5IA 5CZVH 1PY9A 3TURA 5B1AE 1U33A 3II1A 3T0EC 2FAZA 4NHUB 1X44A 1AXSB 3QUKA 3ZJUA 2XWDA 4UUJA 3S36X 5AW4B 2A9CA 5DRXB 1SW6A 2OSLB 3H55A 3KBFA 5CEZH 5FB8B 4B8CB 4FZ8H 1XH0A 3OR6A 4UB0L 1B0IA 3Q79A 3RVVD 5HGDA 2KZRA 5FCSH 5AG9A 1IYGA 3IMRA 4P57B 2WY3B 4WAAA 1S7RB 2IOLA 1EX0A 4JRXD 5FO7A 5J13C 2XSKA 1S5HB 1PGXA 2K6ZA 3FJTA 1J1OH 2E56A 5SWZA 2F74A 3EF7A 2PKDA 2P45B 4JRLA 4EUTA 4J8FA 2YPVA 1MI5E 1F6LL 4A38A 5E99L 2GRNB 5KVDL 3RDTB 4AIEA 2EIZA 1BAFH 2FEEL 3C2SA 3PGDA 3B2UD 4KZDH 2W55A 1E7VA 2VABB 5LGHL 3L08A 4ZO9A 5DQDH 3S8WA 1NPUA 4A7TA 2NTFB 1T0NB 2R23A 4K9EL 2R4SH 1BSIA 4MCMA 1XGRA 1PQZA 1U8HB 4G8EA 4BHUA 3V0HA 1W91A 4NZJA 2MCNB 1E30A 1ZB1A 1KLFB 1NJ9B 2YS4A 3BKYH 3VUXA 4L0YA 1DJXA 4UZUA 1I1YB 5DD1H 1P0RA 5TR5A 3DSSA 4IDLA 3F2LA 1JGEA 3ZBMA 4E5XG 4UT6A 4PRIB 2YPVH 2VERN 3NH7H 1A5FH 3ZDXE 1RKRA 1NLBL 4LQFL 4PJGB 2QPSA 3TZVD 4A04A 4GMTH 3VXMA 3I50L 3ZLQC 3MCG1 5IWLC 2O6VA 3UAJC 1MWAB 1YEEL 1CBVH 2QGCA 1I3GH 2FYYB 2XY1A 3SE8H 2WD0A 1G1CA 4NQVA 4URKA 4KQ4H 1MELA 1VCBA 4XMZA 4NURA 2KDGA 5HHOE 4LLQA 1HXIA 2QR0A 4PSPA 2WOBA 4ETYA 4E41A 2JY6A 4JFPA 4JKKA 4GQ9L 2YGOA 1YEKH 4UM8B 5C0BA 2V5QC 3GC3A 5D7IA 1BFOB 2SEBB 4OAVB 2WCGA 3HE6B 4P48A 3W5UB 1DQQB 1EXUB 4CUCA 4DGWC 5HVFB 2F8XC 2EIBA 3BWSA 3BZFB 3K5SA 2V5SA 3QS2A 2EIJE 4JLRB 5KSAA 3RCZA 1P6AB 1L9PA 4XP4H 4ZO8A 5L4MA 3JXAA 3VD5A 5MP6L 3HN8A 1DVFC 2CLZA 5EORH 3PRPB 2H8PA 4JFDB 2PWFA 4CVZA 2DBJA 1H8LA 2A74B 3N43F 3COOA 4YDKH 4ZNCD 1AXIB 4HGWA 1UB5A 5IB1B 2W5PA 5CSGA 4PJIF 3CMOL 4DH2A 4TXPA 1CLVA 5BS0B 4QXUH 3PGEA 1A5RA 3WFEH 4NUQA 3GYRA 3CFKB 3PHOA 2J4XA 2Z8SA 3BPLC 4HIXH 1BT0A 2K9XA 3MLUH 2WINA 3ZYOA 1QSZA 3D07A 4YXKH 2ATKA 4PGJA 2NR6D 3MX3A 4FCHA 3DVNV 5F7EL 1HYSD 4RA0C 3IXTB 1KLUA 4J3UA 3GRBA 4WU5B 1UOLA 1JZDC 3V4UL 3PP4H 3UTMA 3AG4E 3AB0B 2X6AA 3GZOA 4AEIL 3VFOA 2Q5BA 2XGSA 1KELH 2YRBA 4JRXA 4HS6A 3IXEA 1W6WA 1FZJB 4MD0B 4Y89A 5FYLH 4FQXD 2NPLX 1K50A 2GBNA 5FOBB 3CVPA 1MEXH 1NCUA 4HRNA 4MH8A 4F8PA 5EFIB 4JKWA 4NN7B 1EXHA 1TQTA 1U8NA 2ZCZA 3VLEA 3C5ZB 4K3CA 2PXYA 1SHMA 2OX5A 2F61A 4KOCA 2XFXB 4RETB 1ZSDB 1QO3B 3FFCB 4HEPG 1P0SE 2OMWA 3V61A 4S0TD 3ZFWA 3OPZL 4LOVA 3FF8A 3CVIH 1WPCA 3ARDD 2E9GA 4I9WE 3OKDA 1JZHA 2G3XA 4PS7A 3I2CL 1QLFA 2OTWB 2VSMB 3DDFA 1K6QH 5LCVA 4CMMA 4K5NA 3HB3B 4ZBJA 4C80A 3NJGA 3CN1A 3MO1B 4NHCL 1MW2A 5SWZE 4CGTA 5IY5B 1UWXK 3MCXA 3OTNA 1HG2A 4OGXH 1CGTA 2KERA 3IF1A 4IDJH 4TUKH 2NY4D 3SDDC 1J0ZA 2WN2A 3V6OA 1HSBA 4U1LA 3CE1A 3BVUA 1XBDA 3HG1A 1OP4A 3N9YC 1TJGL 1I4FA 4JG1H 3VDZA 2DNFA 1HH9A 3TZVA 2G75B 3PREA 4QEGA 5IW6B 3PT2B 1H8CA 3CLFH 5GZNA 3CHXA 2EINB 2IADB 4NRXB 1LO4L 3ATDA 3X1EA 4RIRA 3EBAA 1B4JH 3FRUB 3SFYA 2R7EA 1XXFC 5G4NA 3TGOA 2CGZA 1SJED 5BW7A 3Q69A 4AIOA 3TBSA 2C1OB 1QTSA 4PJBB 3CKCA 3PHQB 4N8VA 2MCPH 5D2MC 2WBJA 1A2YA 2VW7A 3ABLB 4NP4H 3CK0H 4R90L 5LCVH 5CN3A 1ZOYB 1QYMA 5AVZB 1XHHA 3KJ6L 3NEXA 1V27A 2FSDA 1C16B 3QVAA 5EU4A 2YNQA 3VCLA 1FZOA 3L45A 3UG4A 2YPKB 5D7GA 4FU3A 1M7IB 3CVHB 3EJYD 4P2CG 3CPLA 2AMUA 1I8LA 3VXME 1XD3B 3Q1EA 3GMQA 4JFEA 1OARH 1U0QA 4J3SA 2W9LA 2P26A 4G42A 3TH2T 3JV5A 1MIEL 4HJGA 3WDIA 4AENA 5K5YA 3BQVA 4D9RE 2MJDA 4Y4KB 1M6OB 4W9KC 3HMXH 1VJSA 1AH1A 2YQGA 3DXKG 3WKML 1TQSA 3VQ1C 4P5SA 3Q7JA 4E41E 5H94B 3K80A 3N04A 5JQ6L 1P5UB 5DCNA 4ILHB 3JVFC 5C0BE 2YXMA 5D7IE 3DO4A 4KPHL 3JQ0A 5TFSH 4HV8B 3C60B 4G8GB 4X6FB 2IYDB 3OQRA 2ZXWE 3HNSH 4NZLB 1SXZA 3JQOB 3WJMB 1RZPA 2BKGA 6PAZA 3UTQB 1M7DB 5FYLE 2HB0A 1KZPA 3ZKMC 2A1WH 3CFEB 3A1QB 2DN7A 2P9SG 2G0LA 4TOYH 1KTLA 5CCMA 2HTHA 1BPOA 2I27N 5CKGA 4FQXA 2VIRB 4WUYA 4P1BC 3DVGB 3FT3B 3X13A 1U8PA 5AZEH 2KFJA 1U93A 3HLKA 1ADWA 3BAKA 4J4PA 2Y36H 1MHPH 5HY9A 1GSMA 2Y7OA 1T0RC 2GQHA 2INNE 3VTXA 1NFAA 1BYNA 1MHHB 4FI8A 4M8QB 1IU1A 2DQJL 1NGXA 5D7JB 5IHZB 4Z68A 3HE6C 3ARDA 2PW9A 4AEZC 1EEQA 1IC7L 5FUCC 1JV2B 1S5IL 2PKOA 2W80C 4DDID 4JRXE 1J8SA 1IQDA 3QS3A 4ELDA 3UIZA 4DP8X 1TKGA 1WFUA 3ULSA 3GUTA 4IWQA 3QQNA 3T8MA 2GSIB 2F53D 4HJJH 1J11A 2N7JA 4YC2B 1N4XH 4UIMB 4AUQC 1EHXA 4AYDC 4J3BA 4R4ND 1BG1A 3ESVF 4O02L 1EHLH 4QRFA 4MJID 3ULAB 1CBJA 3MBEB 5ICYB 4W9JC 3LSOB 1M7XA 1OCOB 2YKKA 3QI9B 4WHTA 2Q7YB 4HEMA 1BBDH 3O4ZA 2KI6A 2G3QB 1TT5B 1U92B 2WQ8A 3M62B 3TLRA 3GSRB 1BIHA 1H6EA 1SJEA 4GUPA 2EDWA 1NUDA 2JF1A 3IU3A 3WXVH 1TS2A 4FOMA 4I8DA 1HOCA 2JLLA 5JZ7C 4G6MH 4WKZB 1YNTA 1TNZA 2X6BA 1ZK5A 2FQGA 3Q5TA 4KJWD 4TLUA 4GAJL 1UURA 2KBGA 4LSQH 2TRHA 1XEEA 3JYUA 4LNBA 3LZOA 4KUZH 2ZX5A 3O4LD 3V6OE 5C3LD 4ONGH 3HG1E 1VLBA 3SKOB 1P6WA 4QKTA 3Q0HA 1D6EB 5H4YA 2H6FA 2YXVA 2QSCL 1HE7A 4PJDF 4LVEA 3L54A 2X1QA 4ZJ9A 3S5ZA 1GOFA 3O9WA 3GBLA 5CJ8A 3ZRFC 5KSBA 4N87A 3L1OH 1R5IB 4G5AA 4NN7C 3C5ZC 1W0YT 4ASWC 2QFRA 2JI3A 4JRYB 3AC0A 2FWUA 2BCKB 4MS8C 3V30A 5DVLA 1NUNB 2WMPA 3QJRB 4FD0A 2Z65C 1NA3A 4H8PA 1NLDH 3FTZA 5LBSA 2VMCA 1V3JA 4W4NA 4XO9A 2H6PB 2JJVA 4EI5D 1A0QL 1J88A 3O4OB 1WYWB 1XGQA 2X4QA 3DVNU 3ES6B 4ZYNA 4RG9A 2VLKB 3HB3C 3T6XA 4G1MB 1G7HA 1WXMA 3B5HA 5EZOH 3X14B 2G9HB 2BSSA 1E3FA 2YEVB 4JEUA 4NBYB 2CJUL 4GP4B 3HXEA 1NDMB 1LEKB 2Y1ZA 2JH2A 1EFQA 1TTGA 2V17H 4QRSB 4JFEE 5D96B 3QO1A 4DXAB 3MYZA 4HJGE 1B4RA 4KDWA 4WJG3 2J5WA 2W9DL 2LFIA 4FQ2L 2FO4B 3N1PC 4NY0A 5FWQA 4PJ5B 4UIKL 3K46A 5E8NB 2GBAA 4LL9A 2VN5A 3MCLH 1FNAA 2BWIA 1R4XA 2D31A 5DO2C 5C1ZA 1B0GB 5LBSH 1J0IA 4QLWA 3UTOA 1JNHA 1EUVB 1RFKA 4U3SA 1UJJA 5JJTA 1RULL 2OR8A 3BIAX 3NJFA 2ZIDA 3AE6B 2GSGA 3U4AA 5JMOC 3K74B 1GAFH 1HXYA 4YE0A 3B34A 4YR6B 5IREA 1A4KB 5BOJA 2VZTA 4WDIB 4J2QA 2WQUA 1AJ7L 2XTJB 4HPOL 2AQSA 1MFUA 4HKZB 5E0FA 5C0IA 4I77H 4OIBA 3PPAA 32C2A 3AM8A 5EBGA 2KWUB 1JDCA 1NDTA 3P69A 1IBBA 2ZF8A 1UD6A 1LQBC 2H9GA 2Z4QA 4JANB 3BRDA 1HEJC 1YJDC 3SJVB 3ZDMC 2EIEA 3GIVA 1R0AL 5CCJA 4Z7VB 1A65A 1T83C 2QQLL 4KMOA 4Y4KC 5DJZB 3RDTD 5CD5C 1FMAD 3H1UA 1EDUA 1K53A 2UUDK 1QFWL 4R84A 1F52A 3EAKA 4KTEL 4X6DA 3SQBB 1AWDA 5E2VL 2BSED 3V5KA 4ZMPA 4AXHA 4XN8A 1LXMA 2LU7A 4BUHA 1P5UC 3AE9B 1EA9C 4AQEA 4KDLB 3Q44A 3CVCA 4OZIB 2QHOA 1C5BL 1V3LA 1WEJH 1LQSR 3I6SA 4NT6A 5HTSA 1KC5H 3FT2A 4F8CB 3BN9C 1DDHB 3C60C 1EWCA 1C08A 2JCCF 1MREL 2EVIA 2XK5A 5IHWA 3PIQB 3A9JB 1XD0A 2PWGA 3MGAA 2BKRB 4M7ZB 2NW3A 2QKSA 3BDYL 3Q2WA 3RFZA 2VZKB 4A7VA 2ZG2A 3TONA 3G6AB 3B1TA 3T1FA 1JALA 3KBEA 3O4LA 3DHUA 3LV3B 2J12B 5E6IA 5JXEC 2APTA 2H0PA 3PWUA 4MA7H 5C70A 4APQB 2ZXQA 3QGVA 4DLQA 4K5MA 3ZYMA 5HDBF 3UYRL 4HAFA 4RAHA 4HEME 2W9EL 1G94A 4L0ZA 3X12B 2FBJL 3M45A 2GYSA 4PB0H 1E9OB 5IMLA 2VSYA 1L5JA 2I9TA 3A24A 1N9AA 5AIJA 1V7ML 5C08A 3NCBB 1EF1A 3ZE0B 3KCWA 1UM4H 4NQSA 2BX5A 2QGEA 4IK7A 4JE4B 5EF0A 4CO7A 4XXDB 3FT0A 1ADQA 1I1AA 1YNTE 1NM9A 2ICCA 5DJCA 4KAQH 4PJFF 4FBJB 3PFQA 4X98B 4ADIA 2BYFA 1A6AA 2H2SC 3HE6D 4M7KL 1OF2B 1F3DH 3SKUD 4GG6F 4KFZC 5DC9B 2HVKA 2X44D 1C5DA 2A38A 1MG4A 4OUOA 1WY6A 5ACLA 3V4VL 3T4AB 5KSBE 2MNJB 5TD4A 1MVYA 2NTSP 1HG5A 3ELAT 4HMCA 4HMDA 3MBEC 4CW1B 4DI4A 1YX6B 3V2XA 1O6SA 5LXIB 2FQEA 3AROA 5DSCA 4UV7H 1MAML 1YEHL 1Z3YA 3LJNA 1R3LA 2AEPL 2WLLB 3OL2A 4PV8B 1KGCD 2J8UA 2W59A 3MUGB 4XBEL 4RGTA 3LEYH 1U3HD 1SF5A 4C0EA 4XVJL 4O51A 4GRMA 1EGJA 1G7LB 1J05A 3SPIA 3S2AA 4FHKA 2JJUA 1KJVA 3HMWH 3L3DB 3S37H 1ZWIA 5AW7B 3N42F 2IXQA 3UT7A 4X0KA 4HGKC 3RYTA 4N85A 3CZLA 4F7PA 2BSTA 3WTSA 4FXKB 2GRQB 1M3IA 3WCQA 4F8OA 3DTUB 1IGYA 4X7DC 2YPLB 4MRUA 5M94B 5E9NA 1D6EC 5E5MA 3TYFA 1ZCRA 1PEZA 2C0LA 2VLJB 3TFKD 1KLGA 4OBSA 5FHBL 1DQIA 3SDXF 3IDXH 5BV7H 4XNZB 4C7ZA 4OF6A 1FC2D 2EYTA 3F85A 3IPFA 4RGNC 1OXJA 2NYYD 5EIVA 2RAMA 2QPUA 2HT4D 4HS8H 4LKCB 2CE6A 3GD1C 3QEGL 2EZ0C 3FN0L 3ZKSD 2P4AB 3C2AL 2FSEB 3VAWA 1C9SA 2MJ3A 3ARED 1EGJH 3CFNA 3MLXH 3FFCD 3RAUA 3O4OC 1J9SA 4KH9A 9PCYA 1A9EB 5GRXG 4I89A 1F4XL 1SYVB 3FBQA 3NIFF 2I07B 3PPEA 3SKMA 2YD7A 3OLGA 2OMUA 1HK6A 3K9PB 3BWAB 1PJ9A 1VGEL 5IMOB 1WE7A 2QQKH 3ZIMA 1FHNA 4NQEB 5I8CA 4PV1C 4ZOBA 2EDTA 1QHPA 3EHRA 2DPKA 4FFVC 3FXIC 1GGYA 4C0MA 1WA1X 5IMKB 2VSNA 4HJ0C 4TM9A 4D2NA 2KMMA 3QYMA 1KCSH 4BZ1L 5ISZA 4X6DE 1MJJB 4C83A 1WC7A 3CUPA 1N6QL 1LMIA 4LSUL 3TCTA 4KMTH 1TZHA 1WGKA 3HZMB 3CN3A 1FT2A 3EDTB 4Y1AD 5GXGB 3RI5F 3B9KB 4KGSA 5LBGA 5K69A 2BVQB 3D87B 3LRLA 4KKPA 5DURB 2AQRA 3UG3A 3EO0A 1X5AA 2R4RH 3WS6C 5IM7A 3ABME 1CK0L 3OSVA 2EDHA 5FR3A 3BZ4B 4WJ5B 4ZQKB 5IB2A 4TTDC 1JRUA 2C9WB 4X9FA 4GAFB 2KFKB 4MM3B 1MRFL 3BY4B 3VO0A 4PWJA 1W2KT 1IAKA 3GFUA 3U7YH 1KN2L 2Z3FA 1ID2A 4P2QB 5C0GA 2ITEA 5J6GB 3O4LE 2R2OA 4FQ1L 3ZTJH 2O5ZH 2DMBA 1N4QA 1ONQB 2WBWB 4KKAC 3MJ8B 3NN8B 3CQGB 2VXSH 3BWZA 4U6VL 1WCQA 3WE6A 3K9OB 4Q2JA 2HT3C 3GBML 4AQ8C 4MDJB 4B9FA 4GP8B 1FGVL 2CLRB 4RFEB 1WBYB 1I53A 1XL4A 2X2JA 4I18A 4PWEA 4YBHA 3ZSSA 4ZPTA 1MWAH 4Q0XH 5IVZB 2HP4A 5C08E 3MV9D 2OVBA 1MCCA 3VTWA 4N8CH 3SEPA 1P4UA 4ZMTA 1JCKB 2KZBA 3ZXVA 2Z9TA 4H88L 5IB4A 1U3HA 1UADC 4JB8P 3O6LL 1KUMA 3MV8B 3E8UL 1UASA 2VKXA 2BEDA 1F02I 3QJQB 3QJSB 3BP5B 2L04A 5G4MA 3WD5H 4M7ZC 4TNGA 2F5BL 3EFOB 3CBRA 1Q90A 4QHUA 1KENH 1EU3A 2R03A 1FE8H 2F7QA 1BF5A 3C3OA 2ZCHL 5LG6A 4OTXL 4M48L 4HEA1 4APQC 3ARFB 3NZHL 2O93L 1R75A 4JPKL 5HYIA 1N0XL 4HHWA 1SDAB 5DI8B 3UYPB 3GMPA 4NOBA 2J8UE 1WWAX 3CLEH 1IXVA 2V2WB 5TDPB 1B0WA 1FCCA 1RJZA 3AU5A 1W15A 3DOIA 1UVQA 1NGZB 1HIML 3KPRB 1G7JA 1DFBL 2EEXA 1KT2A 2FVNA 3NDYE 4OI7A 4N6EB 1U36A 4K8RL 1I42A 2WQ7A 3AREA 2AJAA 3BXNA 5ARFA 4B6ZA 5JUEH 2WO2B 5BYSA 2VXUH 1JPLA 3DRTB 5D7JD 5DZAA 4P9ML 4MS6A 5CHNB 4RM8A 3VSUA 4NQCD 5IVNA 1E7PB 3B6SB 3PRMB 4UYPA 1KTJA 4MVBC 3DSFH 3OJDA 3R2IA 3TBYA 2L3ZA 2J8HA 4S1RL 3L4UA 1GC6A 2NUTA 4OD3H 3T4AC 1X7TA 4U96D 3NIGB 2Z8RA 5HHPA 1VEPA 3NIDE 4JD2G 1SJHA 1BXUA 4WO4B 1HHIA 5D7HA 1MJDA 2GJJA 4Q97A 1IBXB 5CCKL 4G1EA 4A2HA 5BQ7B 3FYIB 2ODIA 1I8MA 3QIBB 4RFNC 1J1XH 3U4BL 5GPRA 3EOTL 4XCNB 2GLSA 1G7PB 2SAKA 4C4KT 1IKNA 1EUTA 4KUCD 1QRND 2DH3A 3D18A 4KXDA 4HRLA 5L88L 3GMNA 2G3NA 3QI9D 4BZAA 3SFZA 3OG4B 2WWKO 4JM0A 2WZ5A 4OW6A 4WI4A 1MFVA 4QY8B 4HK3N 1C12B 4JY6A 4Y1AA 5J9PA 3JVZX 1N54A 2I1KA 1MJ8H 4FG2A 4F91B 3OQ3B 3QUYD 3ZYJA 4FXKC 1D9SA 4Z0BL 1J87A 2HRPH 4NI6A 1N7MH 3K8KA 2AHIA 4ACLA 1DC2A 3AU0A 4FG6C 4XI5C 4XMKH 2RALA 3QWRD 1SQ2N 1ZVYA 4XNZC 3GZQA 4M00A 3X3FL 1OE2A 2C3XA 5ISZE 2K6DB 4IW4C 3V7MA 3MRLA 3FTXA 3I02B 4NYLA 2N9PC 2FWOA 2CRYA 3B3BA 1N9PA 4XXCA 2PM6A 2JB6A 2DW5A 1NEZA 5TDNB 4C56D 3CBJB 5A43C 4JPIA 5K9JL 1EK3A 4JJOA 3TV8A 4DDGD 2B1AH 4DJMA 4DW2L 3MV9A 3RIAK 3A4AA 2Y1AA 3IJSA 2IDCA 4BCYA 2HUEA 1C5CH 3TEXA 1EVUA 5BYQA 1X5ZA 1V1PB 3D9JA 3L3HA 3OX8A 1NCWL 5IBUG 4D3CH 2AERT 4IJ3B 4TQPA 5JO5A 5DMGD 3TPKA 2OYMA 2G9HD 4TXQA 3CCHA 5CHFA 4N86A 4UMGA 4MB3A 3U0WH 4MAYA 4LHUA 1FZMB 4K3EL 5IVXF 2KOXA 3AM9A 2XPIA 5BZZA 2A9ML 1ZGLP 3PWLB 1SMDA 4XMLH 3CVHH 4HA1A 1JV5A 1W72L 3RILA 1KBBA 2XGMA 1AFVH 4K71B 1CG9A 3UTSB 2W65B 3ME0B 1YJDH 5DDHB 5BUAA 1ZS8A 3L5WA 2ATAA 3AQZA 4H20H 1TBEA 1KGCE 3RY4A 4XRCA 3TEUA 5C0EA 2GRRB 1BX2A 1V86A 2EQXA 3BW9A 3VRIA 4GZ3A 2YBRA 1HCYA 4TL5A 4W6WB 5F7BA 1JGDB 3C8KB 4HUUA 5AQAA 4FP8L 4QOKD 3GGWA 3EHNA 2RCSL 2GK0B 4XVUD 4L8SC 4X99B 1TZGL 2LGIA 2XTJD 1KM7A 4G6FB 4NZUH 2MJEA 4KQ0A 2QELA 1QEWA 2K45A 5CUSH 2EDYA 4NQCA 4YHZL 1RUKH 2EXTA 5EOQL 3E9TA 1AMXA 3NRFA 4GTSA 2DBYA 2ZT9C 2B1OA 2IAMB 5C0ND 4Z3JA 3U30A 3MV7A 1I1FA 4QRUA 5EU6B 5H35B 2AQ3A 3NCJH 3LZLA 3SJVD 3H85A 3ZHFA 4F1ZA 4ARCA 5IFJB 2L00B 4GAGH 3WCYA 2FHCA 1XX9C 2HFTA 1R4MI 3VG0L 4XWOD 2OTPA 1DANU 2OPCA 3LQAC 4YDMA 4WGKA 5DRWA 4NFDA 4GKZA 3MOQA 3DECA 1QRNA 3G5XB 5LQBH 4ZFOA 2B3AA 4M8MA 4I2XB 4JQIH 4QDGA 1ZDSA 1UUSA 2BHZA 1SM3H 3AE3B 1HNGA 4G6KL 4TSAL 5DK2B 4KVGB 5E6YA 2W82A 5F9WB 2VH2A 3V60A 3IJ7A 1XSIA 2DD8L 5JW4Q 5DS2A 1MCPL 3QUYA 4XWTA 4HOMA 3IGAB 3UTZA 1MF2L 2C9SA 3U36A 3WL9B 3CLWA 3UIYA 1P7QB 2YMOA 1BA9A 4X7SL 2VZKD 1TU2B 2EO1A 1NCCL 3ARFC 5JMND 4BUGA 2F8IA 1VPOH 3FT1A 4NEHB 5A16A 1UWXA 2YQ8A 5AQ0A 1CVSC 3IMWA 3MFGA 5TSSA 2AWIA 4LERA 1HHJB 2R5SA 2YSSA 3JWNC 4PTUB 1DUYA 2R05A 1QD0A 5I8EB 2AQTA 1LFDA 1C8QA 5D0QD 1GR7A 2OZ4H 4HISA 5EMYA 5KYUB 3HNTL 5H8DA 1CTOA 5FDYA 3CLJA 1DDTA 4HZLA 4NZDA 1KPVA 4Y1AE 1MJ7L 4C56A 1Z0NA 1ILUA 5DZNA 3QPQD 1S7XA 4N3CA 4WZ9A 1JK9A 4GQZA 1KB5B 4WWKA 2V9QA 3BIBX 5DLMH 5DFAA 3AE8B 3MRRA 3CZKA 4WO0A 1ETB1 1U8JB 4WAFA 1AZVA 5KBNC 5I1LA 3BPCA 3QXWA 5EYPF 1YPZB 1PLGL 3Q6GH 4M03A 1F1GA 4EDXA 5CBNA 3ZXPA 1CPUA 1DBKH 1LK2A 2IH9A 2D7TL 4WO4C 4NAQA 3ABKB 1UWXH 3EXJA 3GP7A 4G43A 1DZBA 1EAPB 2XYBA 3CQQA 1PYWB 1N95A 1P9DU 3QIBC 1EAJA 3V31A 5EULV 2TSBA 3LKNB 3W5MA 3T3PE 1AYRA 3L3IB 1RZKC 4HIQA 3MV9E 2I6HA 1TYRA 5DWPA 1GIGL 2EYRB 4LRNL 5CEXA 2J1YA 1G9NC 2DDQL 4NIYE 4PRNB 5I19L 4U49A 2V2TA 1ET7A 2PWEA 1EFXD 5D71L 2V8SE 2B0SL 5TQ2H 2QC9A 5CP3A 1TR4A 5HGBB 3BVNB 3D9KA 4QOKA 4ZTEA 5GZOA 5E56A 2BYTA 4FQQB 3TNNA 1CFVL 1VEMA 4HIIB 1ZAGA 4AQ1B 1JS4A 4AV7A 3N85L 3PG2A 3RZCB 4DKFH 1AIFA 2F0CA 3SYPA 2XWJA 3N2JA 4Y9BA 4LNFA 1EDQA 4EVNB 1SA4A 1ACYL 4I1MA 4HU2A 4IHOB 2DWDB 2VDQL 3R4RA 5H2BA 1ZLUK 3X1NA 3V2AR 2EUWA 2VMJA 1U8QB 4KNQA 2ZG3A 1F97A 2V5YA 4YL4A 1K2DB 4X5PA 3AE1B 3MJ7A 3RNKA 4TTGA 4NQTA 1AZNA 3HUJF 1EJ8A 2BVYA 2WYIA 1DSWA 3D25B 2WLYA 4HJTA 4D7BA 5JPMB 4G71B 3GSXA 4ENED 3BJLA 5LLIC 4LNOA 4BFFA 5MEQA 1V97A 2VERA 5IV2A 3AY4C 4PRHB 3TWXA 2JKJA 3UGBB 4IJ3C 2PCPA 4YDVB 5FW8A 5A2BA 2DX5B 1KT0A 2CNYA 1WE5A 2I69A 4NQCE 5AKRA 4E9YA 3MXWH 5I8OH 3QAQA 5A7DB 5CINL 4ACFA 3FILA 1XCTA 1I85A 3HRZA 3QNYA 4KI5E 2I9LB 4K3GA 4MCZB 5DHEA 5DWUL 3G5WA 3LS5L 3MV7E 2D11A 3B9JA 2D0HA 4G3XB 2YUWA 3KJ4B 1E2WA 3S9DB 4XX5A 4JO3H 2LGDA 1KZYA 3K72B 3F6LA 1FT1A 1SVBA 2PVGC 4XVSH 3K6SA 1EF5A 1GS8A 3QCAA 3RE0A 1YECH 1ZHNB 3RTQC 3TCLA 3L3JA 3EFFB 3RTLA 1AHKA 1YCSB 1QRNE 4NKMA 3HA0A 4BJLA 4EIGB 5FYKE 1CF8L 4JVPA 2APFA 4DK6A 3P0VH 5ICZA 1VERA 1JYWA 5C3TA 1AI1H 1M05A 2VMEA 1RD6A 3B9KD 3UBFA 2BW4A 2JT4B 3UMNA 1WBXB 4TQ0A 3BSHA 5DURD 2OQJA 3HVZA 1S7TA 4N2FA 2NY0C 5CGBA 2BHYA 1TN8A 1ECZA 1U8LB 4LSPL 1Q9WA 2WZPA 4UOQA 3L6AA 5HGHB 1L4ZB 2ZTBA 2Z7ZA 2FBNA 1TQWA 1A1OB 3CVWA 1D5XA 1FP5A 1MW0A 2F1AA 1DSYA 4JGUA 4RAUA 1IGFH 4LMQI 2J6EL 1HILA 3KWVA 4MNGA 2P9PG 3GSQB 1OE3A 1D7DA 1P9MC 3AITA 4UM9A 8FABB 4F37K 4Z7WB 2VITA 3W39A 5CBEB 2H26A 4AXWB 2HMID 4LLGM 5IJCC 4U1SB 3KH4A 4CAGA 1BVKA 1JYVA 2FX9H 2CA3A 2VRQA 4C56E 1L0YA 3FEYA 1CC3A 2XN9B 4JGJA 3FL7A 1PKQB 3IJYB 4KXAA 4TVUA 2BGFA 2NX5B 1CQKA 1M57B 5F9WC 4CSTA 3NFSH 3CSGA 3MV8D 2WZ0A 4LARL 4FZ8L 4XOBA 3NCFB 3OXFA 1EFXA 1O75A 3MOAH 2PTUA 2O6CA 1UZ8A 3N0AA 5GSVA 3HRDD 1GJZA 3K1KC 4J39A 3OD3A 3ZHLA 4I17A 3OTTA 4N8VG 3WMQA 1UCBH 5CCLA 4IMLA 2MOQA 1J1OL 3CWIA 4U95D 3HI6H 2JJSA 4ONOA 5IZ7A 4LFHD 4YDOA 5EOCH 1A3LL 3ARFD 1YEFH 4CDHA 4ZOAA 3VVWA 3QRLA 2DQHH 1ML0A 4UDTA 4WTZA 4BE5A 1BAFL 2ZUSA 4KZDL 2C9PA 2NY3B 3QQ3B 1FFOB 4JFXB 5AZFA 1W6LA 3I63C 5DQDL 3N1QC 4QXVA 1TGZB 4OCSH 1HAUA 1SLVA 1CLOH 2GJ6A 2KLSA 3CSYA 3MZLB 4QYOB 3S98A 5IROD 4L8CB 3B0AA 2R4SL 2IEPA 3F7QA 2XCCA 4QOKE 1T5XA 2N3JA 2A9AA 1FH5H 2P7TA 3BKYL 3SHFA 3FPYA 3H6AA 4GW1B 1JROA 1MFWA 2Y5PA 5CJXC 5DD1L 4AYMC 4RX4A 3OGCA 1HOEA 1HHGA 3RWFB 3DYMA 4XDCA 5IB5A 4PBWD 1G6RB 5BVJA 1VADA 2GTZB 1UGKA 2MQ3A 2QJDA 1WVZA 2YPVL 3X17A 1MNNA 1QI5A 2OZNA 4WO4D 4R96A 4GIAA 5TDOA 4F5CA 4YNDA 1E4JA 3CSTA 1XF3B 2AEQH 2V7HB 4GMTL 3QIBD 4XC1H 3ASNB 5CLYA 5ES4B 3W9DB 1CBVL 4JHRA 1I3GL 4K7PY 2BHUA 3RRNB 1OQRA 4FQJH 2VR9A 4KQ4L 1DHKA 3BD5A 3AEDB 4PJHA 1HXMA 2HLFC 3RUGA 5CX3A 4BSWA 4TNFA 1E28B 4LCWA 2XWRA 2ZUWA 1ISNA 2M19A 1YEKL 4HVBA 1GC1L 1PQSA 5FM4A 4OQTA 1QUNA 1FJ1A 1H3PH 4I85A 4ZOCA 4AC4A 1BFSA 2R02A 2DYSB 3RZCC 2BSRB 3BESR 2R56H 2IQCA 3FQ2A 3FAHA 3U9PH 4NXSA 3C5JA 3DTDA 1CU4H 3U2SA 2XVGA 3PRZA 2RDHA 1A6VH 5TGBB 4OAUC 3SDAA 5EORL 4MSMB 2EVGA 4W9LC 5FPIA 1WE6A 3RRMB 1E8WA 4D10C 5JPMC 5GGVY 3G3LA 4NRZB 3D2UB 4DETA 1SVXA 4QXUL 2VR6A 3EJZD 5KG9A 4PW4A 3KR3H 3NTCH 2MA9B 1XFPA 3TWVA 3PABB 3VXUA 1NCAH 2FUTA 1AGDA 4JJ5B 4XNAA 3NAWA 1WXAA 5G05J 3SE4A 5E8DH 1ZLVH 4LCIL 3MLUL 5GRVK 1KIRA 2HPOA 4L37B 5CBAB 3U7DA 2IY1B 4P46B 5KJKA 4YXKL 4O58H 2X4UA 5E00A 4NQQA 5E9DA 4JHAH 3SY0A 1H5BB 5FGCE 4ZMZA 3AE2B 3NQPA 2CGRH 2YD3A 3HOGA 3QEHA 5JR1H 2WQXA 2Y24A 3KJ4C 4KJQC 1A02N 5AVSB 3G2TA 3CZNA 1KELL 4MNGE 5ANMA 3HPLB 4PJXA 1HX0A 3SBWA 5BMFL 1HT6A 5FYLL 2CHZA 2ALWA 3EHBB 4NN5B 2VKWA 2CU3A 1GZQB 1EH9A 4MKTA 1XLOA 4PCYA 1MEXL 4IQHA 2VGYA 4HC1H 3LEXA 3L17A 3ZDZB 3ZTNH 3MLWL 3K71A 4H0HB 3WNOA 4OVVA 3QB2A 3OLMD 1IC4H 4JHZA 5IOPB 3RWJB 4ACTA 3BVGA 4L3FA 2AJ3A 2AEIT 3AS0A 3CVIL 1GVIA 2Y2WA 3Q2VA 5IROA 1R3HB 4NO3B 4GRWE 3EYOB 3OM3B 3STLA 2IOMA 5L6YH 1DBMH 3SPHA 1K6QL 2X1PA 3VRLE 4KH2A 5FFGA 1BQKA 1T04B 2ZNXA 3M8OL 3WFZA 5CILH 3QIWD 4F7AA 4AQOA 1GGUA 3PE9A 4IDJL 5D94A 3ZYKA 4TUKL 2IAMD 2GKIA 3O8XB 2MOGA 4JN1H 1OCZE 4DVRH 2M0XA 5FA4B 3PWVB 4ZMAT 3OXGA 4JG1L 1KEMH 2AJZA 2XGOA 4EQFA 3CLFL 3FU7A 3JWNH 4O2FA 1XGYH 1YUKB 1XH1A 2GBTA 4P29A 4GI6A 4Q4IA 4HKBA 3FB6B 1N62A 2WB2A 4ZO6A 4HNAD 4JFYA 5AVQB 3IXSA 2GHWB 1JZ6A 5T5NG 5KHQA 1P5VB 2EE9A 3MZTA 2LRWA 2VUOA 1SXAA 2K4WA 2WKOA 2MCPL 2WP3O 2HO1A 1RXLA 5L7XH 4YWGG 1PD0A 4NP4L 4NZTL 5LCVL 1WFYA 1GCFA 4NRYA 1OK8A 4GUCA 4ATGA 3HBGA 2QVIA 1TDQA 1WZ3A 3UUXA 1WISA 3DSXA 4BX9A 1A6WH 1TZIA 1W0VA 3NJKA 5DT1L 5KYXA 1PZUB 4ZHPA 4F5CE 1T3FB 2VSDA 3O11B 1U3JA 4OKVB 3VXOA 3LB6D 15C8L 4JO1L 1OARL 3E6HA 4DVBA 5D5MF 2LU5A 4UCFA 1T03L 1S9WA 4DHZE 2NY3C 1B88A 1QBML 2XUWA 1HI6A 1BLNB 3C8DA 4OF0A 4KROB 4K7WA 5IAAC 3HMXL 4KV5F 4PJHE 4L9LB 3RUGE 4UNUA 1YNLH 3FO0H 1OP5K 2F58H 4LCWE 4KXCA 4B96A 1RZKH 5KZCB 4JUSA 5C3JB 2KBXA 4XP1H 3EECA 3CVLA 4LIQE 2R29A 2B39A 1K4CB 5B1KA 4J3TA 1WGDA 1BQHA 3VUAA 1J5CA 3EADA 4FULA 4DCQB 5TFSL 1Q0XH 5ILTH 1DQJB 2P9KG 3VXPB 1JZJA 4NZRH 1MYOA 1ECYA 4AK1A 3S2CA 5I1IH 3CIQA 2R61A 3R3MA 3HLAB 3F01A 3KPLB 1NP7A 4OAWA 1MJUH 1UJTA 1OUVA 2X70B 3DWMA 1UD5A 3EBHA 2XBZA 3OXSA 1C4AA 2CD0A 1HZLA 1F6AA 4TOYL 1HHKA 3FUJA 3CZGA 3MI6A 3DURB 2LGXA 4JEHA 2VRRB 2FCNA 1HEZB 5KVEH 3M17A 4AE0A 2J49A 4U8HA 1CIDA 1XCQB 1XZWA 2FO7A 3UT8A 2XOTA 5CXPA 4FYSA 3VXUE 4F7CA 4AQ7A 3L9RA 3U0PB 2J1XA 2Y36L 4LG6A 2NT0A 1MHPL 3BVDB 3D39B 2ZWYA 2A4CA 3QHFL 4CN1A 1I4HA 5AAMC 1ZE3D 5E9DE 5SV4A 3TC9A 2C2LA 1AHWA 2FJFB 3J5PA 4LPYA 3GJEB 4JHVA 3JUIA 3BRGC 2NZ1A 1DBJL 5KEZA 5EE1A 3RWDA 2Z8LA 3ZL2A 3MMEB 4BBWA 4Q9CA 1I3VA 5ANME 3NIFB 4PJXE 3PQYA 3C6LD 4X80H 3MAWA 3TFBA 2ZXDA 1T89A 2BVTA 3L16A 3VJ6B 2Z31B 1M9SA 3SFXA 4OV5B 3X0WA 2I32A 5DJAB 1FXIA 1N4XL 4FNLH 2ZZUT 3DVFA 3D9MA 1EHLL 5DO8A 1QA9A 3K0WA 1FVDA 2VM9A 1UXMA 1X4ZA 5CD3B 4EOWH 2IDTA 1IE4A 4KOBA 1UH6A 5IA7A 4GO8A 4OGAD 1BZ9A 2IJGX 4JKNA 3Q8EA 3C9NA 3ZMNA 1Q94A 2NZIA 3T65B 2EDRA 4W9GA 1NGPL 3F84A 4NNYA 4J3OF 5LNDA 2K9FB 4OB5H 3RVWC 5F7FA 4AIZA 4P46C 2UV3A 4EXPX 5HVHB 4PRHD 4QHMA 3I6GB 3ZYYX 4U6XA 3VA6A 2FZ3B 3QZWA 5CJQH 3WXVL 3GBEA 1OHZA 3P73A 3W1SA 5HPOA 4GZ5A 4G6ML 5DZVA 3PJNA 4WJPA 3PTFC 3JQ1A 1R6VA 1UEYA 4Z7UB 4LSQL 4BSJA 4ZFHA 2Q0ZX 1MCWW 3BPOB 4KUZL 3V0WL 3EHBC 3P9LB 4KJQD 4NN5C 2IALA 1MZCA 4PCKA 1NBCA 3ZE1F 5LAXB 3V0VB 4KV2A 4L2YA 3LRHA 5F1IB 4EKUA 1O9VA 3L1OL 2NY6D 5AVRB 2PNNA 4B3VA 1CLCA 3OPUA 5EBLB 3X3GH 1UJ3B 2DEYX 3E6FA 3GSOB 4KI1A 5GS0D 2PPFA 4LSVL 2Y4UA 1WM2A 4K5BA 1HDMB 1EZVY 4Y8DC 3S5LB 3FTYA 1X4YA 4L4VA 1NCNA 2JKXA 2Q5WD 4XCEA 2RJMA 3LNDA 2V4LA 2VRKA 1WH3A 3UPAA 4CC1A 5I1KH 1THCA 5G2NA 4ZD3H 3U1QA 2V17L 3D4CA 3DUUA 1B90A 4M7LL 5J11B 1MFBH 3GSVB 1OQOA 1F8TH 2VL5B 5D70L 4B9PA 4X6CF 3S4SA 3NCWA 1Z9SB 5KVEE 3Q7AA 3MYJA 3WANA 5AOLA 1AKJB 2XN2A 1JHTA 5F88A 3FO2A 1T1XA 3MCLL 4MQSB 5DJ8B 5MEND 3OAWA 3SI5A 2X6FA 1M4KA 4PG9A 3GMMB 5LBSL 3BO8B 2XN9D 4E9VA 4S1DC 4EBQH 1OCWH 2AFNA 2DB8A 3BGAA 4M3KB 2CDFA 4UILH 2HE7A 3O45B 2YZ8A 3G5VA 2FCQA 4U2ZA 4IWOA 1GAFL 4GOSA 2AP2A 3R8QA 3MRIB 4D9LH 5AEKB 3FO1A 1KB5H 1TEZA 4FS0A 4MLSA 4OUUB 3ARYA 2IDFA 4G5ZH 2W0FA 1TMQA 3D85A 3RY6C 4H5SB 4PV9A 4Y4FD 3F6IA 3KLHC 2WYQA 3C6LA 4NWTH 3IVKB 2MH4A 3SGKA 3D8MA 4JG5A 1E6EB 5FF6B 4JWUC 3EXLA 4QAWA 2EVFA 2IIJA 2R8SH 4KROC 2ZOLB 1OGAB 5CSZA 1BIIB 2DLFH 2OEVA 2O1AA 4K94H 4MNHB 3ZKND 5J8OA 4CHKA 2FULA 1SN2A 1S46A 3M1BB 4FTVB 2N59A 4NOFA 4WSGA 4NC1E 5DPTA 4ME2A 3K2KA 1D5ZB 1KYFA 3W82A 1D5BB 1IAOB 2DBLL 4YSDA 4C8XA 5IG7B 1MHCB 4WK0B 2K39A 1JTOA 1WZ1H 4ZX3A 3BZ5A 2GCYB 1ZHBA 2R2EB 4OJEH 5IT2H 3CX2A 1KNOB 1RLBA 3BCFA 4ONHB 1KC5L 4Z0XB 1ZE3H 4E9TA 1VFBB 3PNWB 1MAKA 1NBZB 4MXQD 5CEYA 3CVDA 5D6CA 1YUHB 4DQOC 3AY2A 3PQYE 3TCAA 2VJXA 2KPNA 4A1RA 1E67A 4LBEA 4NAWB 4PJEF 1MQ8A 2B59B 4Y4HB 5I2IA 2J0JA 2E9WA 2Y5BB 1NWOA 2CSPA 4X5XA 1DJYA 5I6NA 4AYSA 3FQWA 4F24A 3BIKA 4HWBA 4PJCB 1AXTH 5KTEL 4E42B 4MA7L 1G9EA 4XPTH 1PG7X 1X6LA 3AXLA 1GB1A 3DSNA 2C1PB 1CLYL 4K3DH 2HRLA 3P30H 3NSFA 3QJOA 1SZ9A 1V8HA 1JZFA 4XP5L 3RWGB 5DVOA 4GMVA 1FRGL 4BHUI 1DYZA 1UM4L 1KGYE 5INDB 1XR8A 4PLOB 3E3QE 5HI3C 5KHOA 3ZT7A 1SBSH 1ZT7A 4M1DH 4CNIA 5EE9A 2DMCA 2ZD0A 3NJVA 1OEYA 5I1AB 4R2GB 4BFEA 3QHZH 1KN4H 2Z31C 5KCMA 2QZQA 4DX1A 2PW1A 3N41F 3EJNA 4HWBH 3SZ7A 4N24A 1S78C 3F7YB 3IFPA 4POYA 5HRYA 3PWJB 4G7SB 1CZPA 5BXOA 1MCWM 1RZIB 4FKKA 4OLVH 3CKBA 4CKVX 4QRAA 3OMAB 4KXZI 2RFAA 5GZND 4UV7L 1WWWX 3SKNA 2QFCA 3D2UD 5MENA 1AGBA 4BKTA 3IBOA 2BRRH 3JVGC 2B7DT 3CZJA 5GS0H 5HVHC 4Z7OF 5EZIL 5FIOA 1ADQL 3HMWL 3BWUD 4OJCA 3PV6B 2IV8A 2ZYIA 5ICUA 2QADB 3N50A 4Y8AA 5EO9A 1QNZH 4BK4A 4EI6B 1CE6B 2VM3A 3EF4A 3U1SL 4LCDE 3EGDB 1PC2A 3KPSA 1M71B 3BPOC 3EZJB 3O3DB 1OWRM 1OB0A 1UF0A 1RUAH 4QF1B 5J12C 3STZA 4H1LB 4FYRA 3UDWA 3VD4A 3VD2A 3QZNA 4Y4FA 5BV7L 3IDXL 4XHQA 1FZKB 1BZDA 1AE6H 1FF5A 3PP3K 2R1XA 2CA4A 1LWJA 2EE0A 3CGTA 3IXAA 5FWRA 3UERA 2Y0BG 1WDYA 1QNIA 3FQNB 3QXVA 5BVPH 4BEPA 3BX7C 5JHLH 2F68X 3MHSD 2VH5L 3ULUF 3MLXL 1EGJL 4NQDB 2J42A 1RP9A 1U4EA 1NEZG 1F45A 2AJXH 3QZBA 2EC9U 3UG5A 1ELKA 3QORA 4FADA 4LL1A 2L05A 2AJVH 3BGMA 3LPPA 4LU5L 4XHJD 2QQKL 4I0CC 1T7XA 2ZPYA 1J1PL 3UM1A 2EQDA 2YWZA 5ENWA 5EU3A 5J11C 5JYMA 2WV3A 4YEEA 3UZEC 3U79A 1ZV9A 2PTVA 1N2RB 1ZXQA 3S3PA 3UGUA 3QXUA 5B7MA 5LFAA 4GA0A 1IRAY 4DHJB 3O8XD 4LHUG 4R7NA 1KCSL 2QGDA 3ALBA 3JUEA 4P49A 1SIFA 2WUBH 2P46B 4KMTL 1MCHA 2MQGA 1WSPA 2YD1A 3V4LA 2AJYH 1UJKA 3DX9A 2CH8A 2Z64C 3IJ8A 3JT0A 4U31A 5EUOA 3F7RA 4LLUB 4AZ8B 4D0BB 4F33B 4K81A 3N06B 5J56B 3H3KA 5DHYA 2XPGA 4JKPH 1N67A 3HC3H 2R4RL 4N2OA 1CYXA 2B5IB 5I1GH 2AK1H 3I75A 5F2FA 1K8DB 2VB5A 4LSZE 1CFTB 4XI9A 4N2LA 4OCYL 5C2BH 2P52A 4AJ0A 2Z93B 3U7YL 5EO1B 4Y6CA 1G43A 4YHLL 3B2DC 1E5WA 4HRSA 1B3JA 3I9V1 3VWKB 1G6RH 4YZFE 2VXSL 1G7MA 1LEGB 3BEVA 2HJKB 4OI9A 2QBWA 4JDZB 3FB8B 3US0A 3LPFA 2Q2EB 2ZKHL 4JHUA 4PGCA 4N9F4 3FTUA 3VH8B 1EO5A 4XC3H 3TWYA 3UEQA 4ECNA 4FL4B 3DOSB 1I7TA 1JXKA 2XZCH 2ZSWB 4G7YH 4Q0XL 3QULB 4UTCA 2ZUQB 4ZW6A 5MEPA 3VFPB 4N8CL 2JU6X 2PLPA 3GIZH 1UG9A 5KZCD 1KIPA 1XMEB 5AARA 3HM3A 2RQ8A 3E37A 4NSKA 4FFZA 5KJRH 4N9GB 3WD5L 3IJ9A 5DFVC 2RMMA 1Y18A 3IETB 4NXKA 3KL5A 3L4XA 2A6DA 3GE8C 2D2QA 5L8KB 1FE8L 4ZXBC 3WJJC 3NCYP 4ZUUB 3L0WB 1T20A 4HORA 4KKNA 4LLDA 4Q14A 5K9KB 4RNAA 3G9AB 1IZKA 2O61A 1T0QC 4JBSA 2A2QT 2KDFB 3F00A 1NC4B 4BH7B 3UACA 3W9CB 4B95C 2K8QA 3M7OA 1F3RB 4W9CA 1N10A 2XG5A 5MENE 3BN3B 3CLEL 4ZUWB 1DJZA 2EDKA 4HCIA 1R24A 1HJBC 3TBTA 1IL1A 4QPEA 3FAXA 4F57H 2OMVA 5DUML 4P23C 1SMAA 4WK2B 5F93C 4QHLA 1QLEL 4ESKA 2UZXB 2IBZY 4JQVA 3ZYLA 1BD2D 2E75C 5FO8B 4M93B 2H47C 2VDKB 2P8MB 2VXUL 3AT8A 4LLVA 3KPSE 2OMYA 5T1LD 3IWVA 1BQUA 4H0IA 4WI7A 3UAEA 4DUWA 2QMJA 4R2GC 3CDFA 2AXJA 2BINA 2IWKA 3L7FB 3DSFL 3L9YA 2CCWA 3TESA 3I4RB 5K59E 4U8VD 4N5EC 2P47B 5ID1A 3QSKB 1S64A 3N1ZC 4GT7A 4OD3L 3HHSB 2KZTB 3V8CA 2YIHA 4HFUH 3FCTB 4N3BA 2LD9A 4RQQB 2HG5B 3JSVA 1N68A 4Z7QE 4G23A 5IUSA 5KVFH 1E8YA 4PRAB 5F6HI 3WIFB 5FW7A 2O5XH 4HXDA 7CGTA 3BAYA 3FO9A 2CO2A 2YUXA 4AG4L 2P80D 1HQ4B 2E4FA 2R39A 1JTPA 2X0UA 2F54A 3RIFF 1TS4A 4J8DA 4REZA 5F6IB 2QV4A 3KW8A 4YO0A 5GGQH 1XGUA 5HG2A 4KX8A 4D8PB 2DQDH 1MJ8L 3OHXB 1DQMH 2QADC 4A7UA 3VI3A 2CDEA 4ZX5A 1SY6A 3Q6FA 1S8DA 2K8MA 2DH2A 3GEFA 2HRPL 4NDMA 4PJ8D 3GRWA 4QAMB 4FLSA 4MEMA 4G24A 4N2MA 1WK0A 1L7TH 5CZXD 5FLUA 5FUZH 3UAJA 3PNTB 4XMKL 4F7TA 4YVNA 4PH4B 1GH7A 5DUBB 3ILQD 3WFDH 4MD4A 4JO5A 3GO1L 4JFQA 1HU3A 1BZ7A 2E59A 4KDTC 2WDQB 1CICB 5AOJA 3DBXA 2P9IG 2FATH 4J7WA 1YEIH 3FUMA 3K91A 2DJUA 1XGZA 4AW4A 1HFAA 3I57A 3QNFA 5EUOE 1NCJA 3UBHA 2B1AL 4OR1A 2YD8A 5AYUL 2LAHA 5AZ2H 2VR5A 5LHDA 2AS5M 4LE8A 2INPE 3ECWA 4IWPA 1LP9A 5FDWA 4L0PB 3W2DA 3TT3H 3DX7A 4JQXC 1NMCB 1CXKA 2K7PA 4FQPA 4IKKA 4NQUA 1YSOA 4CN6A 4ELMB 4NUJA 2XS1A 4OLWL 3VFVA 3U0WL 4WQMA 4J1UA 4NPKA 4ORZC 4ZOEA 3LH2L 5ERWB 5T1JA 4LVHC 2L0TA 5DFTA 4JX0A 4DN3H 2AK4D 1TUPA 1FV1B 1AFVL 4LEXH 2DKSA 4WI8A 3GUFA 5T33H 2ENJA 4WWOA 3UTTB 2DZJA 1E9QA 1AKJD 3GMRB 4HHGA 4ZX6A 1J0GA 3D69B 2WGNB 5C7ZA 3VB8A 1I9IL 1S7SB 3DX6B 4IBLT 3ZE2B 3CJJA 4LEOB 4MDRA 1GZHC 3ILPA 4Q2ZB 2ZEQA 3K3QA 3HG0D 1ANUA 3G2SA 1PY0A 2B5IC 1PZAA 3KPOA 4B93B 1EEZB 1WGRA 3BYYB 1BD2A 1JK8B 4BKSD 1IGIL 2EDMA 4AT6B 3Q3FA 3D9LA 4ZSOA 5AUKA 3SZKC 1HX8A 4NZUL 3S3SA 4DHLA 3MXVL 5T1LA 5EHFA 2G2RA 4I5BA 3REWB 2XYCA 2EUVA 4DQOH 1Z2MA 2G5BA 1OWOA 3VWKC 4EKXA 5C0CD 2ZKMX 4IOFD 3LOWA 4XN2A 4D0CA 3RKDC 4I1OB 2KD0A 3NCJL 3WDHA 1BXXA 1WT5C 3NACL 2BVOA 3LPWA 4JY5H 1S9VA 1YMHA 4XMXA 3IEAA 1T5WA 2P5EB 4MBOA 3H42L 4FL4C 4TQ8A 4AUYA 4HBDA 4HKJB 1S9YB 1WRFA 2ZUQC 2UWEB 1KPRB 3WEBA 2KC2A 3EYVB 3VFTA 4AS1A 2IBGA 5HI4C 3SR6A 2J08A 2APSA 3HEIB 4KK6D 4N2DA 1QWNA 1MRCH 5HI1A 4JZJA 5I5JA 3ZJAA 3EJPA 1NC2B 4FNUA 3CSBA 3TWSA 2LFEA 2CHDA 4WHCA 1BPLB 3WTVA 1P7BA 2Y07H 3OJMB 2MRYA 2HJFA 3KDMB 5MPOA 2YQBA 3I9GH 5I18H 5IFHL 4I2ZA 3F65A 4L3AA 4Y4HD 1E5CA 1ZGLM 4E9SA 4OZFH 1VPOL 3LN5A 4LCCC 2VQTA 3G08A 2MHJA 1ET9A 3AEAB 2IWFA 3UJJH 5EV7A 1WGGA 3MRDA 2DWEB 1NFIB 2OZ4L 1P4IH 3GXFA 2F54E 3OAZK 3LCAA 5EX3A 1II4E 2HTKC 3NCYS 1S7RA 2VJ0A 4GSQA 3ARPA 3OMZA 5GISH 3TA3D 4ZFOL 5J89A 2R0KH 5FYKL 2NY5C 2GIXA 4OFKA 2G60H 4W9ZA 3N5AA 4GW4A 3VI3E 1CDBA 3GSUB 1FVEA 5KS9B 1RHHB 1XH3A 4LLWB 2FJUB 5D72L 3VMNA 2K8CA 4XB3A 4OY9A 4WFGD 3WGVB 1KGUA 2J4WH 4J6RH 5DLML 2WQYB 1HH8A 4NQLB 2YEZA 3KXFA 3RX7A 1CK1A 4KKBD 3IWUA 1YQ2A 3NBNA 4J27A 3F64A 4NS0A 4YHPB 4BDVA 1P2CA 2Q86A 4L3CA 4ZK8A 4W9KA 1IQWH 1DQLH 3MA7B 3ASOE 3P4OA 1U8KA 4KK8C 1QR1B 4EMZA 3QRFM 1PNCA 1XEDA 4HIEA 3S48A 4ODUA 4ZS6D 1DJSA 2JKLA 1SNRA 3QKYA 4ZW7A 2AK4A 2ITFA 3L4ZA 4YSCA 3GXUB 2OS7A 3R8BA 1KOAA 2J88L 3P0GB 1I1YA 3MRGB 3FCUB 3FU8A 5F6IC 1E3ZA 1GRWA 1NH6A 1U8OA 2VWEE 4K9JA 5HDQH 1T3QA 1XTLA 2E7MA 1LP9E 4Q58C 2C7NB 2P58C 3QCVH 3O6KH 2WIIB 3ZHNA 2DLGA 4M4PA 4QI3A 2D10A 1N5AA 1TNMA 5E4IA 1UZ6F 4G8KA 4YJZL 1TG8A 2YA1A 4XP6L 1RPQA 3TWRA 3TYGH 5IEKA 1F11B 1T22A 3CN4A 3FYEB 3HZ3A 1BG9A 3TPUB 2A9BA 3DBRI 4BKSA 3LPGA 2JKTM 3TIEA 4Z7NF 5IUCA 3X23A 1CFNB 1TJIH 4DKFL 3ILDA 5D9SB 1EAOA 1ZT1B 4CYEA 5DEZA 5C0CA 4H8UA 3MU3A 1CICC 1MDAA 3IGFA 2LTQB 4U7SA 1JTTA 2E86A 2KK8A 1WH0A 5C0RH 4KGJA 4OFIA 4UDUC 3QZPA 3T9WA 4MQXD 4EIBA 2WXJA 4F2FA 1D5MB 5DMKA 1DE4A 4NQDD 2EDQA 5CGYD 5CN1A 4MMXA 3KW5B 4US9A 1BD2E 3VLDA 5DYFA 3DXAA 4LVNB 4HOSA 1TYGB 4P2AA 4ZSOE 3KWLA 2BP0B 4M01A 2QPEB 4PREA 5GSRB 4YHYB 5HHQA 2DZOA 5I8OL 2NQCA 3MXWL 4U1IB 1RPUA 4ZDHB 4POZC 1QI4A 1FN4B 3QRBA 3FCSA 3QDHA 2WSKA 5BS0A 4UI9J 4HFWB 4W6XB 3G7TA 4R3SB 3CVYA 3FQ1A 2E6QA 4C7YA 1DL7L 4PTTB 1SEQL 1YMHE 3TNMB 5E4OA 1I1RA 5CTRC 1LD7A 4J12A 1CDIA 2EKSA 3NCCB 2QJLA 1YEDA 1W0WA 3Q8CA 2H6HA 3QWWA 1QBLH 4LEBA 1DTUA 1MFCH 3CZFB 1UT9A 2FNJB 2BKFA 5FINA 2DOCA 5CCGE 3MREB 1HSAA 4OGYH 2FT7A 3ZZSA 5L2KA 3IFOA 3R1GH 1AZRA 2P24A 4NLHA 3P0VL 5HYEA 4NFCA 3TA3A 4EUPG 3KYKH 1AI1L 2ZXEB 3U66A 4HQDA 1M4VA 2IOOA 4NKOA 5CWSA 1TLKA 3TL5A 1QSED 3T3MB 4QT5A 5INCA 4S17A 4JFTA 1H15A 4JM2F 2IANB 3FQTA 4M1GH 1KSRA 1K1BA 3NSJA 3DX8A 3ZRFA 1XCTL 2OKMA 4D7PA 1H2UA 4G3YL 5KSVB 3RA7L 5C0JB 4ZMXA 2WBXA 4NENA 4KVNH 1QPXA 4CYMD 2I25N 1YEWA 4GN1A 1LF8A 2ZZPB 3BUIA 4Y16C 4QXTA 1IGFL 3K5RA 5IVOA 4AVJA 2VZOA 2NT1A 4YHNA 5DHVB 4XDDA 3WEXA 4QCIA 4FF9A 2A5EA 1LDPH 1NPJA 1TIFA 4IC7B 4PYGA 4PR5B 2FX9L 5EU7E 2X4RB 1HCFX 1H3WM 2KKCA 3PE4A 4LESA 5J4MA 1H2VC 3B2PA 2D9CA 2DQ6A 1KACB 3NFSL 3VGFA 2GI9A 3FOLB 4WHYH 4TSBL 3AG1E 3KXFE 2E47A 3G2WA 3OZ9H 3H2PA 4LK0M 2MMXA 3ALPA 1HINH 4G59C 1FNWA 1G3NB 2D73A 5KYYA 1UTDA 2NS5A 3PHXB 4HPPA 1UCBL 3VGBA 5DHXB 3CZUB 3QXTA 4PJAA 1IEAA 2BNRA 5DJ2B 3HI6L 1F41A 1ZKAA 2BC4A 5EOCL 1JD9A 5AQBA 2AK4E 5IB3A 1X1MA 2V9RA 4C4KO 2IG2H 3DV4A 1NC4D 3WG7E 3ZDXF 2F1EA 2Y5CA 2DQHL 4FMFA 4WI0B 1FAKT 1VLXA 4IRSC 2CIIA 5KBKA 5FGRA 3PL6D 4X6EB 1V5OA 5FECA 1FAIH 1XXDC 3AU1B 5IF0A 4Z76B 5JQIB 3C98A 4OCSL 4OJYA 4R4BB 3QUHA 1CLOL 1G7QB 4XH2A 5C23A 1RZ7L 2OXHA 4YSYB 3L5XH 3NP3A 4GZDA 5B3JF 3N6YA 4ZYSA 1NCTA 3FQUA 5EB9A 2CNZA 1QSFA 3L1FA 4K9EC 4BH8B 1WTLA 2MW5A 2R69A 4OHJA 3V0JA 2ASQA 3D50A 3UC2A 4H2CA 4NAJA 3W11C 1VDGA 5C0CE 3T5VA 3ZNGC 2OCFD 3IDIA 1G0XA 5T5FH 1EAQA 5GGVH 4ZMQA 4P5MB 1XB3A 1XXGA 2XCMC 4H1LH 1N3NB 5DK0B 3NVYA 2XG4A 3RL2B 4NNXB 5FQ4A 3TBVB 2GC7C 4ZFFB 4XC1L 1GA2A 3A4RA 1NIAA 5FUCE 3JTTA 2XJLA 3MCYA 1I8IB 5AFAA 1T66D 2X4PB 4R97B 4ACPA 4FQJL 1RHFA 2I38A 4M62H 1TJFA 3DXAE 4GSRA 4FHJA 2BOCA 3GTTA 4W9HC 5EWIL 5A2LH 5SWQA 1N6ZA 2KJHB 3QG6A 3CFEA 5KJ7E 1FRDA 2MHAA 3NSYA 4JCLA 1QSEA 3NK4A 1Z1WA 4IRJB 3QUZC 1MFNA 1H3PL 4EN3B 2R69H 2KMAA 2JJTA 1FIEA 2A6JA 3WAMA 2XX0A 1E96B 5KBAA 2XTLA 1T0MA 3U9PL 1E6JH 1CS6A 2HTLD 4HUWA 4LOUC 3CFBA 1AS8A 2LTQC 1C77A 1Z66A 4B0MA 3QUXB 4MJ5B 2H3XC 2NLJA 3LHAA 4WI5A 2J0MA 3RT3B 4JN2A 3QO0B 3M6DA 5IHZA 1FGNH 1ITBB 2HX8A 4QTIH 2G4GA 5HP5A 5L2KE 1TTFA 1AARA 1UOVA 4MHHG 4PWGA 4R26L 5TE6H 3NTCL 2ZQKA 4LOEA 1NCAL 4IRZA 2NW2B 2PZIA 4LVNC 1CD1B 1PIGA 1FL6A 5CHVC 2RMNA 1X5FA 2LO6A 4W68A 3CVVA 3RO3A 5E8DL 1IYFA 4XXWA