2WXIA

The crystal structure of the murine class ia pi 3-kinase p110delta in complex with sw30.
Total Genus 276
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
276
sequence length
919
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVDCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The P110D Structure: Mechanisms for Selectivity and Potency of New Pi(3)K Inhibitors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
total genus 276
structure length 815
sequence length 919
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 2wxiA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wxiA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2wxiA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wxiA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 2wxiA04
4TUUA 4KZCA 1TJXA 1HE8A 4HLEA 2CJTA 3L17A 1UOVA 3F01A 3TJPA 2D8KA 2X6JA 4J6IA 4NPKA 3SD5A 3DBSA 1DJXA 3APCA 4ANVA 3QR1A 4V11A 4G11A 3ZIMA 3QR0A 2WXGA 1V27A 3ML8A 2CHXA 2WXOA 3P2BA 4QJ5B 4KITB 3N5AA 4MJJA 3PFQA 1BCIA 5H4ZA 1CJAA 5CCHE 3M7FB 3FBKA 2WXRA 1DJWA 2UZPA 4NP9A 4WWOA 4PH4B 4OVUA 1DJZA 2DMHA 2X6IA 4FA6A 4NPJA 1BYNA 1E8ZA 4OYSA 1UGKA 5CCJA 2Z0UA 4AJWA 2I9CA 3PREA 2NQ3A 2CHWA 5JHAA 5ANLA 2WXMA 4PS7A 2K8MA 5JHBA 2X38A 5ENNA 2A5UA 4EZLA 4OVVA 1GMIA 3PYCA 4EZKA 3JZYA 3ENEA 2WXNA 4ANUA 2NSQA 4EZJA 4WWNA 4ANXA 2QZQA 4LT7A 4FJZA 4ANWA 4L2YA 1W16A 3RDJA 3RPBA 4QJ4B 4FADA 3R7QA 3IM1A 2X6KA 4L23A 4NS0A 4F92B 3DPDA 4BFRA 2ENPA 1QASA 1QATA 5KJ7E 1YRKA 3R7RA 2X6FA 4XE0A 3NZUA 1UOWA 3CSTA 1DJGA 2YRBA 2YOAA 4IQHA 1E8YA 3ZVVA 3HIZA 3TWYA 3IHYA 5G2NA 2Q0ZX 4F1SA 3L13A 3L54A 2CHZA 2WXQA 1DJYA 4L1LA 3T8MA 4TV3A 2ENJA 3PS6A 2LHAA 3HHMA 4FHJA 2EP6A 2WXLA 1K5WA 4JPSA 2K45A 1DSYA 3QAQA 4FHKA 1WFJA 2FK9A 2K3HA 1DJHA 4TS6A 3OAWA 3PRZA 2X6HA 4WEEA 3W56A 4WAFA 3ZW3A 3L9BA 4UWFA 4LDCA 5CCGE 2R83A 2ISDA 1WFMA 4IHBA 3F04A 4UWLA 4ICXA 4DNLA 4HVBA 4FLHA 4URKA 2BWQA 3HN8A 4F93B 1BDYA 3ML9A 4XZ4A 2WXIA 2A4ZA 4L1BA 3OHMB 4QAMB 4PS8A 2Y3AA 2WXHA 3W57A 4Y1SA 4XX5A 5G55A 2KI6A 4WWPA 4QJ3B 5H4YA 2V4LA 2DMGA 5EDSA 2RD0A 3TL5A 4AOFA 2CM5A 3B7YA 3CSFA 1DJIA 2CM6A 1RH8A 4LCVA 1E7UA 1E8WA 4Y1TA 1CJYA 3L16A 3QK0A 4UWHA 1E7VA 3QJZA 4UWKA 2Q3XA 3L4CA 3FDWA 4PS3A 2N1TE 3NSJA 4UWGA 4FJYA 3LJ3A 2ENQA 3APFA 1E8XA 4GB9A 1DQVA 4BGDA 4DK5A 3L08A 2QZ5A 2ZKMX 2WXKA 3QARA 2K4AA 1A25A 3S2AA 5T8IA 2B3RA 2NCEA 4GNKB 3NZSA 3IBEA 3MJWA 2FJUB 4F91B 3APDA 4KZ0A 2WXJA 3GPEA 1TJMA 3KWTA 4ICWA 4FULA 3F00A 2CJSA 2WXPA 2JQZA 3KWUA 2CHDA 1E90A 1RSYA 3F05A 3LS8A 4A55A 1W15A 1RLWA 2WXFA
chains in the Genus database with same CATH superfamily
3HI1B 1K5NA 3C60B 1P0RA 3BP5A 5FYJD 4K3EH 2J4XA 1JGUH 5HYJB 1TT6A 2B77A 3CFIC 5HDQH 3MBWB 3C5SA 4HFGA 2W65A 4PJFF 3C19A 1T5KA 3W39A 4EVNA 4XEIG 4XC1L 12E8L 4F7KA 3CLWA 4LFHD 4YBLB 2V8SE 3JWOL 1H3PL 1J9RA 4HOQA 5ID0B 4TULL 2GC7C 4PCTA 3PV6A 3RQ3A 1NKOA 2B4CC 1A02N 3NQPA 2WNMA 1WD8A 2MX2A 1CGSL 3P4OB 4JA9A 5HHME 2D7QA 4H25B 2VZKB 1HOCA 2VSOE 3RX7A 2PM7A 1RZJH 1G7IB 2J20A 2NY1C 1TXKA 2DTMH 5D7SL 4XNMA 3RAJH 3MJ7B 4R26H 5SV3A 2HTLC 3PDOA 1QNIA 2JI3A 3MR9A 4ONFL 3Q6GH 4ELMF 2AEIT 4ANWA 1PLBA 3IJ7A 3HG1D 1M3JA 1QFWM 3RPIB 4DUIA 3DO4A 4JKWA 1FVEA 4B3EA 1KEGL 1SEBA 2EIZA 4FFYA 4MGXA 2XNAB 3TURA 2FIDA 2OCFD 4KKAC 2IDQA 2OSLA 4HUCA 4ZFHA 2N7EA 4X83A 1D5BB 4K71B 4GZ6A 5D4HA 4XNQA 1U3ZA 4JFVA 3UUXA 3PHWB 3VJ6B 1SE4A 1BFVH 3KYKL 3T5WA 2N7JA 2X4NA 2LTQB 1B9RA 4N2HA 3TBWA 4MAUL 4R9HA 4P0DA 2WO2B 5CR8A 5HGAA 5KSAA 3VDZA 5AQ9A 1OQOA 5TH2B 4K5OA 1YYCA 4N2OA 3BAEL 4JVUA 1M71A 4ELME 2W8CA 5A43C 4KRNA 2XN9E 4AC2A 1UADC 4YNDA 4NRXB 2ZAGA 4P46B 4LPCA 2CBTA 3W2DH 5TF0A 4S1SL 5GRJH 3VFPA 4N39A 4NENB 2KFKA 4P3CL 1GB4A 4LO9A 4L5FH 5IB5A 3RZCA 3L4UA 4I0PD 1H6EA 2DJ4A 5DVPA 4A7SA 4LCDE 5H4YA 3HC0B 1S5IH 1EF1A 1I53A 4HK0A 3RDTB 1RZIB 1IO4C 4NAWB 4M62H 4FXKA 4IRJB 1CMOA 3H53A 4FZEH 5CZXC 4QT5A 1LD7A 3VXSE 5EN5D 3IK2A 1YMHA 4GG8B 5E6IB 3C8YA 4WSGA 2WDTB 1IIIA 1SN0A 3ARZA 3IJYB 4NUJB 4X5XA 2R2EB 1X6LA 4TNEA 2WJ7A 1MFDH 3FF7A 4ZMYA 1VR9A 1CLCA 4UU9A 3SDYL 4EJ1C 4OD1H 3KEAA 3FB8B 4KXZH 1JWMB 1FNSH 3UYPB 2BK8A 5DRWA 3RIFF 5CEXB 1TNZA 5LGHH 2YMXH 3EDDA 3DKHA 2ARJQ 4JL9A 1AXTH 4ZO7A 1Y1UA 4MELA 2FB4L 3QZNA 4HKZA 1U92A 4PRID 3SFYA 1D9SA 3FTUA 1EERB 3C6SA 4LDOB 1CXIA 5IUCA 3AU1B 4KVCH 3X12B 3EO1A 4LVHC 2E75C 5EUKA 4HOSA 3HBQA 1ENFA 4EFOA 2WD0A 3TWWA 2QTVA 2D8KA 4HKQA 1A1MA 3NSCA 3RIBA 4PJAF 1ZT4A 3LRSB 4IKLA 2TAAA 3ARBB 4GTPA 2D3JA 2G5UA 2YA1A 3O9WD 4KTEH 5JOEA 1LO3L 3VYNA 3E30A 4NT6B 2X28A 3M7FB 2GSGB 4MAYC 1DFBH 3UPAA 5AUIA 1YPZF 4B0EA 3UO8B 4NPJA 1ROWA 1F13A 1ETB1 1E8ZA 5DYOA 1YNTA 1MYOA 2NUTA 2NBVB 1SJVA 3W38A 3R4RA 4GBXC 3PREA 2OZ4L 1OWOA 3MRKA 2OSLB 4ZG1A 2R0ZH 4XP9L 4LDTD 5C08D 4GA0A 2ADIA 3PRPB 3NZHH 4YUEL 3WMPA 2DYBA 2Z0EB 4MM3A 4JY6A 4Z7OE 3Q9UC 2RFAA 1O6TA 2LHDA 1YEFL 4DETA 1CDGA 2CDGB 2ESVB 3I6KA 4LBEA 2WM0A 3N9YC 1VERA 1BVNP 4H8UA 1ZK9A 2GT9A 4H88H 3RYTA 1EAJA 1N6UA 3KXFD 2NY6B 4WHTA 2W9DL 3L1OL 3SQVA 2P7TB 3GXNA 3O13A 1A6PA 3OKKB 1BOGB 3UJTH 5LAXA 2QQKL 1CYWA 3DXAB 1O9WA 4I6PA 5TE7H 3ES6B 2VTBA 5DHYA 3U0WH 1FXAA 5AJDA 4R3DA 3VXMA 4MQ7A 2CO7B 2IOLA 4N2AA 2YFNA 2NY2C 3S8FB 3HG1B 1OD9A 2RHEA 2B08A 5DZLA 1UCBH 3C5SB 4KI1A 4AVIA 3MROA 4BFEA 3O8XC 2RGFA 5GRXG 4H8PA 2CDEA 4U1NB 5H35B 4QTIH 4KKIA 1MCOL 1KY7A 4HEME 2FJSA 2D5GA 1KJMB 1E50A 12E8H 3PJSB 2AQNA 3SE8H 4BTBA 1L5GB 4ERSL 5I8OL 3K81A 4ZMPA 4P99A 4KRLB 4G1MA 3MRGA 3WTSA 3URZA 4HGWB 4LRZA 1LXMA 4Z7WF 1FWXA 2G30A 2HVBA 2W59A 3GT6A 4MJSA 3CSYA 5C0DA 3QJZA 5KSBB 1MPAL 3TVMC 2KNBA 1QF6A 1C7SA 2OMZB 3P4LA 2VRAA 1HDMA 1QYGL 3MLYL 4WK4B 5EC2B 5BOPA 1I42A 1FHNA 1OZUA 3HA0A 2GY7B 4P46D 5AVQB 4ACFA 3RO3A 1CG9A 3QZLA 5CP3A 1FFVA 2L76A 3KQ4A 3W9GA 2YQBA 3VUWA 3GJEA 3NK4A 3RUIB 3D0VA 1KFAH 4XBGB 4HGWA 5CHFA 3NA9H 1B4RA 2I32A 2J6WA 1Y07A 4C83A 4GQ9L 5IHWA 1DOYA 4FEIA 1LEKA 3B7RL 3DWLG 4TUUA 3DIDA 4Y4KA 3UF8A 1L3NA 2RIKA 2ZSVB 2DWSA 4M5ZH 4X0KB 2KXPC 5E7FA 2CDEB 1OWNA 4U1NA 2HTKD 4UINH 3AH7A 1YNKH 3VTAA 3C6LA 1KTCA 2UZYB 2QGDA 1JI2A 2WUBL 1QBML 3FAXA 3QJFB 3SDDA 4F2ME 3WS6A 1JCKB 2ONQA 2V9HA 3GSRB 4G7RB 2RSUA 1MRDL 1T3FA 3BYYA 4I0PA 3U2IA 5BW7A 3Q2LA 4M6OH 2XQYG 4KPHL 2AEPL 4ZT1A 1DBJL 4QOKA 3RI5K 3EOTL 3JUZA 1SUHA 2VR9A 4R7XA 1JWBD 3LH2L 4Q6KA 1SY6L 1DQLH 4ODVH 2IPTH 2A6DB 3D39B 5G5DB 1PGBA 2DIBA 4HOXA 5FZSA 1SN5A 4GN1A 2X1OA 4JIOU 1MCJA 3F5WB 2XPZA 4HUWB 4TN9A 2ZXBA 4DGVL 1EDUA 1DBAL 4PP1C 2BWDA 4PJ8A 4OVZA 3U7ZA 2XTSA 4XP4L 2LZ6A 2J08A 1FYTD 4FRWA 2P9RA 1L6VA 1HQ4A 1IAMA 1HF8A 3L7FB 5ALBL 2EMSA 4AV5A 1PIFA 2FLRT 4WI5A 1SOQA 2ENPA 2F54B 1YRKA 2ITDB 3OKDB 4BFJA 2VH1A 4AY5A 4Z7QF 3O9WC 4XNZB 1MEXH 3QORC 2CJUL 3TN0B 1IAIM 2Y24A 4NZTH 3RVTD 5HBBA 4XPHH 5HY9B 1ETA1 2CIKA 3IF1A 4GAFB 4KXZI 1M7DA 4NZUL 4OJEH 2IF4A 1JZDC 3DTDA 4KSLC 1XLNA 2IQAA 4XN5A 3ASWA 1R3IL 3PWJB 4KAQH 4BHUA 2RG8A 5AQAA 2YMOA 4FMVA 5F7BA 3HI6H 1MHPL 3OAWA 4GMTL 1QACA 4OZIE 1XF5L 5AWNL 5D6CB 1QZ2A 1EQWA 1AAJA 4YHPA 4QRRB 1QFUH 1KC5H 1ETZB 2BWES 1IAKA 3STLA 1YQVH 1BFTA 5I18H 5L83A 2ZGGA 3R2TA 2EQXA 5F7YC 2KLTA 4PY7A 3AE3B 1MG8A 4UIMB 1SE2A 3GZ1A 3DOSB 3E6FA 3QG6A 3VQ2C 3AS1A 4F7PB 5F7DB 5JMRA 1SVCP 5E99L 3EGXB 1KT2B 2YNQA 1GPXA 1KPSB 3WIIL 1A0QL 2VERN 1BP3B 2V2WB 4H26A 2ITCA 2QVFB 1WRFA 2F7PA 2JNZA 2XWRA 3EYQC 4LSTH 4OCWL 2Y5EA 3RNKB 1WFYA 1JFQH 4D0BA 2QQNL 4QOKD 4HRSA 5D2LB 1EU4A 1K8IB 4YSQA 1ORQB 2D31B 5D1QE 5M7QA 3UBXI 3VWJD 2IH3A 1FQ9C 3V0JA 4UQXA 4LNGA 1PG7H 3SDDD 3CHSA 2YRLA 5I1JH 1NC2B 1OARH 4JFEB 4M8UA 3LRKA 1F77A 1GAFH 4G71B 4TOYL 3DUUA 3KLKA 4EECA 1KC5L 4H26B 4N9OB 5LXVA 4HT1L 1UJKA 1N61A 2VDQL 4JN1H 3PV7A 4CGUB 3OXSA 2WLIA 3SEPA 3QUXA 2BINA 4DGWC 3AN1A 2DQ6A 4LK4A 3H7SA 1LMKA 3KPRB 4L8SC 3P02A 4UT6L 1G43A 4HJTA 3ZTCC 4J3OF 4CN6A 4JX0A 2LGSA 1YMME 4S1RH 5ERWB 4GH7B 4B93B 1JBJA 1OXYA 2BZCA 5JJ7A 1QQDB 2ZG1A 4XN8A 4IKNA 5AW0B 1G7JB 1UCTA 4F7TB 5KSAB 4MWFB 4QYAA 5L4IA 3PFQA 4AEEA 2IH9A 2EE6A 3UXFA 1E28A 5I0VA 3KHQA 4H1LH 3BINA 2AJXL 3MV11 2JJVA 2R69A 1CCZA 2GRNB 1TZIA 4OZGA 4O02B 3JWNC 3MRJB 5D72H 2H1PH 2Q8BL 3U4TA 4QYOA 5FX3A 5L6YH 3V0WH 2PXYC 5F21B 1KT0A 1A4KB 1VLXA 2DQFA 3DX4A 2IO2C 3JZYA 3HC3H 3N1GC 4JO4H 5C2UB 4N8CH 5TE4L 3CLJA 1RJYA 3C5JB 2WZPA 4F6RD 2EIJB 1TMQA 1PLGH 2HPTA 4HWEL 4UUJA 4HC1H 1SOXA 4CC0A 1XAKA 3MA9L 5BV7B 3IGKA 1BF5A 3QIUD 1XGPA 4FJVB 1N3NA 2GCYB 4JFZL 1GPOH 4LNRA 3TXAA 3VNYA 4B9JA 5C92A 3ECIA 2ZJSL 3H9DA 4XE0A 2G5BB 4PB0L 4PBVC 5AIJA 3SY0B 3HKZA 2WUBH 1IKNA 3KDPB 1KIUA 4J27A 3ZDYE 1GR7A 2CK0L 3WUZA 5J6SA 5C6TH 1DVXA 4J3XA 1E3FA 3QQ3A 1SFDA 1PIGA 2DYPB 2BP0B 1TEZA 2FEEI 4NB7A 5BVJA 2C0MA 1OEYJ 4NNXA 3CVXA 5INDB 5IW6A 5LWYH 1OL0A 4I0PB 3ZT5A 1S9XA 1NC2D 3OJDB 4BQ6A 4Q4EA 3R8BB 3QFJE 3MHZA 1I4FB 4LDTB 2XOTA 5J08A 3OPZH 3LN4A 1GTFA 3MRCB 2W07B 5E5MB 1NMAH 4XMZA 2IGFH 1AQDA 3GLDA 2KDMA 1KELL 4E5XA 2B0SH 4RZKA 1TTCA 2VZOA 4J8RA 2J8UE 3SIKA 4DGVH 5ENOD 1VF5C 2HO1A 4H8WH 4GQPH 1Z66A 2VRKA 1NFIE 2DEWX 4N9F4 5ISZE 4IDJL 1DQLL 4L4TB 3OXFA 5HTSA 3UPRB 3VXWA 2PR9A 5BZXA 4AUYA 1CJYA 5E4OA 1RHHB 2CMRH 1RUQL 3P0GB 4ZQKA 4LP8A 5CN3A 5JQHC 4WO4B 5FK9A 2IONA 3K80A 3MLSL 5I1LA 1QBBA 4A7TA 1CF1A 1ZV9A 4PBDA 3IV0A 1KJ3L 2ITEA 2IFFH 1T5WB 4EN2A 4CJ1A 2KTRA 5AQBA 3AU0A 4YHYC 4EIUA 4ZRQA 1NL0H 3GXUB 2B1OA 4YE4H 1N7MH 4FXGC 3PWPD 3AE4B 2EO7A 3K6DA 4XHJD 3O2WH 5ABAA 5EX3A 4JBSA 4NDMA 1HU3A 3Q5TA 3TV3H 2WNXA 4L8BB 3U83A 3F7RA 4W9GC 3B2DC 4OZIA 1IFRA 5CZXD 2CO6A 2VABB 5MEPB 4GQ9H 4HLEA 2D3AA 2EDJA 3REWA 1HTOA 5JIDA 2CIIA 3HKFA 3FQTA 4AVHA 3VD5A 5IHZB 1Z2KA 3RIKA 4CKVX 4MJID 1U91A 3BKJH 3ULUD 1UN9A 4JRYB 5AVZB 5TFSH 1LVEA 3A4EA 2BY3A 4HC1A 3AMLA 1FYTB 3CQFA 3HPLA 2E8ZA 3X11B 3FO9B 3PWLB 3VXMB 7FABL 3BK1A 2CBQA 4Y4FD 3B7BA 4RZCB 1C5CL 4JB9L 4HORA 2DMHA 3IDUA 5HHVL 3BZ4A 2XWTA 3K8LA 2QEJA 1YEFH 5ACMA 3N1YC 1IJ9A 1HCYA 2B15A 5IK3A 1J1XH 3KGSA 4Y19A 1PAMA 1R5WA 2QV2A 3GO1L 4AEHH 3V2XA 2AEHA 1OP4A 5JPMA 4MLPA 1JOIA 2OZ4H 3NABL 3A9KB 1ZT1B 2ICEA 4KHXH 3I3DA 4Z7VB 5A2BA 2VLLA 3GSOA 4M8QB 2H6PB 2FCQA 2AVGA 4WNQB 4ZMAT 4AH2A 2F7OA 4ZXBD 3KBHE 3TZVA 3BAXA 5IT2L 3TO2A 1K4DA 1OGAB 3G6JB 4Q8BA 1CFSB 3QH3B 1XO3A 4Y1AD 1MCPH 2R1YB 3PLUA 1DLFL 1RLBA 4NN6C 3MLXL 3WUWG 5A3IC 2GSGA 4OV5B 2C7MB 2EP6A 5IQ7H 1DSWA 2C4XA 2F7IA 4KTYA 1SPDA 4E9SA 1XF5A 3X0WA 2B1HL 4OLXL 3QXVA 3L1OH 4KVNH 4Y5VB 3VWJA 2LU3A 1KYOK 1JK9A 2M17A 2CD0A 3DX9B 4I1RA 2ICWB 3QI9B 4HCIA 5GGRB 3RTQD 4IJTA 1W72B 3H9HB 4POUB 5DA0B 2Q6WB 1U4AA 2K9XA 4HRLA 1DYQA 2E8YA 2EABA 1D7DA 3IU4H 3LB8C 2AW6A 3N9GH 4G1EB 2WGXA 1I1FB 1X5IA 4HWUA 4K7FA 3M17A 8PAZA 1KB9J 3ZGQA 1T4KB 1LM8V 2DF3A 5DJDA 5AAPA 4DK3A 4FNSA 1W72H 2GFBB 1H6PA 3BCFA 2WP3T 3DI2B 2R8SH 3O6ML 3DNKA 2P9IG 5LN8A 4Z7NF 2CM6A 4GDKA 3PEVB 1WPCA 4WU5B 3TG5A 5JHLL 5D9SA 4C9BB 5K1VA 1MQKL 2OI9C 1WAPA 5C0EA 3LZFH 5J11C 3RGVC 1JV5B 3NCFB 3VG0H 4ACPA 4YAQB 1Y1DA 4P3WA 3LPWA 1ZSDB 2ENSA 3SPGA 4BK5A 3EAKA 3Q4AB 1VZ6A 1BZDA 3LS4L 1BFSA 5CZRA 1WF5A 2GSIB 3L9RA 4PJEA 1KIPB 3WTVA 3PSEB 3G5ZA 2FJUB 1OCCE 4LAJH 1YMMB 2HLFD 4P5MA 4QHMB 4AYSA 5E2JA 4KKRA 1WJNA 3WNPA 2AXZA 1QRKA 4IOFC 5DWUL 4Z76B 1A7BA 4IM8A 4GMRA 5DS8A 1SLVA 3ZTDC 3QDMA 3C5ZC 2YGOA 5D5ME 2ZZPB 2XG5B 2QQNH 1HWWA 3KJ6L 3PY9A 2XVKA 1ZGLB 4OLUL 4WI0A 3FYEB 1NCGA 3MGAA 3N30A 2HVKA 3G2UA 1NCJA 1X5FA 3I2CL 3T6VA 4KNQA 1QEWA 4OD1L 3A0OA 3RRUA 5FS5A 2C3XA 2X4UB 3MQIA 3IU4L 4DP9X 5D7IE 4U1JB 2Z0DB 4LNOA 3N40P 2BKKB 4PLJD 5IV2B 4NJ7A 3L3KB 4UF7C 5HDRA 1NC4D 1G4MA 3ZHDA 4L8CA 2O1AA 1T0RC 1IGCL 1URIA 4PH4B 1QFUL 4J23A 5T1KA 4DHZE 3M1BA 5HHNB 5PCYA 4BAXA 3SKJL 3LSOB 3K2KA 4ENEC 1H8CA 4M7KL 1V1PB 4ALAC 4Z68A 4HXAL 2VJ8A 3TZVB 4K94C 5DD5H 1ZOYB 2RJMA 3N2JA 4DKAA 2GI0A 1WLHA 2HG5A 3OZKA 3IGFA 4PWGA 1HKLH 2BSRB 3JV6B 2J12B 1TLMA 3EYSH 4HWZB 2PPEA 3HCVA 2JX5A 1X4ZA 1ZJBA 5C0CD 1NMCB 2P26A 2YQ3A 1YG9A 2NPLX 5JO5B 2GHWB 1F2RC 1N59A 1BFOA 1B6UA 2R39A 4OJCA 1EHLL 1AHWC 3QG7L 3CSTA 1DJGA 4P2RA 4YBHA 5CLXA 2PO6D 5F9WC 1N5YH 2CNZA 5BO4B 2CLZB 1P3QU 2EE2A 2QKSA 5M94B 1D6EA 1BAFH 3LNHA 2ZYRA 4RZCA 4QRRE 2MNWA 2BY2A 4ZXBC 1FFNA 3C5ZB 3BCDA 3HPLB 5ITFA 1OWRM 2N7BA 4AK1A 2MQGA 3D25B 2KYIA 1INQA 1PGXA 1J9TA 2BHZA 2ZNWA 1AQHA 2APSA 3CUPB 1MWAL 1MSPA 3V4LA 2BSSB 1L0YB 3G3LA 4ENZA 3HG5A 3MV01 1LEKB 1MRDH 4TSAH 3B9KC 4JQVA 3MACL 1IAII 3CVIH 4M29A 3H6NA 3FUDA 3P4SB 2V17H 2Q1EA 4QUOA 1P1ZB 5KS9F 1WAAE 2JKNA 1RAMA 2ZX6A 5L88L 3CN4A 3WHXA 4XWOD 4A37A 3OMNB 3L16A 1E67A 2N56A 4G8GB 1F6AA 2FUQA 2P46B 4JRLA 3QFJD 4OCRL 4UAOB 4DBGA 1Z9OA 3B5GA 3JTTB 3LNEA 4P5RA 1OGPA 1Q72H 5D96B 3WN5C 1DDHA 1TTGA 2X53A 2DQMA 1RZGB 1JDCA 5B38A 2UWEF 1AANA 3W0WD 2ZF8A 4DWFA 3N1MC 2CDFB 2WXJA 2HTKC 3X1BA 1KJ3H 3HLAB 3MRGB 3WO3B 3TNMB 2MJ3A 1MVKA 3TBYA 5DR5L 1BX2A 2BBCA 4PJCB 1RMFH 4XP1L 1BXTA 1I85A 3FU9A 3NIGB 1NEKB 2IDTA 3QHZL 3S6CA 3U7YH 1IC5H 5FW6A 1Q9WB 4DQOC 2DQTL 5DEGB 4DPBX 1NLDH 3O3EA 5AW9B 1O7DE 2QTEA 3J7HA 4OM0L 3RKPA 5JPNC 4MD4B 3M8OL 1EJFA 1R4NB 3VFVB 2E27L 4RMQA 2VM4A 3AC0A 1RI8A 4JFYA 1X9LA 3IJEB 3MNVB 1GW0A 4MB3A 4RA0C 1NMAL 4HA1A 3Q8BA 3MRIA 1IEBA 3BKCL 2L6BA 4P2YA 3FHQA 4EEEA 3OQRA 3GJFA 1KJVA 2GI7A 3MKQA 5H7PA 1TS2A 2K8MA 4RMAA 4WKXA 5CD3A 4ZFQA 4ODWA 4OGAC 2ZXDA 1S3SG 2ZUQB 1G7PA 3SDCD 4EI5D 1JF5A 5B8CB 4WI4A 3RVUD 3OKOB 1JV2B 4PTTA 3I6KB 3WEXA 3TF7C 3O8XD 2Y4UA 1UXWA 1OWPA 2XTJC 3SDXA 3V79K 2KANA 2Y1VA 2FEEL 2WGSA 2C5DC 2R7EB 2I38A 5TDNB 1FIQA 8FABA 1BOYA 2OOEA 4O02A 4CMHB 1SJXA 2J57A 4XNAA 1GOZA 4K7UA 2VW4A 3RU8H 5J9PB 3E7JA 4WNJA 5LG1A 2VNCA 4BK8A 3C08H 3CHQA 1F8TL 2HH0L 1ZKAA 4EUPH 1GHFH 1H3VA 2AJUL 2R0WH 1DUYB 3TX4A 3T3MB 3TJEH 1CGVA 4U05A 5IWLA 3N20C 3PL6B 1MFWA 3QZWA 3QQ8B 4PGEB 3V8OA 4JFPB 3CZJA 5JW5A 1ZLSH 4A6YH 3QX1A 3WUWB 1UOKA 4L3FA 3T77A 3L9EA 3A23A 3QQDA 2Q87A 4GRWH 3UTSB 2XRZA 3OQ3B 2EDNA 4XMKL 2V8LA 4HJIA 1NBCA 3CXHK 3FRPG 2INCC 2UVFA 1HEZE 4ALAL 3K72A 4WUUE 5J7CC 5MEND 5D0QD 2NNAB 3CFJA 4R4BB 4RBPK 3RWIB 4W9HA 3ZRSA 1DOIA 1NAML 3B9VA 4M9PA 1W0WB 2EXWC 2GROB 5DGRA 2NY4D 4ZUWA 3RWDA 5DUML 3BRFA 4J5VA 4XXCC 1D5MB 2LV4A 3BMWA 4LSSL 3CU1A 4XB8A 3RBSA 3V4PL 1AHWA 1KLGA 3B7YA 2N9LA 2A0LD 2H0JA 1OAUL 1W72L 3CSFA 3FULA 1XGRA 2Y07L 4CSTA 3MCXA 1PZDA 5KG9A 4LJPB 4GDLA 1TFPA 2Q3XA 1D2OA 1TO4A 4CGTA 2EKJA 1AYFA 4ICVA 2FH6A 4L0PB 3UZQB 2VITB 3MODH 4JHUA 1BJ1J 4J8SA 4WTQA 3KPSD 3C12A 3VXUD 1I4PA 4JHKA 5IF0A 5IOIA 2BVEA 2ONDA 3GEWB 5HGDA 5HPMA 1FRDA 4GNKB 1TEGA 1JZ6A 3FYIB 3QO1A 4KZ0A 1CB4A 2XTJB 3IRPX 4XAKD 5BQ7B 3II1A 4KV5F 3HR6A 2NT1A 2WXPA 2I2OA 1GZPA 2AABH 3A3YB 3ETSA 3GSNA 3KWUA 4W9ZA 1I3RB 3DO7B 1BZ9A 3G5XA 4O5LL 2N0KA 1SDDA 4X57B 1FG2A 1QA9B 3ZQWA 4K3JH 1N8OE 1CTOA 4F57H 2UYLB 4M1DH 5IG7A 2Z92A 1OPGH 3NRFA 4OKVA 4IULA 1TVHA 4TVUA 5I30H 5DRXA 3EGRA 2VM3A 4A1GA 2XHEA 2VZ1A 3GTNA 1ZE3D 5K33A 4KHTH 4IOSD 1ED3A 1CL7I 4TQPA 4BQ8A 3PEUB 3PHSA 3BG0B 5IT2H 2ADJB 3H42L 3ULVC 2EYSB 2FD6H 3WALA 3QUML 3QWNA 5IGXL 3PDNA 4OD2B 5D7JA 1TQCB 2F19L 4F58L 3CHOA 2YXWA 3L95B 4FGMA 4OV5A 2EEDA 2JKSA 1F3DH 3B1UA 2KQ4X 4UOW1 1GGUA 3T8VA 2Z1KA 4YVOA 1L3WA 3F83A 3N3EA 4J3OH 5BZWB 5J89A 3FUMA 3ZTDA 1YMMD 4G9FA 1WWBX 2W91A 3UG5A 5HQ8A 5T1JA 1GY2A 2M83A 2IU1A 3UKRG 3VGDA 2F8YA 4P23A 1TQBC 3I6LD 3EIQC 3Q47B 1JPSH 1OSZA 1Q90A 1CL7L 1IGFL 1JV2A 3EU5A 1DQJA 2NX5E 2UWEB 3R1GL 4L48A 4PTTB 5BRZD 5BJTB 1Y18A 1NAKH 2WVUA 3WLWC 2D7NA 1KBKA 3L2LA 4PSPA 3BH9B 1ZHKB 3DTXB 2EADA 1TZGH 2VDOH 3KNBA 5CEYB 3B9JA 4UB0L 1HOCB 2PW2B 2BYEA 3AREB 4G6FB 3FOLB 1RPQA 3OR7A 3K6SB 3LXCA 2YJQA 3HVDA 2K8QA 1UGNA 3GJFK 1KTBA 4HPPA 2NW3B 2OXHA 1OTTC 4ZAKC 1NLDL 2QYUA 3TWYA 2R69H 3QWRD 2AKRA 3RAJL 4II2B 5CLZA 2VL4A 3UBGA 1RFAA 3O81A 4HK3J 4P4RB 1LP9A 3UAEA 1CGYA 1MCSA 3JBG7 2J0JA 1ZCRA 2YEZA 3EGDB 2W9EH 1MJJA 3RK6A 3QS3A 4R4NC 5FKAA 1DNPA 2XCMC 1I3VA 1EAQA 1UWGH 3H3PL 4ZODA 4MJHA 4LXFA 5SWZA 4EQ2A 5CCGE 5B3SB 5MEOB 1DJSA 3CHPA 3EOTH 3UC0L 5ISZA 3MRLA 4XN7A 2G0KA 3GSQA 3FCSA 3L8QA 2WB2A 1K5NB 4F7CB 2RACA 5D2NC 4KXKB 3GIVB 1YCSB 2XXGA 1JTPA 4H0LC 4CAGA 3HNTH 1SVBA 2IBZY 3AI5A 3LV3B 2CR5A 3CIRB 3HE6B 1YYLL 4JGJA 1XL4A 3VMPA 1UD8A 1MLCB 5D6JB 3OR6A 4Y5YA 5D7LB 3O0LA 1D5IL 5C9JA 4HCRL 4TNVF 1XQQA 5F3BB 5BYRA 3KJ4C 5LX8A 4YFLF 3ZXRA 1G7HB 3NSJA 3IMVA 3A6BH 3LJ3A 1V86A 1TQBB 3K7UA 1D6VL 1VEOA 3WA0A 3MOAL 1K1BA 1MZCA 2E9JA 4U4IA 3V4VB 5K9OB 4LNUD 3GZ2A 1P1ZA 4I7ZC 4PWKA 5DHEA 5I24A 3HAEB 3VFKA 3OPZL 2BZ7A 2MH4A 2E6PA 4GEJA 4IK6A 2W9LA 4R2GD 1DVFA 4BK4A 2WQ7A 4LCWD 1S46A 4O2EB 5AEKB 4U7KA 3RNEC 4ZAKB 1MLBA 4OIAA 2AK4D 5J3HD 2W0LA 1I8UA 2X0UA 1PLCA 2DBYA 4RIRB 3L4WA 1YYLH 1INQB 3M1OA 1QLBB 4NQCA 4S10A 4GOCA 3U66A 4WGVB 3SZKC 1MFMA 4WJ5A 3KLHC 2BT6A 4WIQA 1BGXL 1AZBA 4ZUVB 5ENPD 5C0BB 2KDFB 4BJLA 4MGIE 2VTBB 2F19H 2VR7A 4F58H 4ZFGL 1BPVA 2HX7A 3KAEA 5D2NB 5D7GA 2C5LC 2EVIA 3FQXB 4L4VB 4LL9A 2LRUA 3Q1EA 3T0XA 3P73B 4C8XA 4J4PA 4GKOA 2X6MA 3F7PC 3QHFL 5JHDE 4C4KO 2WDRB 2B5IB 4K0OA 5IN7A 2PTVA 3GEFA 2X5PA 2VRQA 5L2KB 2WYIA 5BJTA 5DLMH 4LHUA 4JY4B 3RWEB 1VENA 1QOGA 4P2RE 1TS5A 1T20A 1E0OB 2A9DA 4CDGC 4P7IA 3RNCC 4PQXA 1LQBA 2Q3ZA 2RTTA 3NH7H 5E6RB 5DVLA 3DO3A 1CICA 3ALPA 3LKOB 1V1PA 3Q2CA 1NPNA 2G60H 3B1TA 4FTDA 3FN3A 3VW3H 5AYQA 1KPRB 3T65B 2VZVA 3ZZLA 4PPTA 5FYKD 1G7MA 1UASA 5KVDE 2NLJA 4KK6C 4UT6H 3JWNE 2XIBA 1ZVSB 2ZXCA 4TNWK 1T0OA 1AO7E 1KLVA 2X2UA 2ZKYA 3KBEA 1WBXA 3WFCH 1CFQB 4I18A 2N9EB 1NCTA 2VDRL 4PBWD 3OMZA 2CCVA 1FPTH 1OK0A 4UTBH 5E4AA 5ERWA 3RE0A 5GS1B 1WGHA 2KN5A 1TVHB 4M8MA 1NAMH 1ZGLA 5ALCH 2ESVD 4MYWB 3NAAL 2FI7A 3K4DA 2K8CA 4MGYE 3SHQA 3FB5B 3H42H 3QDMB 5EORH 1BVLA 3FU8A 3TC9A 4RFEB 1MJ7L 2MP2B 4Q6IC 4RGNC 1L4ZB 4IKGA 1ZTMA 3QC5X 5DRWB 1O1TA 2H9GA 4LEBA 3CGTA 4ZMNA 3MLWL 2O6EA 3E3QE 4XNYL 2LW3A 1Q4NX 3L7EA 5IR1A 3WNLA 4JO3H 3GXIA 3TO4B 3PH0C 1RZKH 1PY1A 3FRUB 3OKEB 1G1OA 1CLOH 4HHAA 3V55A 1KTLA 3QDGE 4I77L 1HQRD 2MBQA 4ILDA 1XGRB 3IN0A 3ROLA 2V33A 5T33L 4JO1H 1YY9C 2Z7ZA 3NUHB 4YNYA 3V79C 3ILDA 1D5MA 3ZJVA 2V2WA 5E75A 4KVNL 3N6YA 4Q2ZB 4OF6A 4S1DD 3JUIA 2P1YA 1YAIA 4Z7UF 2VYIA 3KVQA 3NJLA 3TVMD 1LK2A 5FLUA 1E5WA 1W72A 2NNXA 4Y4HC 3VGGA 1E9OB 5DUBA 3VXOB 4NRXA 2C1OB 2CSPA 2KWCA 3PUCA 4XXWA 2YPKB 4UQ2B 5LHDA 4JL1A 4RCAA 3QQDB 4KUZL 4G8KA 2F5AL 4HGMA 2HZHA 4J4PD 3D69A 1MREL 4K1RB 2BS8A 5GZOC 4DP1X 3GDCA 2VDKH 2WW8A 1V27A 3P2BA 4AYBA 2VXQH 2IQAB 1C16A 3Q44A 2K22A 1ULVA 4YDLC 3O6FB 5DURD 4ODXA 4HIHA 3ZTCA 1T2XA 4GYBA 1I35A 3WIFA 1E5UI 1BD8A 3HOGA 1FH2A 4JZJA 5G04C 1DVUA 1R46A 2XS1A 1VGKA 1K4DB 1OGAA 3G6JA 2JCWA 3K0YA 5HKHA 5KTEL 3TM6A 4Q6IB 2HSIA 5KJ4A 1H3GA 4PRNA 3SKMA 3TBTA 3MRPB 2XWXA 3CK0L 3EJZD 4IBTA 1DDTA 4DLQA 3AY4C 4PIBA 4M8QA 3SYPA 4ODSL 1I1AB 3B2VH 1QZ1A 5DHXB 3BO8B 4XCNB 3F7VB 3ZYJA 4JY4A 3X2QB 4YHYB 2IGGA 4WW2A 4JFEE 1S7TA 3DETC 5T4YA 3IDXH 2IQ9L 3DPYA 1IGTB 4CC4A 3DRQA 4RDQG 3GQFA 2HJKB 1CTNA 2P8MB 1OCZE 3L5XH 1U42A 4KO7A 4YO0A 2CS4A 2FR4B 2A6IB 1YNLH 3MV3B 5ACZB 4A90A 2YRBA 1G9MC 5B3SE 5DGQA 3W1ZA 4S0RA 3BAIA 4LHQB 2VN7A 2PPDA 4OFIA 4GU2A 1MI5D 1U3JA 4FC8A 2YGVA 3E1F1 1B4JL 1I8KA 5A2LH 3VI4F 4P9ML 1WM2A 1AP7A 1M7XA 5EUOE 2C60A 2WZ0A 4TS6A 1I4HA 1OY3D 3K1DA 1I1RA 5CRVA 4HUVA 4B9KA 5C7XL 3O2WL 1HHGB 3IFPA 3W0WA 3S3DB 1AS6A 5HYJA 3UCRA 3MV8A 5KYNA 1XCQL 1ZTXL 1A65A 4LRNH 2FECI 3B43A 2EDMA 2DQEH 2F68X 2KZTB 2G2PA 2OMWA 2QFPA 3I3BA 3KWWB 4M61A 4ZW7A 3MRDA 3WG7B 5LN4A 4P5KB 4PGDB 3W57A 2LLGA 1BQHB 5KWYC 1J05B 5E8DH 1XR8B 5JZ7D 1L2NA 5KS9E 2IDYA 1JERA 2F54D 4DHJB 4WY7H 2XJLA 3BC9A 3QHZH 4X0NA 1GOFA 3BD4A 3H2WA 1FLRL 3O9WA 1IPGA 4K3HA 5DUPH 1L9OA 1J5HA 3HXDA 1E8WA 2PCFA 3EH4B 4XAWL 2BX5A 5DR5H 4FQ2H 5FV2A 3UMTA 1BAFL 4EN3A 5AW1B 5IHBA 3HN5A 1ZVYA 1I1AC 2QZ5A 5LXHA 4N0UE 3QARA 4TUMA 3MRRB 4LKCB 5KVGE 5I5RA 5CX3A 5CKAA 1N95A 3L3GA 1TCRA 1WZ1L 3BGFC 3ZYOA 2QKIB 1IGJA 4X7SH 2OZ4A 3V6BR 1I7TB 5AKVA 3JYSA 1TLKA 2K6ZA 3DX6B 2WKOA 3HMXH 2FCMA 2PQNA 1D5ZA 1FVHA 2ZKHL 1L0YA 4H1LG 1Q0EA 3EDKA 4ZOEA 3NVVA 4DHJD 2UU7A 3LDBC 4F3FA 4W9LC 3U2SA 1CK1A 5SWZB 1CFNA 4TNGA 3B7TA 5E9DD 3OAZK 4NO3B 5MEOA 1E7PB 1R4MI 1QVOB 5DD5L 3UBXA 4RGNE 4UQCA 4I0PC 3QI9C 3K2UH 1HKFA 5BW7C 2V8MA 3CFKA 5BMHA 2ZJSH 5GRVL 1BD2D 2CGZA 1QLRB 3UFIA 4ZHOA 1FBIL 1LP9B 2NQDA 2QR0B 2J5LC 3FC8A 2M26A 2PQRA 1SM3H 1X5XA 2BUGA 2FL5A 1PLGL 4MX7A 2OMXB 3GSUB 3U7WL 1AZRA 4UOQA 2G9HD 2EXYC 1QSEA 2INPE 3C3RA 1BFOB 1JFHA 4XMPH 1NEZA 4FA7B 1BOGA 2VQ1B 4JE0A 3KDMB 5ANLA 4G43B 5DJAB 4PG2C 1OZTG 3SGEH 1FL3A 1SHSA 4GP8B 3ZR5A 4ZJ9A 2DMBA 1LDSA 4AX3A 2YKLH 5F0MB 5IJKA 1YN6B 2ED6A 1CQVA 2GITA 2RMMA 4N0UA 3GZOA 3KJ6H 2VLME 5I8CA 2BSRA 1NOFA 2YD0A 5JR1L 2F08A 1G6JA 3TVMA 3M7OA 4E5XG 3BDYH 1ZHBA 2I7OA 1WA2X 1ZVHA 2XVLA 1VGEH 4PJAA 3NJKA 3UTPD 4D2NA 4HIQA 4JFOA 4YTNB 1DOXA 3RVVD 3WY3A 5LCWJ 2N1VA 2F5AH 4FXGB 4Y4FC 4G3YH 2I1KA 1KXQA 2M0XA 5DJCB 3DDGA 4IEFB 1JE6A 2Y4SA 3L95A 4GIPD 3BGMA 4C58B 3IMSA 3P63A 1AOZA 1H4RA 3L1GA 2NS5A 4MMZC 4B5ZA 3DSFH 3SHSA 3TA3D 3UG3A 3W9FA 2X4UA 4M7KH 3QIUC 3EYVB 3T2QA 3P4QB 4Y88A 5EUOA 2X7LA 3EIFA 4DPAX 5EE9A 4HT1H 2EKSA 1RY7B 4JREC 4FXCA 3FSOA 1NQBA 4I13B 3VMOA 4HU8A 1KCSL 4DO4A 3U0TA 1GJIA 1YJDH 2M63A 3SGJC 1N2RA 2DJSA 3WFBH 4AT6B 2V2XB 1A7NL 1SDDB 2J8UF 1RP9A 1YA5A 2O30A 3QDGD 4FLOA 3QUXB 3RD2A 3IBOA 2AL3A 4NQEE 5JJ6A 3SJVE 1GZPB 4XPBL 3AXCA 4A66A 4Y4HD 2XWZA 1Z5HA 4YFEA 4M5TA 3D30A 4DAGH 4KGSA 3FUIA 1F3JA 3L3DA 3QO1B 1N8ZA 1MKFA 4JFEA 3CDGB 2BO0A 4LCVA 5EBMB 4G80B 1MIMH 1OE3A 3QQ4B 3UQBA 3QZMA 2RDGA 4JAMB 5TK4A 2UX6A 4X80H 3PAYA 2R2LA 1KGYE 4I0CC 3V0IA 3LKPB 3CPLB 3NAAH 5CJBA 3PZ3A 1OQRA 3QUYD 5ESVA 1S9VB 1U2VG 3HJ0A 4GRWB 1YVLA 2C4FT 4JM2D 3WE6A 5I73C 2O6VD 4NAWA 3RT3B 2INNE 3W2DA 3VAEA 4K7PY 4X5PA 5DJDB 4QAYA 4ZUWB 5FJYA 3Q7AA 5T3RA 5GRWA 2R4RH 3FQYA 5D1QD 1BJ1H 1KCRH 1R3KB 4FFVC 4PD4J 3RWIA 4GBXA 1GZQA 4BSZB 1A7QH 4DVBA 2F8XK 4NX0A 5I1CL 1BI8B 3N1QC 5C0AD 1WH0A 2X3AA 1UWEH 5KNHD 2VDLH 5JQ6L 3SPCA 4YHPB 3HPJA 3NBNB 4PP1D 4Y5VA 5BRZE 2J8OA 1T3QA 1GZHA 4KOBA 5IHHA 2M56B 2QMJA 4KTDH 3QIUB 4LOVA 1LEIB 5A6LA 25C8L 3RSEG 2HRHA 1A5FH 3HMXA 4KU1A 5IHUH 2MRIA 3HRAA 3MMEB 4H4NA 1X4XA 3ZY7A 4B7LA 1BZQK 3Q3NC 3EH2A 4JDVA 4JFED 4U6XB 3RWHA 1DJZA 2ZXGA 4F7MB 3HRDD 3S88L 1N94A 3ZYLA 5KVFE 2I9CA 1C7TA 5LNDA 4R2GB 2ITDA 3OKDA 5DS2A 1PEZA 2JF1A 5TFSL 4NRYB 3JTSB 5TDNA 5IFHL 3TMPB 3S37L 4MJ4A 2R0KH 3HB3B 2HFFB 3J2PA 3LZQA 4ODVL 5BUPA 2LRWA 2X4RB 4W6WB 3RNQB 2R4SH 3MV7D 3OKOA 1R1CA 1MCFA 5L2KA 2WQUA 1V5TA 3C9NA 5DO2C 2MCNB 1O0VA 1S78C 4XC1H 3QHTC 5AD0A 2XHNA 3BPCB 3MRMB 4Z7NB 4H13C 2Z34A 4WF7A 2D07B 3N85H 2VJXA 2VZKD 3MRIB 3L54A 2VXQA 4UINL 3D4GA 2UXTA 3VH8A 4OQTA 5HYFA 4RFOL 2CCWA 4AJYB 4JFYB 1KULA 4AQAB 5H2BA 1NI2A 2BY0A 4MH8A 1UGJA 5IESH 3Q6FB 4IDJH 4OFDA 1CGTA 1FSKC 2JJUA 4G6ML 2YEPF 2F1AA 1XCQB 2BNRB 3C6LB 3H9YA 4PJDA 3RGHA 3KZ8A 4F3FB 4M7ZB 4RX4D 2PEAA 1MX6A 2K3UA 1UYWH 2KQSA 4X0KA 2QJDA 4H7YA 2Q7FA 4PJGF 3GMRB 3CFBA 4DUXA 1FDLL 2IADB 1AR2A 4O2EA 3WO4B 1Q8MA 2ZOOA 4AGOA 1KXVC 1QNZL 3NFPA 4P3DB 3DBXA 2NBUA 2ZCLL 3ABZA 3ZXAC 1SSNA 4NRZA 5IQOA 5ANMB 2NY1B 3SPJA 5F1OB 4FN2A 4HEA1 5DZ9A 3CK8A 1LDPH 2ZOLB 4HEPA 3OAZH 1KGCD 1KENH 2P8PB 1WM5A 4JVSA 3GD1C 3OKLB 4R2GC 1EA9C 3F8UB 4WFGD 4UWKA 1ASOA 3JTTA 2WM9A 3QA3B 4NHCH 4KKJA 1LO0H 4GFTB 3QOUA 4WKZA 4LG6A 1UD2A 3EU9A 2J8UA 4ZMVA 2IO3C 4TMPA 2JKRM 1M53A 3V6ZA 5DPRA 3RTLA 1OP5H 3N91A 1KTKE 4YXKH 1Z3GH 5GS2H 3FUNA 2GTZA 1TU2A 4JKPH 1WE7A 2TRYA 3QDAA 1F2QA 3FONB 4G1MB 5BXFB 4TKNA 4P3DA 3KH0A 2IQ9H 1ZDXA 1GC7A 1NGPH 3VD2A 3GMRA 3L5WA 1P4LB 5DD3L 4F7CA 1T83C 3UXGA 5I9QC 1AQDB 2ZSWB 4MXWH 2IG2L 4U6VH 5J90A 2VC2L 3GLEA 2GPZA 2BFVL 5CU5A 2BOCB 1HHGA 2WYHA 5IUSA 4H8WL 4PLOB 5FFOA 5C07B 4ECNA 3U6XA 3QZPA 5LBSA 2X6UA 3UJTL 5ITFB 2BZDA 5BRZA 1H8LA 1JQ4A 1SMDA 1G6RH 3IDIA 3K2IA 3KCWA 3SOBH 3B08A 1NBYA 2IALB 2XZAL 4GKSB 2W9DH 4YN3A 5I6XC 3DX8B 2Y7QB 1GUAB 1H3XA 3A1QA 5E9AA 4UMSA 3QUZD 4I2WA 4ZX3A 3NS1A 3RULA 1JYNA 1DBMH 1ITBB 1E27A 2R2BB 2VXQL 2P5WB 1A1OB 5ETUB 5JORB 4JLCA 4TM9A 3KYAA 5DQDL 1NENB 3LPOA 5H37A 5LAXB 4OIFA 3TU6A 4YUEH 3QDJA 3ZKSD 2EYRA 4MZ2A 1T04B 4QTHB 5FGCB 1KFYB 5E6IC 1J9SA 1OSPL 3PYCA 2F8IA 3C9NB 1U3HB 3RIFK 3WD5H 1IBDA 1R5VA 4LZKA 5CFAA 3RUGA 5I15L 5D2MB 1C9FA 3DVGB 3TESA 5FYJL 1UJTA 3INUL 1YY8A 1E0ZA 5G05C 5HJGA 5AVVB 4IDIA 3URYA 4GLSC 4MM3B 4BVUC 1AGDB 3RFRA 1N11A 4U6HA 1G94A 5T3XH 4YC2B 3LNDA 1PSKL 1KBVA 1HXYB 4N5UA 5ID1B 2Z4TA 3R7RA 3CKCA 1OCCB 1TDQA 1OLZA 2APFA 4NNYA 4Y16D 4YGVA 5F9OH 1ILSA 1EANA 2HFEB 4CILA 4U1HA 3B9DA 1JL8A 2Y69B 3CCHA 2KQ7A 2DD8L 4K81A 2KZBA 5I30L 2VLJB 3HC3L 3O6FA 1OPGL 1LM8B 3GSNH 3L3KA 4C4BA 5D7JB 1DBBL 2COQA 4Y2DD 2PYFA 3E2HB 2VGYA 1QLFA 3HR5A 4OZGF 3KPSA 1I3GL 3SCMC 1KRHA 2BYVE 4O1NA 4MH0E 1TQCC 4E0RB 2HCZX 1S4IA 3GBDA 2NOYA 3MOQA 4ZDHB 4QLRA 1R0AH 1KYOJ 5DUBB 1UA6L 5G04J 1VZIA 3KPMB 5KS9A 4QNPE 1IGMH 2APWA 1EZVY 3TH3T 2QHRH 2WN2A 5K9KA 4QXWA 2B59B 1KCSH 5EU6A 4WWMA 4G24A 1PD0A 3O41A 5EU7C 4N58A 4PJ7A 2LXMA 2MWSB 2D3NA 4H5SB 1ET8A 3JSVA 5DT1H 4AOFA 2GSIA 2FHBA 3AG1B 3CXDL 5CN1A 2P8LB 5HPMB 2BKGA 2VH2A 3BVWA 2JKJA 3LY9A 1IMHC 3CTTA 1SF0A 3IJYA 4N6RA 4NQED 1ORQA 4QI3A 4MNQB 1J5IA 4JAMA 5E5LA 1KZPA 4HX1B 1A5FL 1OT4A 2YUZA 5J12B 3GSWB 4CQNA 1A6VL 5EBMA 3NFSL 1YYHA 1MEXL 1VHPA 1THAA 4OW0A 4FQLH 4V1DD 3CX5J 5GJTL 4JFXA 1HFAA 4YC2C 1WSPA 2BHUA 3TPUA 1I1FA 1UWEL 1VJKA 1QO3B 2F18A 3VXRB 4F9LA 3RZCB 2KJ6A 1I8LC 5A40E 2I60L 4XBEL 1VZ7A 3EBGA 2WBJC 4WI9A 2F58H 3T8XB 5T3ZH 2QVMA 4NUGL 2E9GA 4F7AA 1F11A 4BXVA 3CZEA 2C9AA 5C6PB 3F58H 1B0IA 1BEYH 1FUNA 2BFGA 3EJCA 5F7UA 5KJMA 1I75A 1X5ZA 3O6LH 5JOPE 1CDBA 1WZ0A 2EVFA 2H6FA 3DYMA 2HM8A 5HD8C 3CH1B 1UJ3A 3ML8A 3AG3E 3T3PB 2FQEA 3RY5A 3KXFB 3RIAF 5ADOL 2EDFA 1GYUA 3SE9H 1GTNA 1JJUA 4YHNA 3TBCA 3HUJF 3MUUA 4F8PA 1HHJB 4PWJA 5HD8D 2XGOA 4NI3A 2CR0A 3DQVA 1EMTH 2EDYA 4PGBA 5D7LE 5DVKA 4DX5D 2BW4A 2ETBA 4POZD 4LGPB 4MSQB 1A7PL 4MDJA 4ELDA 5GJSH 1P4BH 3NIGF 3HXFA 4NZRH 3D85B 3ASFA 1X5AA 1K3ZD 3MR9B 4XI0A 1YJDL 2GITB 4DXAB 4Z7VA 2HVJB 2QPDB 3EECA 2EH8H 1R24B 3SDCB 4M02A 2XTJE 2UXFA 4XN4A 3A9JB 3KSLA 3VTYA 1ET5A 1LLAA 4I1NB 4Y5XC 2HN7A 3CQGB 2VLRE 4OGAD 1MVFA 5D71L 4RDQF 1KLXA 1I1YB 1OPOA 2N59A 3QWOB 4X6EA 5EO0B 4Z0XA 4EI5B 2MEKA 2WWKT 5EEZA 3WV0A 4K3EL 3W3BA 5BQDA 1O5PA 1ZB1A 5E2VL 3P3UA 4OW6A 4RQQB 1G0XA 3P2DA 2R29A 2Y36L 5D4IA 4JRYA 4WH4A 1N52A 5C07A 4H8HA 43C9B 1Q5WB 2A38A 3BAKA 5GMVA 1PKOA 2BF0X 2CO6B 3O3DA 4BH7A 4ZI8A 1AGBB 3VXME 4ZOCA 1Q72L 3JYBA 5D0OD 1D5ZB 3WJMB 3QWPA 2WTRB 4FMKA 4RGOS 4QRPD 3EJRA 1NDDA 3Q2AC 4QJ3B 2PO6B 3DV6A 4JG1L 1QRNB 2AV1B 4LQ1A 3CVWA 3L3GB 4HHGA 4XBGA 4XX1G 4MA7H 1A5EA 3UERA 1BU9A 1W8OA 1MVYA 1QFOA 1E6OH 3G6JF 3TWVA 3B2MA 5C09D 1KBBA 3OKYA 5HYIA 4XO9A 4QRTB 3KH3A 3Q7JA 4TUKH 3UAAA 5JHMA 4DDGD 1HSBA 3JSSA 2O26U 3NTCH 4DP7X 2C9VA 3OB0H 1CD1A 3MLZL 1KFAL 2OJWA 4YOKA 4AE1A 3OR6B 1SXSA 2QQKH 5AZ2L 2PO6A 4FNTA 3CN0A 3W5MA 5HHOA 4ZNEA 1L5GA 2NYKA 3MRBA 4U3SB 2KZTA 3FU7B 1JMZA 4FE9A 4A20A 2J0MA 1JVLA 1YZZA 4OGXL 5KSVA 1KZQA 4G3XB 3LCAA 2J4DA 3KEZA 5M95B 3CDCA 3ESNA 4B9PA 1XCQA 1V5OA 3L4PA 2X4SA 1KWGA 3TJHC 4R0LB 5L8KB 1THCA 2KH2B 2LFIA 3QR0A 5CP7B 3V0VB 2YEZB 4A7GA 4ZOAA 5I8KH 4KITB 2NXZC 4IRZH 3MNWB 1MELA 2D2OA 5IW1B 1QUPA 2DYPA 3W9DA 2X2JA 1TTFA 4YVQC 1NMBH 1TJHH 2B4CH 5HKPA 1UFGA 3ABKE 1CU4L 1CR9L 4AG4H 4NERA 1F4XH 2A6IA 3MYVA 3QRLA 5I8EB 5J0BA 3GUTB 2BQQA 1WVZA 4LIQE 3V6OA 2FBJL 3BSGA 2V3NA 2P8MA 3KH4A 2LGIA 1J8HD 4HXAH 1TNBA 8CGTA 5JHLA 2PO6C 1J1OH 1R24A 4JLRB 1N54A 1MCCA 3P77B 3U0WL 1S7TB 1TCMA 2BSTB 5F6HJ 4HHWA 1RUAL 3HFFA 4KVCL 4FQ1L 4M1DL 4MJ6B 2Z8LA 4G2VA 3F7VA 4X6DE 1LYQA 2KPWA 5C0RL 4JY6B 1SF3A 3V4VL 1A9EA 3D5OF 4C4VB 2AXFA 2C7UA 2AK4E 1KXTA 2QHLA 1IQDB 1BG1A 4LLWB 4ZBJA 3MRJA 2P58C 3OB0K 1I8AA 3PGDA 4U1SB 2J4BA 5TSSA 3FCGA 3SGJA 4GUCA 2EUZA 2PETA 3L1FA 4HIHB 3NESA 1PX8A 2VLRA 1JZ3A 3WFDL 4W1TA 4C0MA 3DBLB 1LO5B 3EF4A 2ACZB 1PW3A 1V2YA 1UJ3B 4XWOC 4KFZC 3QUMB 4JGUA 3VXUE 2ODIA 1UVQB 3CFDB 2NDFA 4U96D 2B16A 3IFOB 3RX5A 2JH2A 4U6YB 1BM3H 1X4YA 1CDIA 1DN0A 3C8DA 2J25A 3G6DH 3MGOB 3SZ6A 4NWUL 2DHZA 3D9HA 1N67A 3A24A 3D52A 3LIZA 4KO5A 1AKJB 2J3SA 5CJ8A 3GSVB 2KL6A 3ZMEA 3C6SB 1O6SB 5HI3C 4KTEL 3M3JA 1BZ9B 3CK0H 4NKMB 1BLNB 2H3KA 5IROC 3NCJL 5E2WL 1M1XA 1B0RB 1Z5LB 2FWOB 3VLFA 2GRQB 3DUUB 1JTTA 1CXKA 1FPTL 4UTBL 2OPCA 4WSJA 1OGAD 1NOLA 5GSRB 4A6YL 3JWDL 4L8DB 3VFTB 5I1KL 4Y5XA 4HQQL 2DLFH 1H2TC 5IEHB 3WDJA 3BKML 1JV5A 1FE8H 3PL6D 5BV7C 4GG8A 3ULAB 5B1BB 2WHIA 2KZRA 3TASA 5DVOA 3SQBB 1TTNA 2WXKA 4F1PA 1HIML 1FVDA 3TWTA 3QT2A 4OBRA 1G9EA 3S7JA 2V5RA 3RDTA 4PB9L 1OAKH 5IQMA 4ZMTA 4JO5A 3M17B 2JCCE 4XO5A 5GS0D 3JVGA 1KEGH 1A8ZA 2JXTA 2EIMB 2GW5A 5DZJA 4W9IA 1BWMA 3EO0A 5DHVB 5HGHA 4PY7B 5IOPB 4FZEL 5DLML 1JROA 5ANME 3HM6X 5KBDA 4YSXB 1OT2A 2GK0B 4C54A 4NQSA 4XMVA 1XVSA 2CUAA 2OZNA 1IGIH 1UOVA 4E0RA 1J7VR 1IFGA 3H7BA 5D6CA 3B13A 3K71B 1UB5B 2J7LA 2KCLA 1UJ3C 3CZUB 2D4DA 3OJ4B 3FXIC 5HGAB 5CHVC 1CU4H 1ZVSA 2RALA 1KDIA 1RZKL 4JRXB 1WEJH 1B0WA 1TZ8A 3KBPA 5D1ZI 5JLZA 3KPNB 5L2KE 2E27H 3CHMA 1I9RL 2CCLA 2FWSA 3NABH 1X9QA 2GIYA 3VFWA 4APXB 5MENA 1SN2A 3U0PA 3VFOB 3LN5A 5IHLB 1BFVL 3D39E 3E3QC 5JMOC 1QFHA 2H89B 4WWNA 1EHAA 1QUNA 1JZ4A 1WG0A 4ADGA 5I82A 4XWGL 3ARGA 4O4YL 1MXDA 4KKLD 4JPVH 4XCCL 1BM3L 3G5VB 1M7UA 2OR9H 3QDGB 2NY4B 2R02A 4DRXE 2H5UA 3JUEA 1ZPLA 4HB5A 1HSAB 3P4OA 4KIKB 4TUJB 4MQTB 4RNRB 3T5VA 3B8YA 4OZHB 1G7QB 5A2FA 1TKYA 4AEZC 1E27B 5ESAA 3PV6B 5ETUA 4AK2A 5JORA 3ZXPA 4BT8A 1JHLL 1YQ2A 4XC3H 1DL7H 4YHLH 4MRUA 2ZOWA 3R66C 2DTML 5D7SH 3W9DB 5IW1A 1YEHH 4N0CD 2J6EA 3ZKNC 1WI0A 1AW7A 3GI9L 5HPOA 2PABA 4LEUA 3BYYB 3Q14C 4QRSB 3CFKB 3NVYA 2VLKE 3TBVB 1KWKA 1OCWL 5C3LD 2X6VA 4D0CB 3VQLA 5M72A 4JFHE 1MF2H 1MCBA 4Q9QL 5HG2A 5EOTA 5FUZL 4TSAL 4HISA 2XVBA 2EICA 4Y4KB 4L8BA 4OZIB 2NYJA 1J1OL 4PS8A 3B2GA 3FAWA 2WXHA 1C8QA 4NDMB 3O6FC 4HK3N 4Z7WB 1E30A 1FLTX 2XFXB 3FONA 4GJTB 4OUUA 3UJIL 2B76B 2CAKA 4LLMA 1ZLWH 3H3PH 2OCCE 1YHPA 4H20L 5C0ND 2W60A 4DKEL 2IPUK 4XAKE 3VRIA 1UD6A 3DIFA 4N2NA 3JV0A 4HJUA 2ITFA 4B7IA 4XHJC 3ABMB 1PS3A 3AY4A 1S3KH 3WS3B 4LL4A 5TR5A 4PV9B 5L2JB 2FYYA 2LI5A 1XEEA 5DDHA 3TONA 3MUJA 5I16A 1MFBL 5J57B 3CSYB 5C0DB 1T5XD 5HI4D 2ZPYA 4GKZA 3NMEA 2L0IA 3IMRA 5GGSY 1IKND 4Z0BL 3BRDA 1TY0A 1S9KC 2ZOKA 1ZP0B 1WD9A 3AWGA 4TL4A 3OJMB 2H3NB 2HX8A 4S2SA 1BYOA 5BCAA 4GRLA 4J12A 1V1OA 3GC3A 3CXFA 4P4KC 4DEPB 1EWCA 1N0XH 4XIFA 1R34A 3Q9QA 2NSZA 1ASQA 3AT8A 3VX1A 2WO3B 4OZFG 1IGFH 1OGWA 1W0YT 3KYCD 4FYSA 1NVID 3KLQA 3MREB 5SX4I 5GZOA 5E5MA 3NUKA 3B95A 1R3JB 1D5XB 3GK8H 4M1CD 1V3LA 3ABKB 4W6YB 4XVSL 4OQTH 43C9A 4Q9RH 2CJOA 1Z9SB 3P40A 1DP0A 1I4FA 3AT0A 3PGCB 4YDVA 3UAFA 4Q9BA 3VFNB 5HHXL 1G9NC 3FNKA 3PLYA 4LLQB 2FSEB 1UWYA 5IJBC 3CR3A 4G8GD 1H6TA 4Z7VF 3SE4A 1CFMA 2B9AA 4C47A 1S78D 1HILB 3E34A 4GIAA 5DHYB 4NQLB 4EXKA 3SDAB 4HUUA 2CLZA 1XF4A 4FKHA 3LVEA 2R29H 3BVTA 5BRPA 2GEQA 4HV8A 3MRFA 1G7QA 5FKPB 4OFQA 5ACZA 5EOQH 3MRMA 1I1CA 1DVSA 3QCTL 2KQNA 3UTTE 1JMLA 1IEAA 5CEYA 3IAM1 3IDJB 2LU5A 1X81A 1IZJA 1VSCA 1H9VA 4NWTL 1X9RA 3LZNA 5FB8B 1PX4A 5SX5H 3KS0H 4HK2A 3MYJA 3ZO9A 4K4KA 1PX3A 1A4KA 4GSDL 3ZHNA 3MEKA 3MLPA 3F7YA 2OL3A 4RRPA 4Q6IA 3SKMB 3T3PE 2VDML 5D70L 4REZA 3GXDA 2VDOB 2W92A 4KKQA 3LSOA 1Q2ZA 3BZEA 2EXWD 1PLAA 2JELL 5L8LB 4PJ9C 2H8PA 1PZ3A 4JFTA 2K70A 3GS4A 4D9LH 4JRXA 3VD7A 2LHAA 3ALBA 2KCVA 3ZYQA 1HL8A 4OCSH 3U36A 1WQVT 4Q74A 3DSVA 2GY5A 4XTRC 4G50A 1NM9A 2FIKA 1Z9PA 1ED3B 2P52A 2YUWA 2ZAIA 3F6IA 4Q96A 1IQWH 4U1MB 1T0PB 3OJ3A 3C2AL 3ZDMC 2DWEA 3VG9B 1MWAB 1WFMA 1QPXA 1MJ8H 3RZCD 5G4NA 2UYLA 3K74B 1JWSD 4P2QA 4NO5B 2YS4A 3QPKA 3RNAC 4DDID 3VVWB 2J6EH 1NLBH 3Q69A 4M8RA 1WIUA 4S11A 5ANHA 1VKXB 4B9CA 1E9PA 4AV7A 2JKXA 2VTFA 4NOBA 2VW6A 4QHMA 5E6NA 1JFQL 4F7ZA 2I5YL 4U7EB 1ODUA 3HFML 3IGLA 3UINB 2IFUA 5ESVB 2D7TH 4MBGA 4KY1H 4ZYKA 2R2EA 3V0EA 1ZDVA 4I85A 4KKCD 4UTCA 2AV7A 4YAQA 2WMOA 1A70A 3R0NA 4J1UB 1OW0C 3RP1A 4I43A 1TNMA 3FTXA 4ZNEE 4A7UA 1G0DA 2IFGA 3QEGH 3VFTA 5AB0A 2NCMA 4Z78B 4HMCA 3O6LL 1N9PA 4U0ZA 1KCLA 2NBWB 1GC1H 5CNHA 2YQGA 3UTQA 4TUOB 4WFEE 1BZ7A 5E6SB 5FGBA 3MBEB 3FTZA 2IAAC 1HA5A 3MKGA 4W9KC 5BO1H 4Z3FA 1E2ZA 3H8NA 1CE6A 2EECA 4NO5A 3HZMA 4UNUA 1J7CA 1XCTA 5F6IC 3V52H 3V2AR 3D9OA 4O1PA 1V54E 4NQVB 1B4LA 2PXYD 4LNFA 5JXVA 1R75A 1HI6A 2E56A 5J17A 2M8SA 1D8EA 3ARSA 3QDJD 4ZPVA 2GOWA 2UY1B 2ATPA 1UA7A 5TGBA 2NYYD 1NCHA 2J1ZA 2JI2A 2SODB 3RVVC 4IRSC 2ZOTA 1ODAA 1UURA 3L5IA 3QUZA 4E9YA 4D10C 1YEEH 4WURA 3VH3B 3B5TA 5DEZA 3B0AA 1HXYD 2XZAH 1AE6H 3ARWA 3JTBA 5EOCJ 4J0UA 3LH8A 4JFOB 3NVWA 1T21B 3I84A 1KH0A 2G0LA 4X4MA 2VT0A 2CO3A 3WJJC 4AJ0A 1P9MC 5JIIA 1SEBB 2A7BA 1RK0B 3EO9H 3HC2A 3NJIA 3VXRE 4D9LL 2P3YA 1UH6A 2XS8A 2CK2A 1J5OH 3O3BB 4FLRA 5D96C 1J12A 5E6YA 3I6GA 3PDOB 4FDWA 4OFYD 2VGXB 4C56B 4YDNA 3NIFE 2MBBB 1VZHA 2JQMA 1NFDB 1NGWA 4YSPA 3QUGA 1I3GH 1SBSH 1Z7JA 2CU1A 1KJVB 1FFUA 1YJ1A 1HS6A 1BHGA 3BD5A 3GUTA 4KH2A 3ZMRA 4DCQB 4US9A 2BWIA 4KV5E 3TWUA 3AB5A 1AMXA 3QJTB 1OALA 2R0WL 3LEXB 1UD4A 4MX7B 3UQAA 1WGGA 5D5MF 4N6QA 3C87A 2L9BA 2VSDA 4NWTH 2ENJA 5HVWA 3NHEB 4JPSA 5GRUH 4ZUUA 4QDGA 3N41F 5H94B 5DI8A 3T0EB 3D0AA 3RL1A 1Z9LA 2EZ0D 2FJHB 1R3JA 3BW9A 1N9AA 4HPYL 3C60A 4LLUA 3AEAB 1I82A 3INUH 3AWEA 5DSCB 3ABME 5DRZB 3BT0A 1BX2B 4XN1A 3MJ6A 3FU7A 3KYNA 2WBWB 3MCLL 1HH6B 3R18A 2ZW1A 2F7RA 1ZUD2 2YPLA 1MPAH 2XZDG 3QPXL 4I6NB 3WXXA 2XBBC 4GXVH 1L4DB 4G6MH 1QBLL 2JJSC 4PWIA 4YHKH 1CR9H 1JIBA 1MAML 3ARFA 3MGTB 5B38B 5B7MA 5ECJE 1CG9B 1C3TA 4GMVA 5DDHB 1P7KB 3BFOA 4PS3A 3VYPA 2A9NH 1VACA 2OMZA 4BKLA 1E4WL 2MCPH 1X5YA 4Y7MA 4AQ1A 4IRZL 4GQRA 1IKFH 3L3HB 3QUHA 4US8A 4EDWH 3E32A 1ZEAH 3DIFB 5C0IA 5CR1A 1MHXA 1A47A 1FV1A 1HVXA 5BUGA 1R6VA 3RYMA 5GZOD 4UUCA 4IIQA 4EI6B 4G5ZL 4U6VL 3OLGA 4QO1B 4WNFA 4A55A 3MA9H 1EEYA 4V2BA 4AYGA 3WJMA 4YPGA 3K6FA 5DRZA 3K9OB 1QWHA 4LSRL 3NCYP 4NKOA 1J1PH 2GIXA 2JKIS 1N4XH 1ET7A 1AFVL 3V0WL 1R5IB 3BKYL 1K50A 2MIZA 4G23A 3DJTA 1WO2A 3UP6A 3DJZA 5I1IL 1UXMA 4MQ7B 1T1ZB 1FSKB 5KVGH 4OCRH 2KO3A 2PP8A 2VN6A 4Q9QH 2YEPB 3V62A 2E76C 1CFVH 4R4ND 3SKOA 2RCSH 5I23A 5L88H 4GTRA 1XSIA 3GDBA 2G4GA 5CZVH 4UT9A 3VXRD 2ZCLH 2YO3A 4YSUA 4D8PB 3HUJB 3BWUF 3REVA 1IGTA 3HG1E 1NFDA 4Z77B 1PAQA 5EOCH 4L3EA 4ANUA 3Q1SL 5F7HA 1AD9A 1VA9A 3S96B 1GS7A 4WV1A 3WNNA 1HHIB 3U3WA 1URZA 3JCKC 1A7QL 2CDGA 1I1AA 3O2VL 1MFEH 4Q56A 4OHJA 4Y8DC 2VXTL 1NUFA 1TJIH 5ICXA 1UD5A 3GJFH 3JTSA 3SBRA 4WNGA 4BFIB 5IVXE 1YEKH 3KCPB 2IO3B 1AQ8A 2O6VA 3SZ7A 2GLSA 3BPNB 3MXWL 1JPGB 5I1JL 4M48L 2LSVA 1NIFA 3C09C 1XTLA 2V9UA 1S64A 1AACA 2F74B 3NG5A 2O61A 3MMEA 3L3OC 3VFSB 3LVTA 2P45B 1W6LA 3FO1B 4NJ6A 3QG7H 2OEDA 2L4OA 2FB4H 4L37A 3VH8G 1JXKA 4Q94A 1K72A 3O6MH 4XHQA 1PKQA 4WEEA 3UGEA 1ZLVK 4LPUA 1OGTA 4TKWA 2G75B 4N4YB 3L9BA 4ZTEA 3DEOA 3WHE1 3OWEA 1NBVH 4KKBD 3RUGE 4G7QB 4URKA 2ZKWA 3EO1B 3GHBL 4A68A 3HXBA 2XG5A 4BFOA 5LBGA 5EE1A 3HE7D 4X6DB 1V5JA 5GIRB 4OB5H 4K9EL 3GHPA 3VQMA 1ILUA 2DKUA 2C3GA 2PWHA 1A7PH 2JJTC 3GSNB 1UZGA 2GKIA 3PNWA 3QUYB 4JDZA 4JZOA 5E8EB 5FM5O 4AMWA 5BV7H 1DQDL 2YD6A 3UJJL 1OXJA 2RR9A 3SFEB 3NQIA 3MLTB 1ELWA 2F61A 5AAMC 2OEVA 2ZCKL 2XGMA 5IQ7L 1FXIA 3LRHA 5C0EB 1Y6KR 2HT3D 4PP2B 4WW2C 2NXZD 1N10A 4NEHB 4LVNB 1SGKA 3MJ5A 1WICA 2K6YA 1INZA 3K4ZA 4FERA 4MS8C 3T0ED 2J07A 1B0RA 4HJJL 4CDHA 1AJ7L 1EJ8A 2X4QB 2MH7A 3QNKA 1I7ZA 4L1LA 2ZXWE 2K6QA 4GW1B 3E9UA 2E47A 5A1AA 4JZJC 4HBQA 2IO1B 2JY6A 3U0TB 4XN2A 4MDIB 4H8WC 1DC2A 3L17A 4QF1B 4KC3B 1FNLA 1NCAL 5TQ2H 4JHJA 3RILA 5IIEB 2ZJDA 3ONSA 1KCVL 1PD6A 1NCOA 1WGVA 2IANA 3BLPX 4AEHL 4WTZA 1XF5B 3AEBB 3PL6A 4HUXB 2WGNB 3LZRA 5CGTA 3U36B 1SY6H 2X70A 3U7WH 3R4DA 5EIIB 5FFGA 3A6CL 4NSKB 2EDBA 3LIZH 1KPRA 3MC0A 4HQDA 3LTVA 1N4SA 3JUYA 1J0YA 1WZAA 4U1IA 5GGVY 3BZEB 1UGKA 5CRUA 4R26L 2VGEA 1JPEA 5F70A 3VE0A 4X4YB 5JNYA 3VWKC 5DK2B 4FQCH 4GAGL 1JZGA 2HLEB 3KG5A 5FWRA 4MASA 4GSQA 2V1YA 2IF7A 1PZ2A 4PBXA 1SXTA 2IEPA 2FX9H 4IS6B 5EEVA 5I19H 3MO1B 5IW3A 5FQ6A 1ZV5A 4MJ6A 3EGSA 2ETCA 4OGYL 3T9KA 1KIQB 2APBA 2RPVA 2WX0A 5F7EH 1G6RA 4AM0Q 5HJDA 1KNOB 1T04A 4F2MB 3V4VH 1L6XA 1D2PA 1MHCA 4OLWL 1C9SA 3V4UH 2CR6A 2DQIL 1XO8A 2NY1D 4ZMWA 2MYOA 1OOWA 4AKPA 4DH2A 3DSXA 1OQYA 5DMJB 1WZLA 5C8JB 2L8AA 4PDXA 3QNYB 2XKNB 1KPUB 4DPRA 5IBUB 1VZ8A 4QHLA 4M48H 2KMAA 3MNWA 3BP7A 2EDHA 3IKOB 2CMRL 1DSYA 1U8JA 2K45A 4XPTL 2ZWLT 3SQOH 3X11A 3VFVA 4GKLA 5B7FA 2A0LC 5CP7A 3V0VA 3SDXF 2QQQA 3QNXA 3BT2L 3QC8B 4M8VA 4ZXBA 1RV6X 5T3XL 1WUZA 1UZXB 2J2ZA 3FTWA 1B6DA 1CZPA 1NMBL 3V4PB 3B6SA 4ZYSA 4NZDA 3QWWA 3BQVA 4D0DA 1WA0X 3BLBA 3QAZC 4ELKA 5BOZG 2A74C 2MQ0A 1P4LA 2DQEL 4PJCA 4LCCC 1E4JA 1LP9E 4HH8A 2LUHA 3ZKJA 3FUJA 1V55E 4E9XA 4IRZA 2IBBA 1W91A 3ROOA 3FT4B 2JXXA 4QTIL 2P42B 4IBQA 4PGZA 3B7UX 3CVUA 1HZHL 4WNDA 2EC9T 2QSCL 4Q89A 3RKDD 4RX4A 3STZB 2XICA 1OWWA 3WKPA 4R5VA 5KZCD 1PQSA 3KPPB 1U8KB 4F3VA 2IO5A 4GXVL 3UGUA 1WCBB 4ZW6A 3SOTA 2ZIDA 1ZPSA 1V7ML 3L3HA 1WP6A 3PWNB 2ASQA 4AXWA 3L4CA 4A1RA 1DEDA 2AC0A 3QUKA 4LGRB 3EJPA 5J1AA 4G8GA 1AIZA 3G5YA 7FABH 1V97A 3FTYA 4DZBB 4E68A 5BYQA 3NJVA 5D66A 5T8IA 2LFEA 3BAYA 4ORGB 1V9JA 1PY4A 3GB1A 4W9IC 4APQB 5C2BH 1P5VA 4YFLI 3Q3JA 2B2XH 1RVFL 2VXVH 2XT1B 3Q8AA 4L18A 4LSUL 2ZWYA 5ITBH 1QSFB 4DVRL 1ID5I 3NG0A 3WENA 4OF0A 4EI5C 3RWJB 4D0DB 1H15B 5ISZB 2WCGA 4O00A 4K7PH 5GS1C 5EF0A 3O4OC 1VJSA 1DCEA 3TWCL 2GW1A 5C0FB 4HUVB 2ZOUA 1AQKL 5DI8B 1IHGA 5EZJB 2VJ0A 1JNHB 2YPLD 5INDA 2R05A 4LERA 1XCXA 3D08A 5I75B 1HQRB 2UY7A 1AS8A 4HIIA 1IP9A 2WBKA 2R5SA 2UZPA 4RGNB 3F12A 4I9EA 1OIOA 3T2PA 2GUOB 1LL1A 5JIMA 4JDEB 3HW7A 3HNVL 4TUJA 5KANI 4UDUA 2BS3B 1NTDA 4HZLA 1OB0A 1A7RH 3QPXH 4EPZA 1S7QB 3KM2A 3Q8FA 2X2HA 3CFEA 3NJFA 4AKOA 1M9WA 3UGBB 3SQRA 3DDCB 2YBRA 3PQYB 1P6WA 1QWUA 1ZXKA 3H9SE 3Q2VA 2BCKB 3W1YA 3O11A 3AS8A 4CVZA 2KCKA 1FT2A 2LABA 1YEEL 3MRPA 4JCWA 4JN1L 3ZRCC 2DBAA 3KL0A 4N90E 1TKWB 2EC9U 4PHXA 1J86A 5F7EL 1HFUA 2G4EA 2J56A 4KNUA 2Q20A 1FZKB 1JCVA 2NR6A 3V5KA 2QPUA 1HZ5A 3CZKA 3M1BB 4L4TE 3OAUH 4JN2B 4L8CB 3IS0X 4L3AA 3N43B 1KTDB 2A73A 4HS8L 4KZDL 2JKTM 4HIXH 3D9KA 4CT4A 5FO2A 2E2EA 3PUUA 3IT8D 2G3XA 2W80C 4KVOA 3L5XL 4XNYH 5INCB 4UWFA 5EF1A 4UV4H 1FH5H 4OKVB 5T1LB 2PYEA 4V1DB 5K5YA 3NJNA 1W6WA 4NQSB 3BVGA 3CZSA 3S9DB 3BE1H 2YHEA 3U9PL 3I5JC 3LQMA 1A2YA 1FNHA 2ZUSA 3U1SL 2L7EA 1GJUA 3WKML 4Q7DA 5KBMA 1P0SE 4PVBA 4Z23A 1TIFA 2DIWA 3WL9B 4X8GA 1I7RB 4OY9A 1TQTA 1W0VB 2QLVB 1WWWX 3EW3B 1FNFA 1IAIH 2AJXH 1P7FA 1MHPH 4D3CL 4ARIA 1SVZA 1MCEA 5JPMC 5IHUL 3S3CB 4RGND 3BDXA 1F18A 3R9MA 1R9FA 2XPIA 1F4YL 4NZTL 3MLTA 3IBEA 1AZUA 3EG9B 4MD5B 3RFZB 1BA9A 4P23C 2APTA 4O58H 4FMFA 3CF6E 3RX9A 4W9RA 4KZEL 2BNUB 3DTUB 1T7XA 2VGLM 3D9MA 3Q3FA 1FIGH 2HRPH 2VQ4A 4A39A 1J7BA 1C5DA 1NDGB 3TEXA 4XMTA 2AHIA 3IDYB 2R23A 1WFTA 4B95C 4WU7B 1KCRL 2X1WL 1Z5SB 4V1DA 1WWAX 4HBCH 4L29B 4PT5A 2QSTA 4QAWA 1QFWL 1P4IL 5EBLB 4HCPB 5E4EB 2O2VA 4N2FA 2P9PG 4I2ZA 3CMOL 3AJIA 1WBXB 1L5JA 3WKMH 5E6PA 1KJTA 1MX4A 1LE5A 3FO1A 2APVA 1E4XL 2PVOD 2BNRE 4G6AD 4BH8A 2DVWA 3BGMB 2LUMA 3S4SG 1NBVL 1IYGA 1NBQA 1B0GB 3OG6B 1HAWA 4FXGA 1N0LA 2D7TL 1A14L 2WIIA 2YN5A 4JANA 4MNHA 4N1CA 2X3BA 1B88A 1FZKA 3GNML 1IZKA 1OV8A 3PGDB 3WXVL 2EXSA 3U7DA 2H0EA 3I3NA 5CCMA 2K7QA 2WWMC 2E3VA 3Q9PA 2MSPA 2XLLA 5F44A 5AZGA 3T5XA 3RPIA 3LVQE 3OAUL 1ACZA 1ORSA 5JW4Q 1A6ZA 2I1JA 3KPQB 4X6DF 2AK1L 3MOBH 5AZUA 3MXWH 3P77A 5TTRA 4DN3H 2BM3A 1YPZA 4MJ5A 4KX9A 5JPMB 5IMOA 5LDSA 3TT3H 4K5CA 4RDBA 4GRWE 1MCDA 1QTPA 3UAJA 2FAZA 3SO3B 1MI5E 3GJFB 2I69A 2Q7YA 4LBAA 1TBEA 3ZKJC 2A6DA 1I4GA 4KAQL 4EQFA 5TF1H 1A6TA 4XXCA 3V30A 2EYTA 1XXDC 4XVSH 2FL5B 2OW6A 2WTPA 4EKJA 2K9UA 1NUNB 2JELH 1Z3RA 3FDHA 2TSAA 1D9KB 2AEQH 3IDIB 5DVNA 1UTDA 4WJ5B 2QL1A 1LFDA 1BBDL 2WB1A 3G5WA 5E9DE 2N4FA 4TSBL 5I1AA 4YE0A 5FOBA 2L7UA 4LNKA 4ZFZA 4Z3GA 3T2NL 1Z9SA 1KTKA 3FQTB 4WEMB 2CNYA 1L9MA 4RIRA 3S8GB 3MREA 5MEPA 1QSZA 4N25A 2M1MA 4P5TD 5I1IH 3TBYB 1ND0B 1T22A 4Z7AA 4HIJB 3BVZA 3PHAA 5EBWB 1F00I 1RLFA 4N8VA 5SWZD 4DP4X 5DUJA 2K8BA 5LCVA 3RJDA 2DM3A 5FQ8A 3FFOA 3IDGB 3ZNZB 2DMCA 4Y8AA 1FNWA 1JNLH 4GTSA 4X6CF 4LKCA 3C98A 1AY1L 3HI5H 3WFEL 1DDHB 4P2AA 1B4TA 4QRPE 3GRWH 5CF3A 4GB9A 1G7HA 3BUDA 4YHOL 3ARQA 1HWGB 2OW7A 3ZFWA 4XKCA 2Y7OA 3VWKA 2W60B 3V60A 4L4TA 1KB5B 2N0MA 1FEHA 2MPVA 2WLNA 2KJRA 2L8JA 4Y4FB 3SR6A 4B0MM 4P16A 1MIEH 5BS0A 4KGTA 5FXCH 1X7QA 1JZHA 3QJQB 4M5ZL 1L5PA 3ZYZA 5KVEE 4XOBA 1WE5A 2GAZB 1GVIA 1U8QB 4JFWA 1QX1A 4A3TA 4ZX6A 3CUPA 3QXWA 4ZOBA 4Q4IA 5CHNB 5IFAH 5MHSD 1VD2A 2X10A 3J27A 3MV8B 1XR9B 2BNQA 3GGWA 3IJ9A 4PRDB 1LWJA 2J2ZB 3P11L 3IU3B 3MROB 2OVFA 2ZX7A 4D0CA 4HJGE 3GW4A 4G9FD 1MJJB 1UD3A 1RAXA 4L8SA 2ZPNA 5A7DB 2VWEC 3SPVB 5I6NA 2JTYA 4YVNA 1RD6A 4UM8A 2IV8A 4Y0GA 3QUXC 4F9PC 5FR3A 4JGMA 3VH8B 3GKZA 1NBZB 1DJWA 1Z6TA 2AKRB 1IRAY 2XKNA 3ZNID 4W81A 1U30A 5FYLD 1K53A 2K6DB 5E94B 5DUPL 3UINC 3BPCA 4NM8H 3FOLA 1N3NB 1J0IA 1CDJA 5CUSH 3S8WA 3VXSB 1YPZB 4MJ5B 4DQAA 2P24A 4YFDB 5AAMA 3W5NA 1KT1A 5FUZH 3TWSA 1CDCA 3CFMA 2YVCA 4QJ4B 1Z5YD 3IVKB 1CD0A 4U8YD 4ADJA 1OGSA 1RXLA 5H8YE 1KBWA 2F0CA 3D9AH 1PY0A 1UWGL 4WUUB 2CKBH 3VSUA 2QSVA 3NZ8A 4BWUA 4GA2A 4LEOB 3GXTA 5I2IB 1TETH 4ODHL 5GHWL 1B4JH 4PJCF 1EBAA 3ZZ1A 3HIZA 4OAUC 1TMCB 2WAQA 4JDVB 1NM4A 4FABL 1KN2L 3KLAA 5E7BA 4C0EA 3BUBA 3EHBB 5TE7L 2XUWA 1KLUA 2CG9X 5EN2A 1QLEB 1YC8A 3Q3OC 1R3HA 4FQJL 2FAUA 4Y9BA 4F8LA 4PJAE 3KWVA 3LRSA 3EUDA 3EYFB 2PNDA 5T5NF 3D69B 5I0YA 2OR9L 1VCBA 2QADC 1HI6B 1TZGL 1AE6L 2GVYA 4MSWA 4G6KH 2E9IA 1NIBA 4X9YA 3BUPA 1VADB 3G2TA 2DWTA 1LK2B 2W0FA 3QORA 5FYJE 5IOPA 4W9EA 4YPJA 4GKNB 1P7BA 1XZ0A 4M3JA 3ZGIA 3CLFL 4C59B 5AAOA 4TNWF 2XIIA 2Y5TB 2BB6A 2WLBA 1CD9B 2ATAA 2QPFA 4UOJA 1NL4A 2ZCCA 4X98B 4Z78A 3GRGA 5FPIA 3CVHL