2WXIA

The crystal structure of the murine class ia pi 3-kinase p110delta in complex with sw30.
Total Genus 276
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
276
sequence length
919
structure length
815
Chain Sequence
b'VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVDCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title The P110D Structure: Mechanisms for Selectivity and Potency of New Pi(3)K Inhibitors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 276
structure length 815
sequence length 919
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 2wxiA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wxiA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2wxiA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wxiA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 2wxiA04
1E8WA 4IQHA 1DJHA 1BCIA 4ANWA 4A55A 5T8IA 3ZW3A 2NSQA 3FDWA 3PREA 2X6JA 3FBKA 4JPSA 2ZKMX 2WXIA 2Q0ZX 3APDA 3DPDA 3F00A 3QJZA 4F93B 2K4AA 3N5AA 2CHWA 1E8YA 3M7FB 2X6FA 4G11A 2CJTA 1QASA 1TJMA 3L16A 1QATA 2V4LA 3GPEA 3OHMB 5CCHE 3HN8A 2B3RA 3PYCA 1E90A 4ICXA 3KWUA 2NQ3A 2QZ5A 4EZJA 4MJJA 3S2AA 4ANXA 4HVBA 1RSYA 3TWYA 3W57A 5CCJA 3IBEA 2X6KA 4XZ4A 4Y1SA 3CSTA 3ZIMA 4KZCA 3ML8A 3NZUA 1DJGA 3NSJA 3PRZA 3RPBA 3L54A 4L1BA 2Y3AA 3L9BA 1GMIA 4PH4B 2CHXA 4ANVA 2WXPA 3NZSA 5JHAA 4LT7A 2WXJA 5G55A 4UWKA 3F01A 4NPJA 4L2YA 2Z0UA 4AOFA 1BDYA 3L4CA 4QJ3B 4BGDA 1E8ZA 2WXOA 1K5WA 1DJWA 2DMHA 4UWLA 2FK9A 2K8MA 2CM6A 4Y1TA 2K45A 4FJZA 4J6IA 4QJ4B 3QARA 4OYSA 4IHBA 3IM1A 2R83A 1E7VA 2X6IA 3IHYA 4OVVA 4PS8A 4L23A 4EZLA 2ENJA 4ICWA 4NP9A 4QAMB 1CJAA 5JHBA 5CCGE 2WXQA 2X6HA 4DNLA 3CSFA 3QAQA 3LS8A 1DJIA 1DSYA 4V11A 4KITB 2WXLA 4FHKA 3R7RA 4NS0A 2K3HA 1DJYA 1W16A 3B7YA 3ML9A 3TL5A 4GNKB 4KZ0A 1DQVA 4LCVA 4UWFA 3R7QA 2WXKA 4WAFA 1DJZA 4FJYA 3QR0A 2QZQA 3OAWA 4FADA 4OVUA 2WXHA 4FHJA 4DK5A 2BWQA 2Q3XA 2YOAA 3PS6A 5KJ7E 2YRBA 2JQZA 3APCA 4GB9A 3L08A 2ENPA 3T8MA 4WWOA 4LDCA 3ENEA 1DJXA 2EP6A 3L17A 3MJWA 4F1SA 2KI6A 4EZKA 2LHAA 1BYNA 4WWPA 4URKA 2X38A 3KWTA 4QJ5B 1UOWA 5ANLA 2A5UA 2N1TE 2FJUB 3RDJA 2I9CA 3JZYA 1TJXA 2CHDA 2ENQA 1HE8A 3SD5A 3TJPA 4XE0A 1WFJA 2NCEA 5H4ZA 2RD0A 2WXFA 3APFA 2UZPA 4WEEA 3ZVVA 2D8KA 4PS7A 1UGKA 3PFQA 4HLEA 1E8XA 4FLHA 3P2BA 4FULA 4ANUA 1RH8A 3F04A 4UWGA 3QR1A 1CJYA 5ENNA 2CHZA 1A25A 4WWNA 1W15A 2A4ZA 4TV3A 1V27A 4FA6A 4F91B 4TUUA 4UWHA 1RLWA 1YRKA 4PS3A 1UOVA 2DMGA 4AJWA 5G2NA 2ISDA 4XX5A 3F05A 3QK0A 5EDSA 1E7UA 2CJSA 2WXRA 3HIZA 1WFMA 3HHMA 2CM5A 5H4YA 4F92B 4TS6A 2WXMA 3L13A 2WXGA 3LJ3A 4BFRA 4L1LA 3DBSA 4NPKA 2WXNA 3W56A
chains in the Genus database with same CATH superfamily
2X4PA 4P23B 4K73A 2ADGB 2VZ1A 1NKGA 4HUCA 4PG2C 4GI9A 4A39A 3CCHB 4EPZA 1VDVA 1LO0L 4AC2A 2DW5A 2WXIA 2XWJA 1J5OH 2G3QB 3B3IA 2D03H 3RA7L 1AZUA 1CD1A 2HN7A 2OP4H 1YMMA 5G05C 1T0NA 4MNQA 1IKOP 4GQQA 1JV2B 1ICTA 1ZLWH 1NCDH 2MNUA 2EUWA 4EZJA 2VL4A 1SVZA 2PXYA 3PTFC 1MQKL 1VEMA 1BV8A 3O3UN 2VWEC 4YPGB 3BPNC 2Q7YA 2K8QA 2MCPL 2LJ5A 1IAIM 5BRZD 2PEAA 2JELH 4XPBH 5HKHA 4AENB 2N9KA 2BOBA 2EVJA 4NFCA 2CLRB 5IJBC 3LZFL 1WT5C 5F6HJ 1F2QA 3F6QA 4PHZA 3BPLB 1UCBH 3LMJH 2DMHA 3RYMA 2LXCA 3NRQA 4LKCA 1E6OL 3NVQA 1NC2B 5KVGH 5D6DA 2EABA 2NTSA 3FTVA 5GRVL 3ATAA 4U1NA 2XPZA 3ZDXB 3S37X 4XX1G 4FFYA 4GKSA 4QAMB 3FULA 1XR8A 5JHDD 1P1AA 4ZS7H 4AQ1B 1RZ7L 1KT2B 1A5FL 4JFHE 3FQWB 3ZNGA 4K81A 4U1GC 2J49A 4XNAA 4TXPA 2OV8A 2EIEA 3QDMD 1VR9A 3GO1L 3FRUA 4FDWA 3TBLD 4JHAL 1BW8A 3BEEA 1WEJH 4JR9L 2W95A 2VSOE 1M71B 5EBMB 2WLHA 3TJEH 4HOMA 3VGAC 3GTNA 5CGTA 1EO8L 4FHJA 5C9JB 5E7BA 1AFVH 3PS6A 5L8JB 1IC7L 1F6LL 3RUIB 4EKUA 2DIEA 3MRPA 2F53D 4WNSA 3PWNB 3H3PL 4OM1L 4RF0A 3LNEA 4F6RD 3CFKA 2B1HL 5BS0E 3ZTCA 1KBKA 3N85L 1P98A 5G05J 1T4KB 5EOQH 2OJEB 2FNBA 2WZ5A 4UDTB 1WJUA 2CBTA 5AL0A 2P48B 4N6RB 1WE6A 4G42B 3VB8A 1J5DA 2MOGA 1YN7A 5L95C 3C9NB 2TSAA 3TJPA 3KLDA 4K5OA 3R1GL 3ULUD 5CERB 4QTHB 3RVTD 1D5BA 2BP8A 1A65A 5IY5B 4FXKA 2DLFH 2J72A 4IIZA 1O0VA 4OKVB 1M42A 2VXQH 1H6PA 3RX8A 4N3TA 5AB0A 4CDHA 1WBZB 1YEIL 5DSCB 2PE9A 3HBPA 4WY7L 1ENFA 4ZPVA 3WGVB 3DMMD 1UGNA 2KFKB 4A3OA 3RVUC 5DQ9B 1RJLB 4RAVB 4E9WA 2HT2C 4WTWA 2NY4D 5FKPA 3RO3A 1BD8A 3B34A 4DSYA 5TDOB 4I6NB 1TJGH 3QHTC 1PVHA 4KJQD 4R2GB 5CKGA 4QIRA 1DYQA 1N5AB 4IHOA 2K7QA 3TFKD 4F8LA 4XZUB 3ULAB 4DQAA 1VAHA 1Z32X 1O1RA 1PY9A 3SE6A 3T3PB 5IBUG 5DPTA 2PTTA 3FTWA 4J3OD 5J6GA 5FO7B 2VKXA 3OC8A 3HC0A 4I1OB 5EN5D 1Z9LA 3HCVB 3HS0A 4PBDA 5F0MB 1MREH 3GMRA 3AH7A 4Y2DA 3NQIA 1E9QA 4QTFA 5AVVB 4Y9CA 4AMKL 2Q10A 1NGXA 4NO0D 1D5ZB 2WZPD 3SPHA 3ZEFA 3FJTA 1FWXA 4WO4A 3VXPB 25C8L 3ZRHA 3WIIL 3SYAA 5EH1A 5J13B 3D3MA 1NOLA 1JROA 4L8DB 3P30L 2V2XA 1IC4L 2QMJA 2BUGA 5C0ND 4GDKB 3ARVA 5AD0B 4K5AB 1RY7B 2DTML 2WYTA 1XLPA 2WVSA 4N9F4 1HTYA 3EG9B 4ONGL 1R24A 1ZDVA 2FX7L 1U3HB 1I9IL 4HCGA 4OD1H 5GGTH 1HTQA 2FECI 5IHLB 1ORSB 5KVDL 3C3RA 1HKLH 1FCHA 3CMOH 1BEXA 4GW1B 3L1OH 1IBFA 2HJKA 4JFEB 4QRUB 3UAJC 4GUCA 4BFJA 3LV3B 2XFXA 5FUCE 4CMHC 3CZUB 3J8F7 2WV3A 5C0AD 3D25A 4PG9A 4NIYE 1BYOA 2GJ6B 3DSUA 4JFOA 4P2RB 2UYLA 1JGEA 1YEJH 2JIXA 4LDTD 2NY3C 4NRXA 3JVZX 3MLZH 4M1CD 4NO3A 3V7MA 2BKRB 4XVTH 1A9EB 5F93C 3ZDXF 2RR9A 3AACA 4MJSB 5L7XH 1II4E 3MX0B 1WJ3A 1OD9A 3CSBA 5AB2A 1O9ZA 1AWDA 4G6KL 5FGCE 1ZLSL 1NVID 3QUMA 4NUJB 2D3GA 3KVPA 3TUOA 3NJXA 4D0CA 4LQFH 5E1QA 4P46A 2XTJC 4XI5D 5TQ0H 2FCQA 2R29H 1SEQL 3EGSB 1ED3A 3QH3A 5CN1A 4LQ1A 4GMJA 5JLZA 1R1CA 4IBSA 3QHFH 4C00A 1JWFA 2HVJB 3O65B 2LSUA 5IT2H 3UIPB 4S1RL 5EF3A 3F65A 3UYOD 1YC8A 3ROOA 2NC9A 4L3EB 1RLBA 5JYLA 5KUMA 2OS7A 3E9UA 4OD3H 4UQCA 2CGRL 5LCVH 3V6OE 1FSKC 4YAQA 5EX3A 1TJIH 2NRDA 5EU6B 1NFIE 1B3JA 1NBVL 1IAKA 3CFBB 1ZLDA 3F7VB 1C08B 2EUVA 4HIPA 4D9QD 5ADOH 5TSSA 2BM3A 1YJIA 4IJ3B 2ZOTA 2GHWB 1G7MA 2IWGA 1YYML 4Z5RB 1UWYA 2Z31C 1ORQA 5T1JA 2OPCA 3ILQC 4UT9L 1OD7A 5SWSE 4OTXL 1BEYL 2E8YA 2BSED 1QBLL 3QISA 1YQVH 2ESVE 1WFMA 3QI9A 4ODSL 3S0PA 4P1BC 3M1CA 3L3HA 1MJ7L 2DQDL 3SBTB 2UXTA 4I13B 4L5FH 5FYLE 1N0LA 4IRSB 4QXTB 1UB5B 1H5BC 2X44D 1RJYB 1ZLVH 3X13A 5CP3A 4L0PB 4MMZB 4KFMA 3FONB 1ZKHA 4N0CC 1Q9OA 4JRWA 4RGMB 1I4RA 3ZW3A 1T7YA 2NR6A 3DX1A 3KJ6H 5DFVD 2WMPB 1RK1B 4HK3J 2X6JA 4DX6D 1NJ9A 4PLJD 1HXYD 1L7TL 2ZKMX 3T3PF 5CIPH 1NCBL 2XJKA 5I6MA 3GC3A 4USAA 2R9HC 4U96D 4RGOL 1N0XL 3WN5C 3QC5X 1AIZA 5DRNA 2JKIS 2O5YL 2EE2A 3FRPB 4ZXBD 1TJMA 1P7KA 4K0RA 5A6IA 2KMMA 2HAZA 3HRPA 1WCQA 3QDAA 1Q1JH 4AE0A 1GZPA 1SFHA 3IHPC 4U0QB 3O8XC 3SGEH 2X1QA 2Z7YA 5DRXA 1EAOA 4G8GD 4TXVB 1TCRA 3MMEB 2P5EE 1P5VB 3LPPA 4NRHB 2EZ0C 5FM4A 5I1HL 5CEZH 2KANA 2BSTB 4HX1B 4X4MA 4N5ED 4LNBA 2YXFA 5CD3A 2BHYA 4AVIA 5KVEH 2AITA 4OGZA 4BZ2H 5A6LA 4UYPA 3E0GA 4QRRE 3AY4A 1YPZA 5D1XB 4C55A 1R3HB 1T83C 3D09A 4FF9A 2A0LC 3V0FA 5JYMA 4R0LB 4E41B 3DVNU 5KSBE 1X6LA 1VGEL 5F8RC 4ZQTA 2BYFA 4GW4A 4MNHA 5HGHA 4ACPA 1N5XA 4LPVA 1QFUH 3DX8B 2EMSA 3OG5A 3L48A 1SUHA 2Y4UA 1S7XB 2PQNA 1G6VK 2CUHA 1D3CA 3CK9A 1S8DB 5DMGD 4NAQA 5F0LB 4YHPA 5F89A 5K59F 1UFGA 4HJJH 4OLXH 3J9CA 3NK4A 4GTPA 3SYCA 5KJ7E 3A5VA 4ZS6D 2AEHA 1ELWA 4AEZC 2R69L 3UH8A 5I28A 5HDQH 4V1DD 1RV6X 2X3AA 3TGXA 2NXZC 4OZHE 3KBPA 3DOWA 2VIRB 3GMNB 3KYDD 2FBRA 4PRAB 1AGCA 4HWBH 3FT4B 4BETA 2A6DB 3EH1A 4I6PA 4H7XA 1IAMA 4N8PA 5SX5H 3OMZA 1XSJA 4P2QD 3F84A 2WTRB 1HSBB 1ND0A 1ZA6A 2R59A 2VISA 5KNHD 4HCRA 2IMNA 5AG8A 1UCBL 3DNKA 4QRQB 5ISZB 4KH9A 3GMLB 3CIAA 1RCYA 4MQXC 3ATEA 4WQMA 2VMJA 3W2DL 4GTVA 2OJZH 3TX4A 2ZG3A 2BYVE 2J8UB 4U1SB 1T5KA 3LEVH 4HSAC 4HLEA 5SX5K 2CR5A 2FHBA 15C8H 5CN2A 5J56B 3VD7A 1W8EA 6CGTA 4IK6A 1USZA 1V27A 2QADB 3DX0A 4X7TB 4Z7WB 3DWTA 5JJTA 4K9EC 4Y6WA 4P4RB 4PLKC 3Q06A 4Y7MA 4I2ZA 1GXEA 5D5MB 3IXEA 5C0BA 4Q96A 3BYYA 3PJLA 5I76A 4KY1H 2BKGA 4K2UL 2D31B 5F1NA 2X9XA 4HWZB 3DVGB 2DMCA 3O2VL 4HB5A 4JQIL 2JCCE 3KS0H 1OE2A 1JZ5A 1IFRA 2QSTA 3Q2NA 5GGRY 4ATZD 5DZOA 1NANH 4PJ6A 1KJMA 1MHPL 4OFKA 4WKZA 2B8OT 1GMEA 4DP8X 3IWVA 3N1XC 4P5RA 1PIGA 3N71A 4LNRB 3VXMD 1OWOA 1MRDH 3VXUA 2Y22A 1MJDA 1AQDA 3V6ZA 2WGNB 4KVGB 3QYNA 1LEIB 3VM7A 1PKOA 4NN6C 4UM8A 1I4XA 3Q1SH 4X9HA 3D39B 3DJTA 1M4KA 1HJCA 3EU5A 1XGZA 4UNIA 1IAOB 2N9XA 2NYKA 1F58H 4YWGH 2D5GA 2M1MA 2NYJA 2M83A 3TO4B 2DLFL 2D7QA 1H6KA 3OR6B 3KPRE 1WC7A 4LBAA 4JO8A 5DVPA 3ZYMA 5E1HB 3VGDA 4RFOH 2CHXA 1EEZB 4TTGA 2R2EA 4GKNB 1SXBA 2ICEA 1A14H 1HZHH 2NTSP 2OMVA 3GSXB 3AMZA 2GITB 1XQQA 3D3VB 2FSEB 4KDVA 2JWZA 1KBGL 2MQ3A 2FK9A 1N59B 2J88L 4MGZE 3FU8A 1DN0B 1F0ZA 3FB7B 5I26A 5GRJH 2VQTA 2B5IB 4PJAA 3O6FC 4Z7VB 3B1LX 2JKSA 5CJQH 1KZYA 1FO0L 3BUYA 4G1EA 2KZRA 3BP5A 4I6EA 2V37A 3R0MA 4U7EB 1W0WB 3IFNL 2AF2A 5BZZA 2ZSVB 3D9HA 3SKNA 2VLRA 1JZHA 4KZ0A 5F9WB 1ZDQA 3FQUB 1FZMA 2LU7A 4KDTA 3MCKB 3MFGA 2UU7A 4GRWE 2YPVL 4RMVA 4K7PX 1PF3A 2O61A 2E7HA 2HVKA 4L37A 2GYSA 3FCUB 4R84A 5HYJA 2B3AA 4B9ZA 4JN1H 3VWJA 2HT3D 5B3SB 2E3VA 3NGBC 7TAAA 4LVNB 3L17A 4F58L 5DR5H 5GGTL 3RAJH 1FIEA 3OXFA 2BZ7A 1HKLL 4U1IA 4G8FB 4D7PA 1JCKB 3WEBA 2L05A 2F8YA 2AXGB 4LARL 4WENB 3VU2A 2GOWA 3QUYD 5EUOE 4K3JH 5FO9B 2RGFA 3KAEA 2P80D 1K8DA 2NNAA 2GRMA 1T1XB 1S6NA 2AVGA 2X4NB 4MAYC 1UA3A 5I8KH 1XCXA 3APFA 4YL8A 2KATA 2WP3T 2OJWA 4HJSA 2WP3O 3L3JA 1MN4A 1ZHBA 4NWTL 4RBPH 1GY2A 3O3BA 4G6AD 1SN5A 4KVNL 5ICYB 1VB9A 3Q8EA 2KQSA 2QVIA 1KBPA 2IEJA 1V8CA 1CU4H 4FA6A 1U8NA 2I26N 1DBAH 4MS8D 2X3MA 3QEQB 5L7XL 2BDNL 2Q8AH 3VVVA 2EEDA 3K4AA 3IJEB 4AYFB 5F6IB 3BKMH 5TGBA 3V4VB 4EN3C 3O48A 1NA0A 4XKBA 4WHCA 3VFTB 4NQCB 3K4ZA 4Z7WF 4HRSA 1I1AB 1S9VB 4BSWB 2G60L 5SWZE 2OL3L 3R4DA 3RP1A 3KPOA 4D0DA 5IQ9B 1H2VC 3CXDL 5D5MF 2O72A 5B1JA 5AOMA 2WZAA 2J2ZB 1I9RH 5IHZB 3MRRB 3MJ5A 4FTVD 5GZNA 1B88A 4WLCA 3RNGC 1GS7A 1RZGB 3RU8H 5SX4I 3VD5A 5B7MA 4UAHA 3GP7A 1C5CL 3UF8A 1YEDB 2DMKA 2JWYA 3KDMA 5DD3H 5ETUA 4HJ0C 3MUGB 2YRZA 2C7FA 4KQ4L 2XWEA 5HHMD 4JVSA 4FABH 2PNDA 1VESA 4JDZB 5ADOL 2AQ2B 1K3ZA 3C60B 3CFDB 5EBLA 5LBVA 5I1AB 3SDAC 3DBHB 1A1MA 4I0CC 2BSSA 2YGOA 2W91A 3FSWA 5ID1A 4ZRPA 3EO9H 2ZNVC 2CGYA 4IN3B 3BDXA 5D1ZA 4YE0A 2WXJA 3RKPA 4L2YA 5LWYH 3P2DA 2ARWA 4ZX3A 3I50H 1HL9A 3BUPA 1AG0A 3JYSA 1J5HA 4RRPG 3MYJA 1E5ZA 5I73B 1RLFA 1SY6A 4A66A 4GSQA 1QSVA 3QJVB 4RSYA 3HPLB 3HI6H 2WQWA 3LZRA 4LHUA 3ZUNA 3NA9H 3TWQA 4L23A 2NY0D 4JQVA 2OXHA 1KYDA 3BIKA 4NRZA 4YLBA 2XG4B 1S7WB 3UO1L 4DW2L 5BRZE 4KKQA 3ME0A 1BG1A 3QJFB 4L1HA 3KJ6L 2P43B 4IS6B 3MC0B 3M1BB 2P9PG 1IUZA 5FK9A 5BQ7A 4GEJA 5IQMA 3U9PH 3X2QB 1RIUH 1AJ7L 4MJIB 1S9WA 5C07D 2JK5B 3NFPA 4A1SA 3D85B 4ILDA 4LCYA 1UD7A 2CZNA 4UINH 2ZXWE 1K72A 1V1PA 2DWQA 5AL8A 4HLZH 4ZSOA 3ABZA 2EIDA 3FOLB 1MX6A 3RFRA 1INEH 3N9YC 3PU7A 1HWWA 5J6HA 1MY7A 5JHDE 3ENEA 2AXZA 1KPVB 4HD5A 4AYEC 4F57H 4HAKA 4WGKA 4G8IB 1CYXA 1ZHNA 3QJQB 2ITEA 3QDME 3SDLC 1OZUA 1ET5A 1TKWB 4FFYH 4JPVH 4NBXB 4RIRB 1PDXA 4YPJA 4KK6C 1XB8A 3D08A 2F5AL 2JB6B 4X9YA 1CVSC 1M2OA 3GMOB 5CSZA 2X2HA 4JB9L 2JZPA 4H88L 2G4GA 3NHEB 3NAAH 4LSUH 3EADA 5FC9A 1O75A 1IGTB 3ASFA 2Y72A 2Q86B 3TBSB 2G5UA 2F53E 4C0EA 5J08A 1XSOA 1TNNA 2EKJA 3V6BR 3GKZA 4OF3A 3V5KB 4OIFA 1QWHA 4TUKL 3TBYA 5IFAL 3SDXA 2J1KA 2YVCA 4KXDA 4YSRA 4HKBB 2FT6A 3TVMD 3HE6A 1CB4A 5T3ZD 1GC6A 5HVGB 5LBSA 5EZJA 2KTFA 1K8KG 1MVYA 1KEML 5AW3B 6PAZA 1M4VA 3DEOA 3G6DL 4MGYE 3BVVA 4H25A 2WQHA 2YKLH 3BGMB 3AITA 1C4PA 3F7RA 3BQUB 2MFNA 4PJHA 1JNHA 5JW4M 3ULUE 1ZD6A 3FT3B 4AXWB 5HYQA 3AFLA 2BIPA 1D4BA 4OZFG 5H92C 4HT1H 4P49A 5AW7B 1YYHA 4A2EA 4LCUB 5IMLA 3RWJB 1Y7VA 1AZZC 1MCOH 5E75A 1N5YH 1ZHLB 3LYYA 3UAEA 1HG5A 1G1YA 1L6UA 4ASWC 4KAQH 1UGMA 1LEGA 3HRZC 4EDXB 2K39A 2UY1A 3QIWC 4GDLB 4XXDA 4EUPG 3HN5A 2NYYC 4YEEA 4FQQA 1OP4A 2X6FA 3UTTD 3RGBA 4F2MA 3IVKA 3QQDA 1VZ7A 1G1CA 5A40E 1CK0H 2OJZL 2IZVB 4GXFA 1J7VR 3Q1EA 1S5HA 2QZ5A 3HFMH 3ZN6A 5MEPA 4XODA 5E4OA 4EBQH 1Q9KA 1V54B 3Q6BA 4KZCA 1MIML 1G0DA 1XGRB 1FQ9C 4WDIB 4WHTA 1ZB1A 4YHZL 4BSXA 3P4RB 1BREA 3CZSA 2NUTA 4HUMB 2RTTA 3X14A 3VMNA 2L1AA 4KY1L 5CEXA 3HZYA 1P9DU 3INOA 4PUCA 1BJ1J 4UNTA 3RUGE 3PCYA 2VE6B 4EZLA 4Q0XH 5KNGA 4PAZA 3AS4A 3HLAB 3QHZH 4NNYA 2LVOA 4HBDA 2PM6A 4IIQC 5H94B 4BFEA 1Z9SB 1SNRA 1UB6B 2TRHA 5ENWA 1I9EA 2HLFC 3CNKA 3NMEA 5AVWB 4NQED 1NL0H 4GXUN 1GAFH 2KXPC 1MRDL 1N10A 4XMTA 3UCQA 3ZE2E 1U8MA 1DJZA 5C0AE 2QQQA 3DI3B 5KYYA 2EE0A 3Q1SL 3VXOB 1FL6B 1LK3L 1W8OA 4GYBA 4RCOA 1W72A 2K22A 3L3KA 1X4YA 2A77H 4KX6B 4RGNC 1FV1A 5KYWA 5AAPA 2I2YA 4AM9A 3GE8C 4BWTA 1A6TB 4X8JA 4YGVB 3ESUF 4A6YB 2AANA 3OKKB 5DJZA 5HDOA 2WQ6A 1DBML 1OAXH 1E9PA 2YKKA 3SHQA 3LKUA 2H32B 1CGUA 4X9GA 5HPMB 1A14L 5D7LB 3BSHA 5GGSA 3TO2A 4WU5B 4C56C 1L6ZA 4ADIA 5EU5B 5L2KA 2CDFB 4X7CC 4LLUA 1QLBB 2R0LL 4RZCB 4AKOA 4JL9A 1VZ6A 1D9KB 4KRPD 4JLRB 5FYLL 4AYBA 3BP6B 4ODVL 1CR9L 1JGLH 2QBWA 5DD6B 3AV8A 4FQJL 3QUMH 3U7YL 1GGCL 4FMFA 4U1HA 4Y4HB 1RZJL 5I6XB 3O13A 4APFA 3NPZB 2AAVA 3VFPA 1OCWL 4KKLD 1I4FA 3UPVA 5EUKB 4QPEA 3V55A 5C09A 2WLLB 4JFXA 2CLVB 3LH9A 2W9EL 2YMOA 4BFNA 2UVEA 2JNZA 3NAWA 2DY2A 3PGCA 1OXJA 3MRFA 4JHWL 3D07A 2W94A 3Q0HA 1QFWH 3KPSB 4D9QE 3HG5A 1IT9H 4XN7A 4M43H 3PP4L 1QLEL 1E8WA 4LU5H 1IBXA 5MENA 2MKWA 2QDWA 3EGXA 4K3DH 5IG7A 2HRGA 1NBYB 4OFPA 3DPYA 5GXGB 3IETA 4HV8B 3PL6A 1MUJA 4B0MA 3VTVA 4G8EB 5LHDA 3KWWA 1DSFH 3UINC 2O6DA 5AZHA 4ZAKD 1AHMA 2WQXA 5L8LB 2BTDA 3WEAA 3FSAA 3GTTA 1BU9A 2DYPB 3NZ8A 2K78A 4PYGA 2FR4B 4WJPA 4MZRA 3BEVA 4WFED 2W65A 3QXDA 2ZX7A 4H1LG 1RM6C 3X23A 4IMKC 5DVNA 3F7QA 2GBRA 3QWVA 5DD5H 4LLMB 5DDHB 4LGRB 5E08L 5DQJB 4RGTA 3HMXL 1RIVH 2C26A 1QPPA 1CDHA 1SF5A 3HI1B 3IDYC 4KVPA 4PWIA 1MX2A 3FFDA 2D3CA 5G5DA 4FQHA 5E2UL 4TRPH 3N2JA 2IGLA 1G3NB 2G1EA 2CDEA 4FZEH 3MBEC 2DZJA 4NZJA 4PS8A 5LAXB 4M6OH 2K8BA 2KC2A 4HPPA 5E1AA 4G8GE 3MRLB 1JFHA 3WCQA 2DI8A 1TZGH 4KTDH 5HI3D 4GTTA 1SMAA 2EH7L 5JPMA 3RU8L 3P4PB 4TUJA 4RFNB 1RW2A 4BKSA 1AGDB 1AWCB 2IG2H 3LQMA 5EZOH 3IF1A 2GTWA 4AJYV 3MRNB 1QA9A 5DD3L 3HNSH 2Z3FA 4NENB 1OM3H 4YZFE 1ERNA 2F6AA 4ERSL 2Y7NA 3FN9A 1OCOB 1YNLL 4HKJB 5E94A 5I71C 5BVJA 4O2CA 1ZVYA 3E8UH 2JYTA 2O6FA 4GBXB 3WBDA 4IMLB 3T65B 4AX3A 1H3PH 3UROR 4F7EB 2A74B 1YEWA 4IK7A 2EILE 2PYFB 1L9PA 1KTKA 1FNEB 3TP4A 3SFZA 5I30L 1ASQA 1YA5A 4OJYA 4Y8DC 4BBWA 4AZ8B 1ZJBA 3SDCD 2E9WA 3K2UL 1TT5B 1SIJA 5ENOD 4WK4B 5FGBA 2C4XA 1MCNA 3P4QB 5AOZA 3IAM1 2OEWA 2KCKA 2YUXA 5K9KA 3HEIB 1KGXA 1ZK5A 2KWUB 1LGVA 2VN6A 4V1DE 3NA9L 3HMWH 4FEMA 4PJ7E 3ZK0A 3TCLA 1OV8A 3ULVF 2HLAA 4FKHA 2EXYD 1JWMD 4FLHA 3D4GA 3UTSA 1WTLA 5IHWA 3ARDD 2O6VA 4NUGL 2YD5A 3L3IB 3L4TA 4MA1B 5D1QB 4HKZE 4P2QE 1DQJB 1GGBH 3E2HB 5FKAB 1FF5A 3LH2L 2VLKA 3RGVB 1I8LC 3TZVA 3AE8B 1MWAA 4HCPB 2XACC 3SE4C 5K9QI 3QG7L 3F05A 2NY6B 4MQSB 4YBQC 4HCIA 1IQRA 1P5QA 2V17H 3C6LD 3G7TA 3I6KA 4K5MA 4TSCL 3BKYH 3MLRH 4APQD 4YNDA 1UH2A 1MI0A 1XCTL 4XBGA 5J1AB 2FJHB 3U2SB 2UWEA 1FFTB 5TDNB 1L3WA 4FFZL 1GGIH 2I07B 4JZJC 4US8A 4BQCA 1IAII 1XH3B 2L7EA 2ED7A 1SZNA 3WTVA 3DHJA 3CVBA 3TA3D 2YXWA 5LBGA 1M1SA 4BE5A 4E36A 3G6AA 2Q87A 1ROCA 1J48A 3PV7A 3JTTB 2Y1LE 4Y16A 5DTFA 4ZTOH 4XBPA 2NY2D 3WHXB 3VNYA 1I75A 1S2EA 3IVFA 1HKFA 4WNQA 1HA5A 5KTEH 3O3DA 1WD8A 5IF0A 3MJ7B 2Z93B 3QDGD 5IR1B 5J11B 2LVPA 3NAAL 4LSUL 3SBWA 1VGKB 5K9JH 2FUHB 3QA3A 3NSXA 3QNXA 3QQ4B 4Z7OF 3VUWA 2E6QA 3M07A 1JCSA 1MHQA 1KPUA 1JFQH 4ZUUA 3DYMA 4O2FA 4MVBD 4HK0B 5AUMB 3BVXA 3HE7B 4E9QA 2EXTA 3DARA 1MW0A 4JZOA 2J0KA 1RIHL 3VXME 3ARED 3GEFA 3PXJA 1R7SA 1KEGL 3A6CL 1UBIA 1TGZB 3ZLQC 4W9GA 4X5QA 3NBNA 2A9NH 3AS1A 2L83A 1E8ZA 1FL5B 3MJ8A 5G4NA 4Z7NB 3S7BA 3T8VA 1NC4A 1A1OA 3MOBL 2PMVA 4XVJH 4JPKL 3B6SA 1D6EC 1YY8A 2VDMB 5I1JH 4HT1L 5GRWA 2X2YA 5ESVB 3PV6A 2NOYA 3EFDH 3MCLL 3QORB 4YS4A 1MCOL 1KY6A 4JQXC 4QXWA 5DYOB 4E2OA 2AKRB 1DBJL 4KAQL 2I5YL 4E68A 1Q94B 3KPMB 1QEWA 2ZWSA 3OGCA 4OZIA 4MELA 3TIXA 4QHMB 2GSGB 1MRFH 1CQVA 1KJ2B 1AO7B 1KLUA 4IDJL 3DVNB 1QRKA 1SJXA 4K94H 3IFWB 1S3KL 5AVRB 5AARA 4RMSA 4UWQB 2BC4B 1PJ9A 4FNPA 4HS6A 3Q49B 1YECH 4G59C 4Y2OB 4PY8J 4YHIB 5E9DD 2ZNXA 3T8MA 3GK8L 3ULSA 4AIZB 5I8OH 1BM3H 2AXFB 4OD2B 3VFMB 4CVXA 4S0HA 2WPGA 2LHDA 1OY3B 3CFIC 3TBVA 5T1LB 1BYNA 1JI1A 1IFHH 3HKFA 5L88H 1HEZE 2KC1A 3BWZA 3A0OA 2WQRA 5DJ8B 1D5XB 3RNQB 4BDVB 3SDXE 4RQIA 4PI2A 2VGYA 3IBOA 4DO5A 3H55A 2ICWI 3CK8A 1M05B 3P1VA 4IKJA 4AQ8A 2HO1A 2V4HC 4FQLL 2IO3C 3CPLB 5A7EA 2IH9A 2BNUA 3HUJA 1H15B 4RLYA 1XO3A 4Q0XL 4U05A 1Z66A 3C5ZC 1S9YB 3CH8A 4U2ZA 3GSUA 4P5TA 2NW2A 2BZDA 4D0BA 3T6XA 1IKNC 1GOFA 2N7BA 3GLZA 1A6AA 1NEZB 4XTRC 1NEUA 5ANMA 5BZXA 1GAFL 3V30A 1OGAB 3B9VA 3BPOB 4MA3A 1AARA 2QT6A 1EX0A 1Q72H 4MBOA 4U31A 2ZCCA 3MRHB 4JO5A 5GGQH 4KV5F 3DYPA 2ITDB 1QZNA 2OMXB 3S7GA 4FTDA 1BQHA 4DETA 4GOCA 1MZCA 1JPTL 3L1FA 1Q9WB 3N6YA 5TFSL 3E37A 4Q94A 3PUUA 2V8SE 1SPDA 3MUJA 4MD0A 3C6SA 4GP5B 2BJML 5DS2A 1U8HA 4ELMF 2QVTA 5HGHB 2XKUA 5CNHA 2IO2C 5D6JB 5AZUA 1OAXL 3FT9A 1K4CA 4K7FB 1SE9A 5E2WH 3W37A 1SZ9A 4IOIB 4W9LA 3U9UB 3DDFA 4HJTA 5LN8A 3WSQH 1JNLL 1F1DA 3MQIA 1IC5H 4OGYH 2Y1YA 1EHAA 3B8SA 2LUMA 1EFXB 3GMPA 4M7CA 1J05A 2QR0B 3FS9A 3T4AB 3V5HA 2DWYA 3S2AA 2VDKH 1JK9B 2BW4A 4YZWA 2YWYA 3H2QA 2R02A 3NJJA 1O6SB 4FTVE 4X6BB 4AY5A 5CWSA 2E86A 3I9AA 2FLMA 3KBEA 4PJIA 4U1MB 1BZOA 4PJCA 1SDDA 1ZJAA 4UQIM 3R8QA 43CAB 2LQRA 1VCAA 1SHSA 1AR2A 3BYTB 1K4DB 4XWGL 3P2TA 1C4AA 1CDUA 5HHME 1KLFB 1HAWA 2C1PB 1XGQB 1U8KA 2YPLA 2AGJH 2JLBA 5ENRD 4AIFA 1CXEA 1PQZA 1CCZA 3DTUB 1EEUA 1M6UA 2XBTA 3G5XA 2WOBA 5FOJA 4Z7NF 1EMTL 4B50A 1H0DA 4K3DL 1DJIA 4MMXA 3NJIA 3OHXC 5LAPA 1U91B 1XGYL 4UOW1 2YSSA 4KKCD 4X5WA 2KNBA 4LP8A 3P3RA 2QL1A 3O2DL 3KVDD 3ZU8A 3D4CA 1JPGB 3HG1D 3T77A 3MRBB 1DSFL 5FIEA 1C9SA 2OTUA 4HSCX 5LGJB 2EVFA 4NN7C 1FORL 3ARPA 2VH5H 3KG5A 4GG6F 5TQ2H 1FN4A 4BIKA 3QYMA 3SSGA 4Z7QE 3BVMA 3LB6C 4YBLB 1KB9J 2Z65C 3I63C 1L9TA 2ZWKA 4JRLA 3EYQC 2HX8A 2V7HB 4G5AA 3MV11 1RIVL 2IQ9H 4YXKL 5EU4A 5C07E 1TTRA 5F3BA 3U2IA 2X4SB 3ZO0A 2NX5D 2FIKB 2IAND 2KLGA 1S7TA 1V86A 1K8RB 5I19L 1HFAA 3G08B 4OFVA 1R4MB 3ULUL 1TVHB 4II3B 1WGOA 4W70A 1S4IA 4QOKA 1TYGB 4F7CB 1NDGB 2HFGL 1TZGL 2MRYA 4Y4FB 1CFMA 3BQVA 1CF8L 3MLUL 2XVGA 1FYTD 5IJDC 1BMWA 2YARA 3RDTB 2X87A 5F7EL 3DO4A 3N1QC 1DL7H 3BRDA 2NDGA 4TLSA 1PEZA 4N2OA 1MFEL 1AW7A 2AV7A 1UWXA 1UQSA 3E8UL 1KOTA 1IPGA 4FQCL 5I66B 3OZLA 2CJOA 4A7QA 4ZYSA 2KLSA 4ODTL 1XR9B 4JRYB 3N06B 3HVNA 4N3BA 3QJSB 2IEPA 1BCIA 3IK2A 5T3ZE 1JPFB 4KKBD 1FZOA 4MXVE 3O6LH 2M8SA 2QYJA 3BH8A 4PS4H 1L4ZB 5FFGA 4PV8B 3WMSA 2B0SL 3MDJA 3KGSA 2LVEA 1SM3H 3TEYA 3Q7JA 3VWKD 1UJJA 3V79K 5LBSH 4GRLD 4E9YA 5BQDA 1DEDA 1PZBA 4DGVH 2P8MA 2XQBH 4L4JA 5IHUL 1MFVA 2OMNA 3FQTA 4GQZA 2YPKA 2SEBD 4QAYA 4DBGA 3CVQA 2X4TB 2YAEA 2JVCA 3PDNA 1J8SA 1P53A 4L1BA 5BV7L 3RFZA 1MJJA 3DOHA 3MV8B 3PWUB 1D5IL 4DKAA 2EVIA 3MRGB 4CVZB 1QSFB 1PZAA 4S1SH 4LPUA 1HX8A 2PL2A 2IGTA 3UTTE 1KJ3H 3S36H 3IDJB 4KK5D 2DJSA 3VAEA 2EXWD 3BPNB 2GVYA 4NCDA 1IGCA 3ALPA 3LKRB 3ELQA 3Q5TA 4UT7H 4Z68A 1AACA 3D33A 3D51A 4NJ9H 4E9SA 1KG0B 2IXQB 3R8BA 2GTZA 1A6WH 3H7LA 2ZCBA 3ZTDA 5DXWA 4DCQB 4JDTH 5GQBA 4IU2A 4UF7C 4Q69A 2R23B 1FVFA 3KNBB 3QQNA 3SCMA 4H2AA 3CR3A 5K39B 2VZKD 4I6GA 5CCLA 1CLYH 4LCVA 4G23A 5E8NB 3BVDB 3C98A 4XI0A 1S9XB 2KS0A 3RWGA 1HHJB 4WJ5B 3PGDA 4KOCA 2AEPH 3VG9C 1U30A 5CECB 5BUZA 5FV2A 3HHRB 3S5LA 5HI4C 3PQYD 1F4AA 2WW8A 3M8OH 3ZXVA 2YMXL 3GTVA 1P84K 1B0RA 3D2TA 4WQOA 1DQLL 2MNWA 5IGXH 5JORB 1JF1B 1UKTA 3B7RL 4C54A 1KIQA 2EYSB 5IW6B 2IAMD 3Q6GL 1PAQA 4NQEE 5I74B 3MLSH 4MYPA 5AVQB 3NJHA 3SJVA 2ZUTA 1QSEA 3DETD 2FJUB 1U8LB 4DOHB 3KSQA 2EIJE 4DHJB 2IGFH 4J1UB 4C4VA 1LO5B 2B6CA 2ZUUA 3KR3H 5ACMA 3TIDA 1P6FA 3ARFD 1L0QA 4W9JC 1WAO1 3UXFA 5I1JL 3KL5A 2WSDA 3EFDL 3ZHEA 4EDWH 4BQBA 2OI9C 4W9HA 2R4SH 2UWJG 2ERJC 1M2VB 4MS6A 1W72H 2F7OA 1IJ9A 4JO3L 1UWMA 3CVIH 4N59A 4UZSA 2C7MB 4EFOA 4KJWD 5FWRA 5ENSD 4XP1L 4R8WH 5IBUB 3RIFF 1WS8A 3DUUB 2CRYA 2FL5A 3G5VA 3LN5B 4I3SH 3Q79A 3QRLA 4GAYA 3LXCA 4FQXA 4HJIA 5ENPD 5IN7A 3CHXA 2XIIA 3CLEH 4NQDB 3WLWD 4WWKB 3O9WA 4KO7A 4L7TA 3B9KD 3EGDA 4I17A 4U7MA 5D2NB 5IMOB 3ZDZB 1TTCA 4DVBA 3JUIA 1V7NL 3DJ9A 3K0WA 2D4DA 4HJGB 2F61A 4PWHA 4QRBA 5FXCH 5EF2A 4YTMB 1CLOL 2HXAA 3S8GB 4HXBL 1F18A 2N9EB 5I6PA 4JHBA 2F58H 3L4YA 3RIKA 3MLPA 5MEQB 4L0YA 3MNWB 4MCYB 1RU9L 3A67L 1GAQB 4NHUA 2XGSA 1E6JH 3GRWA 2K6DB 3SDYH 2A4CA 5DJXB 5F7KC 1IILE 3WFBH 4POYA 2NXYB 4A20A 2IDSA 1MHHE 2ETAA 1R47A 4JFSA 1WH0A 2C3WA 2DIBA 2F7IA 1HZKA 1HSAB 1JUFB 3TSSA 1PGRB 3DSSA 2BNQB 1DJGA 2KAJA 2EDQA 1PLGH 1BQLL 2VGLM 5CD5D 2WVTA 3TWUA 1T80A 4AH2A 3GSNB 1E4HA 2ICWA 5GSVA 1PUTA 4JX0A 3LS4H 4X57B 4J3SA 5ANHA 3WJJC 2DAVA 4WV1C 5GGQL 3FKUS 4U4BA 2GGFA 5ALBL 2K9XA 2GRIA 4GT7A 3U0PB 2H6PB 1QYGL 3QDJA 3RX5A 3O41B 4U0SA 4WFEE 3WL9A 4M5SA 3QFJA 5FZSA 5I18H 2DLHA 4I3GA 1MPAH 2IOMA 4Q9RH 1TETH 4D2NA 5GS2H 2GRQB 4CMHB 3RZWA 1D5MA 3NSFA 3K2KA 5J8OA 5JHMA 2FECL 1WISA 3KYKH 4G24A 2JJWA 1P9MC 2WXKA 3ASHA 4I5BB 4OFYA 2AABH 1EHLH 5IREA 1U4AA 4PPTA 2NY3B 2XI9A 1C5BL 2YAMA 3T04D 5LUMA 5J1SC 4CJ1A 2ZCLL 4P4KB 5LN4A 4ZRGA 3S96A 2VRKA 3NIFB 2HJFA 3VFSB 5IOPA 4B9GA 1DLFH 5IESH 3CVPA 1UH6A 4A2GA 3MYVA 4P57B 1JBJA 1KN4L 2B1AH 2BKFA 1KGUA 2P47B 2PJHA 2XTJB 4MXWH 3U7AA 4UM9B 1NEKB 3ETTA 3VNZA 1JN6A 4BYHA 2GIYA 1MRCH 3OQ3B 4QRTB 1RPQA 2ON8A 3DBLI 5A2LH 1U3CA 1NCUA 2F8IA 4ZYNA 2FCSA 3DURB 4OV5B 3MJ9L 1B0GA 3EYFB 3MODH 3U36B 1DE4B 3F04A 4I88A 1U42A 2WKGA 1VRAB 3S4SA 2KJRA 5A2KH 3MNMA 1C16B 3D9LA 1FSKB 2GAZA 4XP5H 5SX4H 4NQLB 2KT7A 5D4JA 3AGVA 5FUOH 3FQNA 1YQ4B 4KX9A 5D7JD 2PCYA 3HIZA 1KGIA 1QRND 4QAWA 5D7KD 3F5WA 5H4YA 3RNKB 3L1GA 3ZDYE 4P2OC 4X2UA 1LP9A 3ALWA 5EA0H 2FZ3A 2JRHA 4HBCL 1DQTA 4GP8B 1EWYC 3BZ4B 1YQ3B 4JPQA 3T0EC 2FLRT 3OD3A 3EDEA 4K3HA 4NM4L 3MLXL 4WJG3 4ZUSA 3VQMA 4HA1A 5FZRA 3AE5B 1PBYA 4GCNA 4PJDA 3SQOH 1AXTH 5KJRL 3W1SC 1GZQA 2QKIA 2OZ4L 4OF0A 3ZDZF 3ZOAA 1OK8A 1FVDB 1TN6A 1MI5A 1OPGL 1SJVA 3TV3H 1E9OB 4M7JL 3ZKND 3T3ME 2E56A 2E47A 1FZJB 3H9SD 2VR3A 4DUVA 2BOLA 1OOWA 1MWAH 4Z7AA 2DM3A 5I75B 5AQ0A 2AJVH 1UYWH 3HZKB 1OB1B 4OZCA 1XCQA 1E67A 1MXGA 4FA8A 1K1AA 1RAMA 3WN5B 3W1ZA 3V4PL 3VH8B 2F5BL 3VFGH 2OMTA 4OCRH 1X9UA 4ZO9A 3II3A 3POHA 4HJEA 2WXPA 3B2GA 3U52E 4X98A 3RZFA 5CZKA 1DL7L 1EXUB 1GVIA 5IQNA 4QO1B 3QDGE 4K7PY 4N90D 4F9LA 2FQEA 4JHUA 3C5SB 5EX0A 3RRMB 4CSTA 2X4OA 5C0GA 4QTIH 1WWTA 1EPFA 4O1OA 3OKDA 2BP0B 3FH7A 1C7SA 2ZQKA 1OCRB 4ICWA 5BUGA 4YHYB 3WD5H 2FB4H 2ZPYA 3IFOA 2WK2A 3QP3A 5CHVC 1H8NA 1WF5A 4RSVA 3FQYA 3GBML 4YNYA 1YC7A 1JZDC 1RZ8A 5DHVA 4OW0A 1QQDA 1WMHB 1KLXA 4TULH 4LSRH 1X5LA 4JJOA 4BSJA 2Q3AA 1AGEB 1CD1B 3OR7A 4NZTH 2XQBL 3ZX1A 4Z8FL 2D7NA 2I6HA 1DVFC 4I2XA 4IW4C 4LESA 5EN2B 3U1PA 4A8XC 3CN2A 3D52A 4MSQB 2NBUA 4LSVH 2APXA 1C77A 2PVOD 1WZKA 4JE4B 3U6RB 2JXXA 3NIFF 4S1SL 2KLRA 2EELA 3MV3B 4DRXE 1L2NA 3PWLA 4C48B 2B14A 2VR6A 4NNXB 4F7PA 4L8SC 1KJ3L 4NXSA 4KGSA 2GI0A 1SZAA 4Z7UE 1U2VG 4UT7L 4HG4K 1PZCA 3AWFA 4HGMA 1P5UC 2PPDA 2TRYA 4NJ9L 4NKIH 1FE8H 5E9DE 5HTSA 4NN5C 4CGTA 4MWFB 3C08L 4JG1H 5J06A 2VQUA 1BZQK 4LVOC 3BZFB 1P1ZA 1PY4A 4M6ML 3B2VH 3NYKA 4M7ZB 4J4PA 3RX7A 3HR5B 5BVPH 2DBYA 1VSCA 3CVHB 3WKQA 2IOLA 3GBNH 1WFTA 2IY0C 4M6NL 3PABB 4X7DC 3UUXA 4A7SA 1T0MB 2VCOA 1IMHC 3NY5A 4TMPA 3HHMA 4FQ1L 5AW4B 4FL4C 1SLXA 4HHAA 1ROWA 3IFLH 4HI8A 4G80A 4M1DH 4BRVA 1TYJA 2W3SA 4XT1C 4YWGG 3U4EG 4X0KB 2H47C 4ZFFA 1P7HL 4UIKH 1TJCA 4RX4D 3BDBA 3DGDA 2DJMA 4H8UA 3TMPB 4ANWA 4U0ZA 5IB4B 4N8VG 3GBEA 1BAFH 4XNQB 2RCSH 1HH6A 2DBAA 2GSMB 3WJLC 3V2AR 1MIEL 3KS0J 3EO0A 4HMDA 1MG2C 1Z5YD 2FQDA 3D7PA 4H4NA 5KS9E 2WYIA 1CIUA 4M4RA 1P7QA 4AT6A 2MBHA 2ZP9A 4XC1H 5LQBL 1KDJA 1I4HA 1DQDL 1FP5A 1YN7B 4DHZB 2INCC 4R90L 4EVNB 2YZ1A 2QHRH 5BXUA 3CVWA 3ALXA 4NXKA 1OAQH 3QNKA 1D8DA 1SN0A 3WNKA 2MLBA 1D5BB 2XWBA 4NN6B 4BINA 4ZFZB 1TVDA 3AG3B 1MJUL 3BVUA 1E28B 3NEOA 5JXEC 5GHWL 3ZJAA 3V9CA 2EQDA 3I85A 4OLEA 1BX2B 5BUPA 4XHQA 1ADWA 3QPQC 4GU5A 1LK2B 1JVOA 5HHOD 4HIXH 1R4NB 2J9QA 2UY6A 2I9TB 5F2FA 2MBEA 4YHOL 4PJ9C 3CVXA 3RY4A 3ZHKA 5I6NA 5KSAA 2E0IA 1LXMA 2DVWA 1PLAA 4NM8H 2YN3A 3VYNA 4ZNEE 1KGWA 3MP9A 5B39B 4PB0H 4XH2A 2F58L 1Y6IA 1FYHB 4JMXA 4OUUB 4J23A 4HOXA 1CICD 1UZ6F 4O1PA 4LOUC 4JUSA 3LN4B 4W81A 1E6JL 4KROC 2ZKXA 3T71A 4NPYA 3SDYL 2BMKB 3IMSA 1Z9NA 1ULVA 4XCFL 1VADB 1HEHC 4TPRH 3QJRB 2UYZB 2R03A 1OAUH 4WO4B 3S7FA 5EILA 1D7BA 1OF0A 1WK0A 3BE1H 3LIZL 2Q8BH 3AJIA 4HPYH 4YX2L 2ETBA 2Y6SC 1P3QU 3BAYA 1YMHE 1NDMB 5ARGA 4HQQL 4BCZA 1TKGA 4NJAL 4X6FA 3BUQA 4QR7A 2IDYA 4XNZC 2VGEA 3HG1E 3D9IA 2CKBH 1YNTE 1CI5A 2CRMA 1GNUA 5CJ8A 3TIEA 5BNXD 5EN3A 3W82A 2XFXB 4A3VA 2NSMA 4PRPB 2YZ8A 3FB5A 2MOQA 3QUXD 1TN7A 5EO1A 4EI6B 3JYUA 1G0YR 4PG9B 1O6TA 3BO8B 2C34A 1MPAL 4LEBA 1VKXA 2Z4QA 1JGVH 1KIRA 4TQEL 4XPHL 2UYLB 1JGIA 1JGEB 5T3ZL 3W9CB 2XWXA 3HG2A 3CVUA 1SDAB 1KIPA 3L5WA 5FT9A 2NX5E 1FNGB 2IANE 2OX5B 1EJFA 4UB0L 1RUKL 2V7NA 4X7SH 4YSYB 1T6WA 4JRXD 2CJSA 4Q97A 2ENYA 3EFFA 1I3VA 4O02L 3Q6FB 1VLBA 3Q9UC 3HS8A 1RZPA 1URLA 4CAGA 4JY5H 4KNTA 3VRJB 3D2UA 4DO6A 3BQOA 4ODHH 2BERA 2CO7B 1FG9C 2VXUH 1AP7A 5T1KA 1KLGA 5BJTA 4D0CB 2COQA 1OUVA 1FYTE 2P8LA 5F97E 5KZCB 4CKVX 3KGRA 4MJ6B 1HL5A 3FF7A 2B1AL 3FC8A 5D3DA 4A3PA 4LMQE 3EJRA 1J8KA 1G6JA 4LNNA 5ITBH 1HXMA 4ARIA 4I0PB 1MYOA 1YYLH 4I0KA 4UDUA 2G4SA 3SY0B 5E6PA 4DK6A 3QEUA 5DK2B 4LCCA 1NQBA 2QEJC 2E7BA 2JJTC 4FYSA 1SJHB 2EEXA 3G6JA 3FO1B 4GSUA 1HF8A 4H13C 4AYGA 1MAJA 3VXQA 4ZW3A 1XLOA 4H8HA 4M48H 1JRHL 3BD4A 2C0MA 4HGWA 2WSPA 4L8CB 2XX1A 2N0MA 3GLEA 1IAKB 4FHBD 3CC5B 3BH9B 3ASNB 1BZ7A 1R33A 3JVFC 1PYWA 3KGTA 3KXFD 3RL2A 1OP3H 2EUZA 1G7MB 3GJFB 1BDYA 1SLUA 2VC2H 4PRBB 5I16A 2YS4A 3TT3H 3MCYA 4G6ML 3GXTA 4HLZG 1NBQA 1XIWC 3SDAB 2QQLH 2KYIA 4MKMA 4OJEH 1ITBB 12E8H 4DP2X 4C58B 2F54D 3IHYA 1AHWC 2OLDA 3EBHA 3QI9B 3ZO9A 2WU2B 1JHTB 4ELKA 3T6WA 4HOWA 3K9IA 3S3PA 3L82A 4ZFQA 4NI6A 3WS6A 1FAKT 3SQOL 1JV5A 3O0RH 4XMLH 4UIMA 1BPOA 2NNXA 3ESNA 4WZ9A 1H6OA 1U0QA 3RVUD 5C92A 2HT2D 1Q9OB 1U6AH 3I57A 3KPLA 1TVBA 2C9SA 5FA4B 3QPXH 3Q3GA 5KBAA 1NJ9B 1RMFL 3FCTA 3PSEB 5DEGA 3AW5A 1IGFL 1NBZA 2BYTA 4BAXA 5E8DH 4JD2G 4I48A 1ZIBA 3JV4A 2O2VB 3ZGIA 5A1AA 2YA1A 5CF3A 1QABA 3EUUA 1MQSA 1UZ8B 4OCYL 1IGCH 3C09B 3OXLA 3OXSB 4YHKL 1FFPA 4A2DA 2DWTA 2GHZA 2YUVA 4GS7C 2BFVH 4QY8B 5DRXB 3MV7A 4FXKC 3Q05A 4AUYA 4CN6A 3MRKB 5ILTL 5FV1L 3WNPA 4G1MA 1L9MA 2PP8A 1R0AL 1PSKH 4ODUA 4Q2ZA 4AWJA 4HPOH 5TTRA 5EC1A 3PQYE 4EEEA 1UN8A 4WTZA 2VR9A 1N4QA 4PLOB 4G5ZL 3H6NA 3QS2A 3EJTA 5CRVA 3C6EA 1Q0WB 3P2BA 2HKHL 4QRPD 5IM7A 1V5OA 2LXMA 2XU9A 4B95C 4WWNA 1IQWH 1A6UH 1IAIH 1XTLA 2A3TA 3CDCA 4OB5L 2DTSA 5DCCA 2VABA 1YEEH 4NSKA 3UAJD 1BPLB 3DPBA 5JHLA 5D72L 5KAQG 1FM0D 1TNYA 3BW9A 3HS0C 1I7ZB 1GCYA 1OT8A 2MSPA 3DBXA 3CTTA 2AEQL 2OSXA 4OZFB 4TTDD 4Y2DC 5ESAA 3X3FH 1V8HA 4UTAL 4KDLB 3EOBB 2VXTH 1LJMA 5CUSL 2A1WH 3VXRA 5F89B 3DWLG 4NZTL 2VDRL 4HAFA 4P23D 1H6FA 5DS8B 3FYEB 1HQ4B 2HG0A 1OTRB 4EUPB 2AXUA 1F11A 2BVOA 3WCYA 1LTXA 4HJ1A 4A67A 1KB5A 5IFHH 3WUWA 3NESA 3RK6A 1SHWA 4U6VL 5EIVA 5FF6A 1C79A 3QIBA 4PJ8B 4KYOB 1SA4A 4UU9B 5FYJD 3WO3B 1AGCB 1CGWA 1IB5A 4PY7B 5K5YA 4X80H 1XXFC 1NP7A 5TE6H 4LIQE 3ESKA 1IM3D 2FJSA 1TZIA 1ZA6B 1NKRA 1SXNA 1FPTL 2VISB 4C7YA 4N0UE 4GXBA 3W9DA 3ASOB 2RAMA 3QWRA 5GGVL 2K0PA 2VDQB 2ZWZA 3HRZB 3MZLB 3LRGA 3QIWB 5JA4D 3DK0A 3ZGQA 5AYUH 4IRJD 2WO3B 4L4VB 5KYUB 3JSSA 5HRYA 2WDVB 1WG0A 5C3JB 2Z91B 3IFPB 2H1XA 3NABH 2IPKA 2JMRA 5F7DB 5DUBA 1DUZB 3WMQA 1WYGA 1CT8A 3DSXA 5EWIH 1NC2D 4N0RA 4NAMA 3J27A 4UT6L 2OMZA 3SKMA 2BVQA 1WAAF 1SXTA 3IFLL 5LVEA 3ZQ9A 1GB1A 2M1KA 4H8WH 3BYYB 2F7QA 1AVAA 2ADJA 2H26B 3PHOA 5JZ7D 2DF3A 2Y5TA 4R7DB 2Z31D 1JWSD 2YD9A 3KBHE 4YC2B 7PAZA 1FNFA 3SBQA 4I2XE 2P9LG 1BD2D 1KJMB 1L0XA 5AW9B 3MCXA 2VDLH 1S5IL 2WWNA 3GSWA 5JMRA 2ZPNA 1I8MA 4OY9A 2KX3A 1GSMA 2G3ZA 2WQYB 1EDQA 4UM8B 3A9KA 4PJXB 4IBZA 3NSCA 1IEAA 5FM5M 3ZHFA 1OAQL 3FAHA 1KJVB 3OKNB 3EXJA 2OR7A 5J0BA 1XL6A 1G5GA 3IGUA 2X38A 1Z3GH 3KLHD 3ARBA 4HJKA 4NERA 5E6IA 4RGNB 2XEWA 1N64H 2R2EB 4IU3A 1BMGA 2ICEB 4H5SA 2WBJA 3CZJA 2IOSA 3ZY7A 1IGMH 2DKSA 1S1QB 2UZPA 1AGFB 4GW5B 4GRMA 2B0OE 1G9NL 4XI9A 1S7SB 2XWTB 3HA0A 4QXGL 3ZFWA 3PFQA 2C7HA 2R0ZH 1AANA 4LNUD 1SEBA 3JV6B 5KOVC 5CEAA 3PHAA 3QZBA 2W54A 4PB0L 5F9OL 4H8QA 2B3IA 3OJDA 2VZTA 4K71B 3OAZH 2KH2B 5JW4N 2FULA 1DANT 2MA9B 3BAKA 1JPLA 1BIIB 4NB7A 2QQKH 1U3ZA 1YEHL 4KJPD 1J19A 4ESKA 4FU3A 2ZCHH 3ULUC 4PQXA 1R3JA 4IOSA 1VF5C 1JYVA 4TPRL 3HNTH 2KO3A 4RQQB 3PWPB 3BE1L 1T0QC 5IMKB 4TQIA 4HPYL 5HKPA 2LAIA 4L37B 4R97C 4GY4A 5J18A 5ID0A 1OOAA 3QYCA 3DMMC 2WZ6A 3Q2WA 1CFBA 2A6JA 2P7TA 2Y25A 4R83A 1JZ7A 3VSUA 2CKBL 2E9BA 2EINB 2YHGA 1BXVA 4KJQC 5D7KE 1QRNE 1FI8C 3IDNB 2R2QA 5BMIA 3FU6A 1RZ4A 1SB3C 3BSGA 5E4EB 2L0TA 2VB5A 3U9PL 3L9EA 5JIMA 2XZTG 1BF5A 2NXZD 5K9OB 3F3HA 3T8XB 4U04A 1FC2D 3W57A 3MKQA 3K5RA 3O4ZA 1J8HA 4KKAD 3C5JA 3AEDB 1SBBA 2Y9RT 3LYAA 1P2CA 2XZCL 1JD7A 3UINB 2DQUH 3WMPA 1BFSA 3TBTB 2WAHA 2ADGA 3BT0A 1U8NB 3H9SE 2UY7B 3GDBA 3CCHA 2NW3A 5I1IH 3L4WA 2XBZA 1RPUA 5C0NC 3CUPB 1WQVT 4ONOA 3FFLA 4YL4A 4XVSL 5LXGH 2VZVA 4J3OG 3P40A 3QCTL 1RP8A 4IBLT 4G50A 3H3BC 4D0DB 3T2QA 1GOGA 1JV2A 2WHVA 4X5LA 4JFTA 1EU4A 1TBEA 3S88H 4TNEA 3KLKA 2D3NA 1U8JB 2L00B 3NRFA 4YPGA 3GSRB 1WSST 2YAQA 3ISYA 1TZOA 1H2TC 1N4RA 2I24N 3PE4A 2PR4L 4M29A 2OVBA 1FZKB 1NCTA 3T2OA 5KANI 4AENA 1TXKA 5C3IA 1RXLA 2CLRA 1S7UB 2DKMA 5DO2C 2V0GA 1XMWA 3V61A 4M1CC 4UZUA 4LDCA 4QD2E 2K25A 5JA8B 1FLTX 3FB6B 4LO9A 1A3ZA 5IEHB 2ZX6A 2BB5A 4LP5A 2DDQH 3GHPA 4M7KL 2LXAA 3HM3A 4YHLH 5B4MD 3NRZA 4XMXA 4O9HH 5JO5B 5I71B 4OAWB 4PJXF 1J0HA 4QJ5B 1BVNT 5ID1B 1UKSA 4EHMA 3FSOA 1RI8A 1KT2A 3WA0A 3FQWA 1XWVA 4G9FB 5D1ZB 4NWUH 1BXXA 3HC3L 4JO1H 4XI5C 5EU6D 5AZEL 2ATPA 5C0RH 5DUPH 5BYSA 4WEEA 4DUXA 3A6BL 3MYJB 1M71A 4X6CA 5EBMA 5F0PB 2D0FA 2OCCE 1HG2A 4LHUB 5C9JA 2HUHA 2BRRH 1J87A 2EYRB 3KEDA 2ICES 4N2DA 3PWNA 1U6AL 4AEIH 2XNAC 1TJFA 3QPXL 5L4MA 4XMVA 1JZ3A 3NIDB 3S34L 3X3GL 3L95B 4I85A 1FA4A 3X1EA 3HXEA 5FK9B 3QAZB 4KRMB 2CO4A 2I2OA 1IRAY 2OJEA 4F7MA 5EE1A 3O6FD 4UDTA 4N6RA 4PJGB 1AD0B 4G42A 4MNGB 4HLLA 1HZ5A 4EBAG 3DQVA 4XPAL 3FUNA 2AFNA 4RMWA 2NY7H 3C9NA 3NCMA 4XAWH 5INDB 1OT4A 1RZKH 1W9XA 4A55A 2P44B 3QZWG 4DVRL 2VH2A 2QSQA 4U4IA 2H0EA 3ZMRA 1T89C 4ADJA 2E8ZA 3LZQA 3QUGA 2ZIDA 4HRLA 3G2TA 1FFOA 4OKVA 3L6FB 4K94C 4H7YA 3NOCD 1JXFA 1WBZA 1X5KA 4HAGA 3QIUB 1GGTA 3S36X 3HDXA 4W9FC 2KFKA 3V0WH 1OCZB 3L4ZA 1RJLA 4MD4B 4YH6A 3BFOA 4RAVA 5DQ9A 5I1EH 4GI6A 2XT1B 5TJWK 1I4PA 3VXSB 1A7NH 1T5XA 1JZJA 5TDOA 1KCLA 1L0PA 1IQWL 3UTMA 1GHFL 2JJSC 1BZDA 3WAKA 3RN9C 2ATKB 1NAKH 1ZXQA 3EDTB 1YEEL 4XZUA 3CHSA 4MMYB 4ZO7A 3AKKA 4ZXBC 3VI3E 1GUAB 1K5NB 3X3FL 5FO7A 4HUXB 4R96B 3HCVA 4XBMA 4Z95H 3BWUD 3JUEA 1A4JB 1U3YA 2A38A 2VXTL 1OM9A 2YGQA 3GLDA 4FP8H 4GJTB 1QR1B 3LRMA 1A7OL 1D5ZA 2HB0A 2LWPA 5A7BA 2AJSH 4G6FD 5FFLA 3CLFL 3VXPA 1UUNA 2KWDA 2ZUSA 5IFHL 3WAOA 5JMOC 1QNZH 4GTQA 1B9KA 4H20H 4L8DA 3VWJC 5IUSA 1AKJD 2ZG1A 4KSKC 3B9JA 4GDKA 5HYEA 1ACCA 2E9JA 3VI4E 4OLUL 4EN3D 5AD0A 4BXVA 1NGPH 3TXAA 3IU4H 1XAKA 4XP4L 3HBQA 4I9CA 4TNWK 3EG9A 5HHOE 1TJEA 4IG7B 1J1XL 4FJYA 1LEGB 1U3HA 4FXGB 1GPXA 4YHMH 3PV1A 1ORSA 3WLBB 4F7TB 2EIKB 4JFEA 4WI9A 2OOBB 4GMVA 4QRUA 1T7WA 4HDIB 3LV3A 3SKJL 3II2A 5CSBA 1DBBH 2VSYA 4FQ2H 2JX5A 5AYUL 1QFPA 1L5GB 3D9AL 1ESFA 1D5RA 2GJ6A 4P2RA 3Q3NC 4JGNA 2BW2A 2WQ7A 5I5JA 2A5UA 4HJ0D 4LEOA 3PAZA 3KPNB 4ZRKA 3TPUB 1SGHA 3LOWA 3R18A 4WHTB 5KBNC 2JKRM 4O4YL 4MJSA 1L9NA 2X09A 1A9EA 2YRPA 3QWNA 4G43B 4B96A 2HH0L 3V8CA 4MA8L 3X14B 3MX0A 4JLCA 2Z8LA 1THCA 4S0TD 3HI5H 4H0HB 5D8JH 5MI0C 4HWIB 2IMMA 2DQCH 3D18B 1CJYA 1RSFA 2EC8A 2MJWA 2OEDA 3OPUA 1CD0A 3P77B 3N41B 2AJYL 1AGBB 4G9DB 2OR9L 4LK4A 1T21A 4OZGE 4KXAA 4RLDA 4W9CA 2IO3B 5B3JF 2IV9A 2H1PL 1Q8MA 5ENWB 4N8CH 4B9JA 2N7DA 3N32A 4JXTA 3C5ZB 3CN1A 2BVTA 5T5FL 5JIIA 4P2CG 4Y9FA 4Q2JA 2HVJA 1QO3B 2VDPL 1OW0A 3X17A 3KCPA 3DBHI 4L3EA 5KYYB 1YUHB 1R4XA 1ZKAA 5HJ3B 2Z7WA 4K7WA 4FMVA 1PKQE 3VG0H 3AT8A 4XHJD 2BWIA 5DFWH 3CWGA 2PW9A 1ZTXH 4PJGF 5LB1A 4X8JB 3CFBA 1C08A 2E7CA 5HPOA 3ILPB 4PJEE 4JRXE 1N19A 3MRJB 1JNNH 2PO6D 3D39D 4NPNA 2VDOL 4Z5RA 2X4QB 1JZ8A 5FX3A 4YUEH 1K53A 2IO2B 3ZL4H 2HZHA 1LQSR 2IF4A 3B7BA 1SGKA 5L2KB 4JKWA 1DDHB 2RR3A 1FUNA 3DIVA 1YO4A 3N1PC 4J6RL 2ITFA 5FYKD 3MOAH 1JYXA 1AP2B 2IFFH 4JQVC 2O5ZH 1ADQL 2F7RA 5I1DB 2ZX8A 3ROLA 4AV5A 4IRSA 4QXTA 4CRPA 1RJYA 1EGJA 32C2B 3D3VD 4MMZA 4DUIA 2VAAB 2O6PA 4M7LL 3AT0A 3FONA 1LE5A 5H7PA 2O1AA 4PGJA 3IMBA 1WXVA 4RGMA 4OM0L 1I4FB 2WMPA 1RK1A 3ABLB 4G7YH 3SDDB 5EF1A 2RB8A 2CIKA 2WKLA 2K6ZA 2BPSA 1XBDA 2MBQA 1I7HA 3A4FA 4ZW7A 1G9HA 3TH4T 1WCBA 1KY7A 2J57A 1OSPL 2OCFD 3PGCB 2YFNA 3Q2LA 2R4RL 4P9HH 1A1NB 3QXUA 1IEHA 5ERWB 2WX1A 3Q3OC 1DJYA 3KXFE 3AE9B 1W0VB 2LXLA 1EZVX 3AEFB 1AYRA 2BXZA 2FBJH 3MMEA 5J3HC 1KV3A 1YEGH 2HP4A 2R8SL 2ZCKH 1P5VA 3ESMA 3VSTA 1WA2X 1KBBA 2CBQA 5C70A 3V79C 2AXHA 2BSTA 2F54E 4FNUA 5KVMC 2MHAB 4TQ0A 1UF0A 1T66D 3DJZA 3O3EB 4FA7B 5IVXB 3NZ8B 1OWNA 1G87A 2ZGGA 2WIMA 5D1XA 3U2JA 1B4RA 4EOWH 1KYUA 1R3HA 5D9SB 2PN5A 4ATGA 2NZIA 2Y69B 3TF7C 5C71A 1FNWA 4E41A 2IWKA 1RK7A 3O4LB 4LSTH 5D2LE 2NS5A 3DX8A 4H0IA 3GZKA 5I5IA 1RJZB 3U66A 1S7XA 1S8DA 2NMSA 4A2MA 4FQHB 2KDEB 1T1YB 3IB4A 4K5CA 1U8IB 1IARB 4CHKA 1KTLB 2X4RB 3ZRCC 1JTOA 2YD3A 4HH9B 2DLEA 5I0VA 1BZ9B 3QUYC 2ILRA 1HWHB 3TGOA 3BLPX 4JE3B 1OXYA 1ZIAA 5AB9A 5FM8A 2VIRA 3FQRB 3GMNA 4H40A 4LPWA 4LIQL 4PRAA 1KCSH 3ARGD 3FT4A 2A6DA 5AQBA 3IF1B 4F92B 2N0KA 1SYVB 2WWKT 1T2QH 5E1IA 2WTRA 2WWKO 2XKSA 5B8CB 1DQML 3DTXB 1FXAA 1EZSA 2AL3A 4G6AC 2IFUA 4X50A 4QRPE 4QRQA 4MRCA 3HLKA 1RUPL 5ISZA 5DJDB 4JKPH 3GMLA 1CXIA 4ZMOA 3EYUL 2LGDA 4MS8C 2JKJA 4B8CB 4NZLB 3AKLA 4YHLL 1B4TA 4BCYA 4O9HL 4U1SA 3Q48A 5AUIA 3V31A 1T03H 4OZBA 3APDA 1J0ZA 1A6PA 1IBBA 1SF3A 1H3WM 4NWUL 4JO1L 4X7TA 4Z7WA 5DUPL 3PNRB 2YBGA 5JHLH 2CG2A 3FYIB 3BX7C 4P4RA 4RWYH 1RFDL 3DX2A 1N0RA 4J8DA 1AZCA 5D5MA 4DP6X 3L9TA 4AY6A 1DFBH 3SPIA 1L0YB 4U8VD 3GS2A 4LOEA 1JPEA 2D31A 5EOCH 1AD9B 4EIZC 5FYJE 4HWZA 3DVGA 1OT1A 3UTSB 1KENH 3GHBL 4A1GA 4C56D 4YFDB 4AEIL 4X4KA 4Q9QH 1GTFA 5TD4A 1H2UA 5DD0H 4PRIB 1KB5H 3AQYA 4YEFA 4GTOA 4JO4H 4ZFHA 3BPCA 3W9FA 1HIMH 3D06A 4TNFA 4LNRA 1M6OB 4Z3TA 2R83A 3LYRA 5FPIA 3CXHK 3K9PB 1LEIA 3AC0A 4W4OC 1J5IA 1RZKL 1E4JA 2A9MH 3Q78A 2C8NA 4PBVC 4U63A 2VXVH 5E5LA 1FD6A 4MJID 1WA0X 2P8PA 1ILSA 3TO4A 4JGUA 3OR6A 5ACLA 5BYRA 1BLXB 4OQTA 1P84J 3CVYA 1CMXB 4GKNA 2NY0C 3H1ZA 3V0WL 3N9GH 3APMA 5ADPH 4AJ0A 4F20A 5I1EL 4PJFB 3GSXA 2GITA 2FSEA 5CEYB 4EIBA 1N59A 5BOPA 4QGTA 2L4OA 2O5XH 1PY0A 3KEZA 3FB7A 2YWZA 3VG9B 1C76A 3UQ3A 1BD2E 1VA9A 3T8KA 3IWUA 4FERA 4M9PA 5IVXF 3M95A 1SLVA 5H37A 4N2IA 5H35B 3RNCC 2I9CA 4Z95L 1FO0B 3V2OA 4Y2LA 2B77A 4FP8L 4Y4KD 1MFMA 3C5XA 2BO0A 5AEKB 3ZT5A 1HE7A 2IADB 1OSEA 2XRAH 3LZLA 3EH3B 5F21B 3FQUA 1C4CA 1NC4B 1DP0A 3GXNA 3MCKA 4MX7B 1BOYA 2GC4C 3IPBA 4CU6A 3PUJA 5AYQA 4H20L 2FEEL 4PCYA 1BIHA 4G72B 3PV6B 4BBNF 4MCMA 4Y9EA 3IU4L 2EC9T 3FU9A 2GTQA 1MVKA 5I17B 3VGEA 3DKHA 3N1ZC 1OWWA 4OZIB 3OKEA 1JCKA 2AK4D 3MBED 4G8FA 2ERJB 2AXGA 3KYNB 3A33B 1F4HA 2JXMA 4IKKA 3CMGA 5FO9A 2XZQH 3MREB 1ZV9A 2PTLA 1T1XA 3QFDB 2ATAA 4XCEB 3PNWB 1NBFC 2NBWB 3KW8A 2MOVA 1CI3M 4Y19D 1OGWA 2JZ3B 4CVXB 2ZUQB 5BW8C 2O5NA 4M7LT 1M1XB 5DA4A 5ICYA 3ZN3A 1CFSB 1AMYA 1X5IA 1ZS8B 2L7QA 3QUZB 2V4IB 1NDDA 3RZCB 2ZKHH 3P69A 2V3NA 3PYCA 3QEQA 3AWEA 1KCVH 2YQ8A 2KT6A 3IJEA 1QYMA 5D8JL 3V4VA 4AYFA 1XT9B 3UZQB 4ANXA 3VFTA 4LCIH 2F1AA 4KY2A 4NQCA 4RRPM 3QJOA 3N1FC 3LEWA 4ZPTB 3UC0L 3QRBA 4WU7A 2WPVA 1I1AA 1S9VA 3QFGA 2RMNA 3D1MC 2BIMA 3FPXA 4HSQA 2OL3B 1U36A 5DK0B 5JUEH 2J2ZA 5IHZA 4LKXB 2J4BA 3MRRA 2NXPA 2OW7A 5DHDA 5JPMC 4ZHOA 2TAAA 4ZFGL 3UZEC 1RZGA 4MA3B 2FTAA 3NZHL 3FK3A 5CN3A 3DRTB 3ARUA 5BZWB 1Z3RA 3MUGA 4NKOA 4OCMC 5F1KC 4TLTA 2ONQA 2YD7A 4MD0B 4WV1B 2QILA 4HEMA 5EIIG 1QWUA 5T1DH 3TL5A 5DA0B 5M94B 4YSUA 2AQ2A 3C60A 3D34A 3CFDA 5EU7E 1JNNL 1KTJA 1TTFA 1F41A 4UWFA 2V5RA 4JFDD 3RJDA 3NFNB 4YUEL 5HYIA 4M5ZH 4JM2D 3WFEL 3D12B 1U8PB 5AQ9A 2FUQA 4Q6IB 5K59E 1J05B 2BX5A 3V5HB 3EUB2 2BSBA 1KMGA 2NCNA 4NY0A 1IIKA 1JDDA 3ZZSA 3AMLA 5DEJA 3D9MA 3HPLA 2O5ZL 3S3DB 4PJFF 4HPMB 1ETJA 5TE7L 2XG4A 4ONFH 1S7WA 3TBWB 2Y07L 3QCAA 3SE3A 3A4RA 3MC0A 4IS6A 5J89A 2IQCA 5EEYA 4TQ8A 2Q6WB 1D9KD 4M56A 5BS0B 5HXMA 3N43B 4XMPL 4GIVA 4LLQB 2FIRT 2JK5A 1AIFA 3D85A 3MRMB 4F5CE 1USQA 1ZXKA 1L5JA 4HULB 4WHDA 1SJED 4Y4HD 2XN0A 1M3IA 4RMAA 2YPLB 3FOLA 4N1CA 1D8EA 1PQZB 2BWDA 3GI9H 3ARTA 2VMFA 4HUUB 3MTNB 4PB9L 4WJOA 3HAEG 1KPVA 1T6VN 2RJMA 3M17B 3ZTNL 3I2CL 5EU6E 4G8IA 5FA3B 2ZCKL 4N22A 3BOVA 4KRPC 1JALA 2RFMA 4LSDA 1TKWA 5TF1L 3T77B 4RIRA 4BH8B 5LXIB 4IJTA 2OTUB 3WFHB 5HYJD 1VJSA 2V3SA 2JB6A 3SBWC 1GKOA 1X5MA 5HVHC 3GMOA 4E0RB 1QKZA 4UTBA 4M0WA 1LO4H 3T9KA 4R7XA 4KKLC 3TBSA 2Q86A 4LRNH 5EZPA 3BAXA 4CDRA 1EUVB 3V5KA 1T0PB 4P2OB 3CSGA 4BEPA 3IJSB 5CHFA 1WGYA 2HE0A 4Z0BL 4HKBA 4LSTL 1WH3A 3L5HA 1UACH 5F3BB 4TVPD 4L4TA 4ZTPH 4YDIL 4OR1A 5KWDA 1S9KC 3N04A 5D55A 2DZIA 3KM2A 3TYFB 1OGTB 3BGMA 4XE5B 3V9EA 2FGWH 3UACA 3BQUA 2MKLC 4XPTH 4D3CL 1AQKH 2MOWA 4GTRA 3FT3A 4AXWA 2LT9A 3BJ91 1AS7A 5BO4B 4DDGD 3WE6B 5ANRA 1BQ5A 2FHCA 4ABWA 2CUIA 2V9UA 1T5WB 3IMWA 3IRZA 2BXYA 4LCUA 1GC1H 3RWJA 1S7VB 3LH8A 4DEPC 1WAEA 1LGRA 3QWZB 2P5WD 1ZHLA 2LU5A 3WFZA 3CC1A 2EXSA 3ETBJ 4GDLA 4LCWD 1LDPL 2JVUA 2YD1A 4GQ9L 1J7BA 5L6YH 1X6NA 2DZOA 2AEOA 3LX9A 5IBTL 4GA2A 4GMLA 4XTRD 3GS0A 2XY1A 4NZ8A 2QFCA 1RFKA 4YSXB 1N9AA 1WIOA 4L3CB 3IPEA 4HGKC 3RJVA 3MKKA 4LOVA 1U93A 2C2LA 1FVCB 4WAFA 1M7IB 1XGRA 4OF8A 2JFCA 4L1SA 4WDIA 3US0A 1A70A 3ARYA 4RWYL 1N26A 2HKFH 4N6QA 2AXWA 5K93A 5I1CH 1FCCC 4E41E 3U8ZA 4DWFA 4DERA 4N5QA 1I82A 5HI3C 3C5RA 7FABL 1HYSD 5FGCB 1NMBH 1V10A 4TOYH 3JXJA 4AEHL 2VSDA 2P8MB 4F1SA 1TIUA 5DHYB 4BT9A 4XWWA 2VE6A 3FQTB 3P0GB 3P9LB 5BMGA 4AK2A 4XB8A 4PGZA 2EO9A 3HLAA 5EFIB 4EAEA 1G1KA 3RFZB 4LRZA 1ZANH 1I9JH 5H94A 1Z9SA 3DIFB 4JO4L 4Q56A 2C0LA 1DVFB 4G8LA 4AY0A 3QNZB 3A9JB 1VFUA 4J7WA 1BOGB 3JCKC 1OTUC 2ZX9A 3V2XA 1ZPSA 5FCUH 3L7FB 1WE7A 3R8BB 4K5NA 4DAGH 3VXOA 4BQ8A 1FL6A 2GTZB 1A25A 4L8SB 3MKGA 3N43F 4OIAA 3ZNHB 1GIGL 4OSUL 1IBHA 4NX0A 4NJ6A 3RI7C 1XF4B 1NFIB 3P0VH 3BWSA 3QG6A 4YDKH 5IP4A 1A6TA 4PGDB 3U4EB 3RAUA 4XNUL 3W39B 4ODXB 4OT1L 4NN5B 3OKKA 4W9LC 4ZUTB 3BXNB 1B9ZA 4FC3E 2HFFB 3SCMB 2DNFA 5GISL 4KZEH 1OCCE 2J8UE 4XNYH 5DJ6B 5JZEB 2H32A 4OCSL 5HPMA 1YN5A 4N8VB 3EC8A 5T4YA 5D7LA 2EXYC 3H2PA 3U0WH 4WU5A 2XN9D 3PGDB 3H42H 5DMYA 5IJVB 4BOZB 1MCIA 1XGWA 4JW1A 2BSCA 3DTDA 5HQ8A 3S5LB 1WZ0A 1GYVA 2CDFA 2YK1H 5F7LB 1INDH 2JLLA 1CC3A 3WG7B 2ESVB 4RZCA 1B0RB 4WUUD 5C0FB 1HOCB 1NCIA 2HD5B 2VTBB 3BP6A 1ZTMA 5DD6A 1A3RL 2DPKA 2JKXA 3T1FB 4APQC 3C6LC 1ADQA 3BP4A 3VRLE 1NCCL 4PGBB 1BZEA 4WUKL 4LGPB 4R7VA 5CLTA 4NQXB 2CJUH 4OCXH 1WRDB 2C3XA 2ZOKA 5EUKA 1ZPUA 1A4KB 4C4VB 3GHEL 2WLLA 3S6CA 3TA3C 2E7MA 3S3BB 1OAKH 3FTUA 2APTA 5FO8B 3DHHC 3L22A 2QQNH 4KRNA 1YNKL 2NY2C 2V5MA 3KPSA 3ZHEB 5AAWC 1CWVA 2YBRB 4ZJ9A 3W0WD 4DP5X 4O58H 3HVDA 1CGSH 3D39E 4RWHA 4EOYA 3GQFA 1RK0B 1QLEB 2UZIL 2P5EB 4PGCB 4GQPH 4HV8A 1TENA 2ED9A 3FBQA 4MVBC 3PIQB 3H9DA 3O4OC 3MGAA 5FYKE 3RY5A 5GGRA 5EKQD 3TFBA 2GUYA 1OLZA 1K6QH 3AREC 1DOXA 1N60A 2FH8A 2DYPA 1EHNA 3HZ3A 5DJ0A 5ELIA 5F72S 4QRRB 5MP6H 5J6SA 3D3VE 5TPWH 4DVBB 3M63B 4G7RB 4J3WA 1CFQB 4PJ9B 1R4MI 2LD9A 1UA7A 4LLMA 5LP0A 3CK7A 2F74B 2KWVB 3AVEA 5DDHA 2WB7A 5KSBB 2DX5B 2FE0A 4N2NA 4Z7VE 5DQJA 1ZLUK 5KHQA 1A8JH 3L10B 2YEPB 1EGJH 2E76C 5CFAA 5HY9B 4GB9A 1AMXA 5A16B 1QLFB 4YVOA 4EN2A 4GZ5A 4G26A 5F6HI 5ABZA 3PGFH 1TQCC 4AKPA 4ZMZA 1SVCP 5D71H 3GZSA 2PYED 1IFGA 1I3RB 5LAXA 1UFUA 1BYPA 3N42F 3EOTL 3HZMA 5FS5A 1J9RA 3VFNB 5JW5B 4OZHB 3C3QA 2H5UA 5B22A 1F2RI 3VRBB 1UXMA 3V0DA 4WEUD 4TNGA 1F3RB 1AGDA 4JFQB 1CQYA 3VR8B 3MRNA 5C2TB 2XQYA 1WIUA 4XNZB 2F9BT 3KJ4C 2CXGA 4FFWD 4HKJA 3EJCA 3C19A 4UV4L 2AV1A 2EYTB 4GBXA 1ETZA 4O6FA 4IMLA 1IC0A 3RB7A 3T65A 4ZMAT 2GEQA 3SFXA 4N6EB 2IPTH 2P9RA 5F9DC 3T3NA 4F7EA 1B0IA 2A74A 5I15H 3DXAD 4FBJB 3WTYA 2RPVA 2YLKA 1ES0A 1NZRA 3DSNB 1S7RB 1IVLA 2HWZH 5F70A 4AZ8A 2H45A 3MXVH 5LGHL 5TH2B 4PIRF 4I18C 4H7VA 1YEKH 4NKMB 3GZPA 3GM0A 2J4WH 3SPJA 2XSKA 3H2WA 3ZDMC 5FYJL 2HJFB 2XDHA 4LSQL 1GGUA 4HFUH 5AENA 1N68A 1JXDA 3WKML 1E8YA 3L3IA 2KUTA 5D1QA 3NEXA 1DQJA 5FINA 1FNHA 2AQPA 2B2XL 5FKAA 4F7KA 4XBEH 5GZOA 3RGVA 4MM3B 2HE7A 3FT2A 1JN6B 1E65A 4ELMA 2OJRA 1FMAD 4N2SA 1UD2A 1IQDA 5HGGS 3ZTDC 3UZVB 3JWDH 3GI9L 5J1AA 2FJHA 4PH4B 1XCTB 3CDFA 4U3SB 5C7ZA 5TDNA 2FD6H 2I07A 2NY1B 3BDYH 4X7FC 2LZ6A 1XH3A 5I1GL 4M8RA 1KC5H 2WUBL 2K6QA 2EDOA 3OTNA 3KPRB 3IGLA 3V6CB 5CZRA 1DTUA 5KWYC 5LOZA 3JTTA 2DQJH 1DZ0A 5IW1B 4J3XA 4IHBA 3WHXA 1L7YA 5C23A 4QHUA 5E0QA 2EECA 3F5WB 1HOEA 3U4AA 5AUKA 3ABME 3MJ7A 5IR1A 3JT0A 3PP3H 4WFGD 3UAAA 5C0CD 1HYRC 3QQ4A 4KMTH 4F37K 3Q14C 5DJYA 4O51A 2ICIA 4TRQA 4PRHD 3EH5B 4HK0A 4PJDB 5AUMA 4F8NA 3HE7A 1AHWB 5BYQA 3THMH 1GZQB 1A6VH 3B2XA 3SKOA 2MPVA 2E9GA 1TNMA 5CLZA 4QXUH 5SV4A 5HI1A 4KPHL 4LDLB 3PDOB 1ASPA 4AQAB 4CNIB 4TVUA 1FL5A 1XEUA 1T04A 3FCSB 5KSBF 2CU9A 2C1OA 4KKCC 1UM5H 5JQ6L 4GRWB 1R3KB 3X2QE 2YEPF 2J42A 4MJIE 1XCQB 2EDRA 5KBMA 5CCMA 1QI5A 2HJLA 4CC4C 2N4FA 4EQ3A 1NCAH 2DWXA 1OARH 1MCPL 3LVTA 1TOXA 4L3AA 4W4NA 3QORA 5ESVA 3S37L 4DESA 3CLWA 5DYOA 4DTGL 3TG4A 2YUWA 3PLYA 3K80A 1A2YA 1B89A 4EI5A 4OJFH 1TJXA 4B3EA 2AKRA 2MMXA 2JV6A 3KPMA 1BBDH 5C9KA 1RUML 5BT1A 1MCBA 4GS7B 3OPZL 4QHMA 1NGQL 2GSGA 2H2PC 4OZHF 5GPRA 1BJ8A 1AO7A 5LKNA 4GG6A 3DVNA 5EUOB 4OQTH 5FYKH 5DGRA 4TNVK 2X4OB 5C0GB 4LDTB 2L3ZA 1ZMYA 1YY9D 2BC4A 3O9WC 5IWLA 1FFUA 4TSSA 4WF7A 3WNLA 4IGBB 4YHIA 4G7VH 1OEYJ 2AI0L 4Y1AD 4HMEA 4BK5A 3IXTB 4HWEH 1BXTA 4LJPB 4AVJA 4AIZA 5G2NA 4OD2A 4ODBD 3WGUB 3R9MA 4I89A 4UOW0 2A5EA 4KNQA 5T1LA 3URYA 3Q5OA 4GAGL 4Z7IA 4IDIA 5DHVB 5DJ8A 1