2WXIA

The crystal structure of the murine class ia pi 3-kinase p110delta in complex with sw30.
Total Genus 276
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
276
sequence length
919
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVDCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title The P110D Structure: Mechanisms for Selectivity and Potency of New Pi(3)K Inhibitors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 276
structure length 815
sequence length 919
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 2wxiA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wxiA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2wxiA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wxiA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 2wxiA04
5G2NA 2X38A 4HVBA 4HLEA 2X6IA 2N1TE 4XX5A 3APDA 5CCGE 4AJWA 2WXMA 5KJ7E 1QASA 1UGKA 3FBKA 3OHMB 1DJIA 3HN8A 2WXPA 4PS8A 2ZKMX 1E8WA 2FJUB 3IBEA 2DMGA 3MJWA 5EDSA 2UZPA 3F05A 4WEEA 4FHKA 4BGDA 2WXHA 4GB9A 4QJ3B 3DBSA 4XE0A 2YRBA 5H4YA 4DNLA 1WFJA 5ANLA 1DQVA 1TJXA 4KITB 1K5WA 2DMHA 2QZ5A 2FK9A 3NZSA 3L13A 4PS7A 2B3RA 2CHDA 4EZKA 1UOVA 4KZ0A 3QAQA 1DJWA 5G55A 1E90A 3PYCA 1BDYA 4F91B 3L4CA 2I9CA 3L16A 4NP9A 4FULA 4KZCA 4ANXA 1DJGA 1RLWA 3ML8A 3KWTA 4PH4B 4AOFA 1DSYA 3W56A 1W15A 3B7YA 4IHBA 3F01A 3NSJA 1BYNA 2NSQA 4J6IA 3PFQA 2ISDA 3HHMA 3HIZA 3L54A 3M7FB 2CHXA 2CHZA 2RD0A 2WXFA 1DJHA 4LT7A 3APCA 1RSYA 3QR1A 3PRZA 4F92B 3PS6A 2K8MA 4NPKA 4QJ4B 3KWUA 2X6JA 1E8ZA 5H4ZA 3F04A 4TV3A 4GNKB 1GMIA 1QATA 3APFA 1A25A 1CJYA 1V27A 2X6FA 4G11A 2EP6A 3IHYA 4ICWA 3LJ3A 4FJYA 3ZVVA 3R7QA 4L1BA 4UWGA 1BCIA 3PREA 4WWOA 4FLHA 3OAWA 3RDJA 2LHAA 3QK0A 1E7VA 4JPSA 4L2YA 4UWKA 1DJYA 1E8XA 4LCVA 4QJ5B 4FADA 5CCHE 2CJTA 1E8YA 4ANWA 2WXIA 4L1LA 2X6HA 2X6KA 3TJPA 1TJMA 4ICXA 4FJZA 4F1SA 2K4AA 2KI6A 4DK5A 3NZUA 2NCEA 5JHAA 2QZQA 4TS6A 4V11A 2V4LA 4BFRA 2Z0UA 2NQ3A 2Q3XA 2ENQA 4NPJA 4Y1SA 2JQZA 1YRKA 4WWPA 1DJXA 4QAMB 2WXLA 2WXNA 1W16A 4ANVA 3CSFA 2WXRA 4A55A 1WFMA 4F93B 2A5UA 2Q0ZX 4PS3A 4LDCA 3CSTA 4URKA 2WXGA 4OYSA 2CM6A 4UWLA 4FHJA 3JZYA 3TWYA 3TL5A 1HE8A 3IM1A 4EZLA 3W57A 3R7RA 3L17A 3GPEA 2K45A 3SD5A 2BWQA 4IQHA 2ENPA 3DPDA 1RH8A 4UWFA 4WAFA 3ZIMA 4ANUA 2WXOA 4MJJA 4NS0A 2ENJA 2YOAA 2Y3AA 4OVUA 2WXJA 3FDWA 3L9BA 3L08A 3S2AA 1DJZA 4Y1TA 4FA6A 3T8MA 3ZW3A 4EZJA 2K3HA 4TUUA 2WXKA 3QARA 1UOWA 2R83A 3QR0A 5CCJA 5T8IA 3QJZA 1CJAA 5ENNA 4XZ4A 2D8KA 2CM5A 2CJSA 2A4ZA 2WXQA 3ML9A 2CHWA 3ENEA 4L23A 5JHBA 3P2BA 4UWHA 3F00A 3LS8A 4WWNA 1E7UA 3RPBA 3N5AA 4OVVA
chains in the Genus database with same CATH superfamily
1PDXA 3RZFA 5DFTA 5IO9A 3KSLA 2PE9A 4WK2B 5BO4B 1BMLC 3MRRB 3JT2A 2M4NA 2WW8A 3BLBA 1T1ZB 4WCYH 2EDRA 2JT4B 2ROXA 1NAKH 1U8KB 2PVOD 2SEBB 3DWTA 3KPOB 2UZYB 3B3BA 3TOPA 5B39G 1HHJB 2MMXA 4MNHA 4MAYA 4B0MM 2YD4A 3WN5B 3O2DH 5FO8A 5D2LB 5C8JA 2INCC 3ZE2F 4AG4H 3A4DA 1TFHA 1OCRE 2J73A 4ZPVA 2APXA 2B59B 2GJ6B 5DTFB 1NMCC 3VVVA 4MJ2A 5DC9B 1MPAL 2HJFA 2L04A 2HLAB 4KJQD 4ODUA 2KH2B 3PHOB 4AOFA 1WD8A 2K6QA 2QQLL 3AS2A 3GJEA 5IFAH 25C8L 4H8VA 2ZEQA 4H0LC 4KVMA 3SDAB 4L3ED 4TQIA 3KR3H 2G0LA 4DPBX 4RFEA 3C60B 2BH0A 2AXGA 3CZJA 4IRJC 4NT6B 2DJ4A 3S8WA 3TO2B 4CZ2D 2RH0A 2ZSWB 5CZXD 5EH1A 2J6EL 1H19A 3CDFA 3II2A 2QSQA 5E03A 2VDKL 5FKPA 1TJHH 2ZGDA 4DPCX 1DOXA 1HEZE 2D2CC 3D30A 3P3RA 4PRDA 3M1BB 3KYNB 4ZW8A 1F4YH 3FSVA 5T1MB 4DKAA 3VA2C 3GBLA 2P5WA 4HFUH 3UT8A 5DVLA 2DQHH 2DYMA 2X1OA 4G43B 1EM7A 3QUZC 2X6UA 4HIIA 1UD4A 1MF2H 4JK0D 3LNEA 2FO1E 5EYLA 4KI5C 3C8HA 1QSFB 2P28B 1FRDA 2Z9TA 1AE6H 3KD4A 1KEGL 5CCMA 2YAEA 3BKYH 1G6RB 4P46A 4B0ZA 1F2RI 4HLLA 3AE7B 1KYUA 2PP7A 5CU9A 1VESA 1L9QA 3MRLB 5GJTL 5LBSA 1MEXL 5I0DA 4DPRA 1M7IB 1UZ8B 2FZ3B 3CC5B 2CK0L 4NJAL 4AE0A 4A9AA 1W72H 2KLGA 4G5ZL 1HIMH 3CHSA 2BDNH 5TDOA 1IM9B 4HULB 1DN0A 4I88A 2XPZA 3HFML 4BHUA 2L52A 3CSTA 1KWGA 4EPZA 4ZUVA 5E6IC 4L37B 3QDJA 2FD6H 1PYWA 4FQIL 4IWOA 1FT1A 1S4IA 2KTFA 2YMOA 3O2WH 1OAUL 3NYKA 1TEGA 3TNNB 5BRZA 5KYYB 3RWEA 5DMYA 3ZE2E 1IBZA 2JXMB 4YSOA 1WISA 3LEYH 1TZIA 2LJ5A 5IT2H 2VGXB 3QEUB 3A6OA 4ZUWB 2BNUA 1GGBH 4XNQB 1BJMA 2E6QA 2IQAA 4LVEA 3ZDZB 5DVOA 1OCOB 1QSEE 1SE9A 2EZ0D 3AREC 4RRPM 4EN2A 2WXQA 1XQ4A 2P48B 1J7AA 4MB5A 1V54E 1S7UB 3ZYQA 4CU6A 1YEGH 5DRZA 4GMLA 4YSEA 3HNTH 4DZBA 3LQAL 1DUYB 2C7UA 5CCGE 4Y0GA 3GJFH 1I31A 3GSOB 3GO1H 5FYLL 5IFJB 4OLXH 2F8YA 2MCMA 1YJDH 5C1MB 2KDYA 2QVMA 1A6VL 1MRCH 5AVXB 1F1HA 4WEEA 4JFFE 5E2VH 2A73A 2D9CA 2OP4H 3JWDC 2F53A 3LNFA 4J3OC 4OLEA 5CILH 2LLLA 3CBKB 2DZMA 4M6AA 1QYGH 2BP0B 1QR1B 1OSEA 4XOEA 3NCBB 4CKVX 4GA1A 1TCMA 1Z6JT 4FFYH 1YC7A 2A2QT 2K4WA 1JN6A 4G8IB 3A47A 4U1GB 5GGTL 3RVTD 4F20A 2L00B 1QFUH 2A4CA 2P5ED 3UAEA 1PU0A 4HJGA 1MHPL 5D1QB 3EJRA 1F58L 2IO2C 3VFWB 4CDNA 5E1IA 3DUSB 3IMWA 1WT5A 2EYSA 4GTQA 4O02L 4W9LA 3H9YA 5FO9B 3M86A 2F5BH 2HRGA 4RMTA 1H9VA 3ARBC 5D4QA 1S9XA 5I8EA 2N4FA 4GXBA 4OZCA 4DXAB 1IVTA 2B1HL 3OAYH 1UT2A 4MQSB 4YBHA 5FUOL 3P63A 4FGMA 4FOMA 4AJ0A 1Q90A 2YXWA 1DVFB 1HH9B 4PJBF 1G9NC 2M1KA 1KCSH 3TYGL 3NCWA 1JMXA 4IOIE 5JQ6H 2IGFL 4LRZA 2F74A 4ODTL 4PJEA 4OIIL 5FWQA 2CKBL 4KO6A 2QMJA 4LU5H 1Z0MA 3S6CA 4PJFF 3LS5H 5GGUA 3SD2A 1KCWA 3AULA 3K2UH 1NLBL 3MOBL 4G7YL 4LG6A 1TJMA 1CZ8H 3CVPA 3TZVA 3DWGC 3T3NA 4HX1B 2D5GA 4DK5A 3AE5B 4CMHB 2HJKB 3GHBL 1SLUA 2QJLA 4K7WA 1MJ7H 3Q9QA 4D8PB 3AADB 2E9IA 2WDQB 3BUAA 2XCCA 3F6IA 4M43L 4ALAL 3ABKE 1P3QU 1IFRA 1RJLB 2Z35B 5G5DA 5C07E 3IT8D 3UAAA 1CDCA 1SRDA 3DARA 4XVJH 5CLYA 3T9KA 1IGJA 2J88H 2Z4QA 1BF5A 2YRLA 2ZIRA 1RJZB 3EH5B 1T1XB 4NPNA 2X2HA 3DSTA 3ZYOA 4Z7WB 4ZFZA 5TPWL 4LSTL 4IKLA 2VZVA 3D6GA 4TVPD 3RL2B 4HIQA 4Z7UA 5DJZA 1UOKA 3FFOA 1HWGB 5EWIL 4HPYH 4F57L 4RAUB 5C2UB 4GBXB 2ZP9A 3PWNA 4KKCC 4TUJA 1WLHA 3O11B 3CKCA 1W8NA 4LDTB 3SQOL 1PPIA 1MHCB 2ITCB 4DP6X 3Q05A 5D5MA 4CKQA 2O61B 1XGRB 1EJFA 4L5FH 4Z3FA 1RXLA 3GSNH 3N1XC 4Q96A 1IIKA 2XXGA 3JV6B 5H37G 5I1IL 5K59F 2CGZA 3WIFB 3BP4B 4PJBE 3HXCA 5HTSA 2D31B 2VGLM 3PJNA 5D71L 5KW9H 2KZ1B 2HSIA 2ZXWE 1VB9A 2E27H 2DQMA 2QBWA 4KHTL 4L3EA 4WNJA 1N4XH 5I26A 2Y5CA 1TR7A 5GRJH 5I8KH 1U91B 4IRUA 1FNSL 2EIJB 4G1MB 4I0KA 4O9HL 2VSYA 5DD0H 3SDCB 1ESOA 3MQIA 1NFIB 2Q1EA 4YC2B 2VIRA 4WW1B 2YEVB 2FX7L 4D2KA 5FGRA 1YMMB 4QHNB 1DTUA 4YHLH 4UDUA 4WSGA 1F8TL 1R5WB 5CP3A 2P9PG 2X1XR 4GQQA 4U3SB 2NSXA 4PHXA 2YFOA 2FEJA 3PVLA 1DZ0A 2ZCBA 4KK5D 4W9EA 3RG1C 2VWEC 3ZTCC 2VL5B 3ESMA 1UM5H 5I74B 2RD0A 3O6KL 3OC5A 3MLPA 1JTPA 1NOAA 3C5ZD 4KU1A 2X4NA 4ZG1A 2JKXA 3TU6A 1CGSH 1VADB 5I18H 1KJTA 1YPZB 5EU5B 3U4EB 1MCOH 3GKZA 1GKOA 2V37A 4OV5B 4EQ3A 4LNBA 4DWHA 5B3JF 4R2GC 4MWFB 4ZMOA 1UQSA 1UVQB 3DMMB 4DW2H 4BIKA 3UT7A 1HDMA 2FQFA 4I18B 2LT9A 4AWJA 1DBJL 1AO7E 1FZKA 2FBRA 3C6SB 3QEHB 3QH3B 3C5JA 4PI2A 3RRUA 4OZHE 4X6EA 2FBNA 1D5XA 4U1IA 2GY5A 2BVUA 3NFNB 4XWGL 1H6EA 2NXYB 2HT2C 1MOEA 4B9YA 5EIDA 5E94B 4NUGH 1I53A 1KPVA 4L4TD 3EJZD 4K7PY 3LB6C 3IEGA 4R26L 1CXLA 4JGJA 2VH5H 1CLOH 3M45A 1TTBA 3W0WB 5C3JB 1HEZA 3E3QC 4Y16B 3E33A 2J8UF 1E65A 3KYMA 2J08A 1HL9A 4PB9L 4XPBL 2CPUA 2H1PH 1URIA 2X4RA 2IMMA 4ONFH 1FCCA 1IGTA 1CMOA 3FTXA 3HI5L 1D9SA 3I5JC 3SZ6A 5CJXA 4GO8A 4DPAX 3E6FB 3VUAA 2HKFL 2FO1A 5K59E 1HEHC 5E2UH 3MCKB 4H88L 3DUUA 4WFEE 1WBYB 1K5NA 2D3NA 2OMYB 1OANA 4ZFFA 3EOAB 2JK5B 2I07B 1SEBB 1DQKA 4GS7B 4M00A 1R17A 5JOFB 2PJHA 4RGNE 3ZPJA 2RA1A 4P48A 1E3ZA 4XMZA 1TQTA 3U0PA 1FIGL 1PD0A 5IB4B 2QY7A 1WWCA 3GXIA 1U3NA 2GFBA 1BQSA 1FVEA 3L6FA 1QPKA 3QJRB 4ENZA 4LSQH 1NGWA 5DUPL 3QQ8B 4I48A 2CM5A 3KPMB 2XRYA 4MYWB 1I1YB 4X9YA 3U4TA 5F21B 5LO7A 5I5RA 1UN9A 1U30A 1UXSB 4PRNB 3II3A 2ZJDA 2KMMA 3U6RB 2XI9A 1IQDB 1H5BC 1KPSB 1CGTA 3N44F 3VXUB 3HW7A 1SF5A 3PCYA 3HEIB 3QDHA 4E5XB 4XWGH 3IFOB 3OX8A 5DHVB 3IKKA 3D4CA 5L0QC 3HN8A 5L6YL 1BT0A 1UXLA 4MXWL 4FQXC 2QPSA 4C83B 1QSEA 4MA8H 1MHHA 4RDBA 4MTMA 2Z0BA 2E0PA 5GRXG 1XH3B 4LK4A 4R0LA 1BBDL 5HGBA 4QLWA 3IPEA 4HG4J 2AQ1B 1IAIH 5SWSE 5HGDB 4EDXB 32C2A 1HTYA 2VTBA 1N64L 2YJLA 3U8ZA 1ZXKA 5LBSL 1NEKB 1UOVA 4Q6IA 4YGAB 1XTLA 3PT2B 3EGDA 1RZFL 3EH4B 3MRQA 4PVMA 4ABVA 4JFFA 3KAAA 3IJSA 3P4QB 2J8UE 4R96A 3SPVA 2J0MA 2A4EA 5GRUH 4GG8B 4P4KB 1ED3A 2INPE 4RMBA 4FDWA 5DQJA 3L4XA 1H3TA 5GGQL 3UCQA 1K85A 5EC2B 4OB5H 3VX0A 4JHKA 3RVXD 1MFCL 3IGAA 3Q43A 4GDLB 4JPKH 2B4CL 3K8MA 2VLLB 1V1PA 2JFCA 1QZNA 4X98A 4US9A 1P4LB 5FF6B 3TYFB 3VXRE 5KN5B 3F58L 4RFNB 1GOFA 3HE6C 3LPOA 3TBTA 3LVTA 4ITKA 5IVXB 1AP2B 4MNQB 5DJAA 4HWEL 3GNMH 1RZPA 2V7NA 5C70A 2M19A 5BYSA 3EOTH 3AG3E 2E3VA 2JKRM 4N9OB 4GSUA 1MREH 1AMYA 3T77A 1SXTA 3OAZH 4IOIA 3S3DB 4PLNC 3WOVA 1FV1A 3L4VA 2H6PA 2NZ9C 2P9KG 1A64A 1XH0A 1PF3A 4NRXB 3FAXA 4OM0H 1CF1A 1T3QA 2EH7H 1HN1A 1KYOJ 4U7MA 4E9LA 5ACLA 1WAAF 3X2QB 1JAEA 3T0XA 5I1KH 3RWIA 4N5EC 3TXMA 1JI2A 4JZOA 4Q52A 4N6QA 2QADD 4G72B 5C0CE 4O1PA 4J1UB 3RTLA 3B7RL 4NGHH 1I1AD 5CBEB 5KUKA 3RA7L 3PJSA 2Q3AA 4MSQB 5IROD 3SBWC 1YJ1A 3P4OA 1BIIB 3DNKA 2PYEE 3SKNB 2FULA 4CGUB 2BC4A 1BZEA 4JMNA 4TNGA 3X1EA 2C9SA 4N2GA 2OJZL 2C60A 5FTPA 3L4ZA 4IHOA 5BRQA 4JFWA 1BXTA 3I9PA 1NYRA 2PMZA 1YQBA 4AJVA 4BQ8A 1E5WA 1WJ4A 3BWSA 3BWUC 1A47A 3P11L 4J3XA 3BRGC 3REVA 5DRWA 4HFWB 3TFBA 5E1AB 5JIIA 2XBDA 3J5PA 2VDKB 3EO0B 4RFNC 1I4FA 1A7BA 3ZY7A 4POYA 1UWXA 5K1VA 2WQYB 5T3RA 1GGIH 5JTWA 4Z7AA 4APOA 3TPUB 2HX8A 1HKLL 4P3CH 2G4DB 4UUCA 1NCCH 2WGNB 1AGCB 5ICUA 1HH8A 1N8OE 5CHFA 2JCCE 1H3VA 4ZRJA 1G4RA 5I9QB 3PP4H 4ODSH 3MRCA 4P59H 3C5ZA 1S9KC 2A77H 2WZPD 1K4DB 2OL3A 3BVZA 4DX5D 3FCTB 4K55A 3AAZA 1JWMA 4E9RA 5HDBF 2K78A 4HKZA 1TS2A 1BQKA 3BAIA 5D3DA 1NIAA 4HORA 1FO0B 4RMSA 4OLVH 3OXRA 2WC7A 4GYWA 2R29A 4GZ5A 2VABA 1SVXA 4LARL 5DJYA 3CZNA 2KAJA 5F7KC 4I6NB 1H0AA 2Z7UA 1WAAE 4XPAL 4L4TA 1OCCE 5K69A 2NXZD 3RLSA 1O7DC 1ZT7B 4EN3D 4JD2G 3CK9A 2X41A 3BYTA 4XBGB 4PVBA 2PPFA 4TN9A 1FXTB 3DQVA 4XWOD 3OR6B 1Q0XH 1P4UA 1XZ0A 4I89A 1OGAB 3AZUA 4OLWL 1FNEB 4E3CA 1P6AB 2KZBA 3ZKNC 2CBMA 4BDVB 1AACA 2ZG1A 4A2DA 2X3CA 1BD2B 3BGMB 2CIKA 3BPOC 4QJ5B 2TSBA 2EDEA 3DBLB 3ULQA 4DEPC 3PE9A 4JE4B 3NH7H 5HYQB 3QDME 1O1TA 1GTNA 1J5CA 4ICXA 1UEMA 4EKJA 1K6QH 2L8JA 3VXTA 4J6RH 3KGTA 3B37A 3FB5A 1IC5H 2YGQA 4NN5B 5E56A 2M8SA 1AO7A 5LLIA 3DRQB 1FNGA 1O6SB 4GW1A 4KROD 4RSVA 4WW2C 4BZ2H 4KO9A 4OZHA 4E36A 5I9QC 4GCNA 4RWHA 2KD0A 3VAEA 3D3VB 4OW6A 4YHPA 2AERT 1MWOA 1NAMH 2LGSA 1U3JA 2ZKWA 2F6AA 3F62A 5DD3H 3UJIL 4IDJH 4XC3H 3K71A 5DT1H 4XI9A 2GCYB 4Z3EA 2X1PA 4B50A 2FSDA 2RDBC 1HE8A 4EZLA 1AXSB 1HC1A 2YBRA 3EAKA 3QHFH 3L5IA 3MNWB 3G08B 2ZZPB 1KELL 1INEH 4X8JB 3HC4L 4YDLC 5B1BB 4XMUA 3PP3K 2EUWA 2ZAHA 3AWEA 3Q3MC 5CWSA 2OMUB 3HTLX 2OYPA 4FJVB 4TULL 4C59B 2XWJB 3Q2WA 2O4EA 1HWHB 4O02B 3RY6C 3IMRA 1L4ZB 2RIKA 1F1AA 5B1JC 1BEYL 4AIZB 5EBGA 3EJYD 3CPLB 3QDMD 5HDBE 4B53A 5ENNA 1U3HB 2X2IA 5JPMA 4NKQB 4K7PH 1XIWB 2P43B 1ZT4B 2ZXDA 2C9VA 4KY2A 5JYLA 1S5HB 3GMRA 1SB3C 3FUNA 2V3NA 3DGCR 2DM7A 3KPRD 4HUUA 2XV0A 4N1HB 2ATKA 4ZUTB 2V4IB 1SXSA 4P9HL 2RTTA 3EJTA 1KJ2A 4N2AA 2G9HB 5KJLA 2CKBB 1CR9L 1DJIA 1PEZA 3DETD 3O9WB 3F8UB 2X9YA 4OZGF 1KT1A 4NOFA 2EDTA 4IOFD 3V9EA 2ZCZA 3SJVD 3KYKH 2VDPL 3VWJC 3ZKJA 2EDWA 4I1AA 3DX9B 2IDSA 3LQAC 1EQWA 2RQ8A 4LLDA 4GSRA 2PM6A 3HFFA 3V2AR 3DGDA 1PNCA 4OZAA 1UHVA 3OTNA 3PHQB 3BJLA 2OQJB 2VSXE 2DQIH 1KGXA 2EC8A 1XQQA 4ZSOE 1J1OL 4L29A 2BNRD 2DM2A 2YD5A 4MDIA 4Z77A 5IQ7H 2DAJA 1HCZA 1TY0A 2B08A 2CLVA 4YJZL 4LT7A 1WRIA 5EZOH 5IQ9A 2K8MA 5T3XH 4AMXA 5GS0D 4U49A 1TZ8A 1RZJC 4JHBA 1TZGH 1TKYA 1JV5B 2BPSA 2KDMA 4ODHH 1MIML 1ROWA 5D66A 1OHZA 4XP4L 4Y5VB 5H37H 1D8DA 1UGMA 2DJSA 3HS0B 1ZGLA 5FUCC 1OQQA 1OPGH 3DXAD 3SE3A 4GTRA 2J8UA 2PF6A 4PGEA 4E41B 2YSSA 1QLRB 5BT1A 3LSOB 1Z9SB 3PWUA 3I75A 1FUNA 3TBCA 4K07A 3EJCA 1H6OA 3LHPH 5AVQB 1ZLWH 2KTRB 3V3XA 5HGAB 1Z9LA 4YT0B 2DRUA 3HN5A 3LPPA 3E6HB 5FCSH 2ZXAA 1I1AA 3FONB 4YTNB 2YMTA 4BA8A 2QGCA 3PL6A 3O9WC 3AKJA 1EV2E 3MRKB 3VXRA 1IKFH 4CSZA 2V0AA 3VACA 5J56B 2DWXA 3OGCA 4N0FA 3N9YC 2IOOA 4JZJC 2ZYHA 1LGVA 1JD7A 3PWPE 4XN4A 3V95A 4KZDH 5AQAA 1R3JA 5GISH 3Q8BA 2E7LC 4JG1L 3QE5A 2R0WL 4NRYA 1WP6A 3OWEA 3RAJH 3ISMC 1SN2A 3GM0A 1ZHKA 3BUBA 5CEZH 1GGCL 3W9DA 2F9BT 4YDYA 1A14H 4GIAA 4OZGE 3WUWA 1N6QL 1M6UA 3A9KA 3GTNA 5B38B 4GSXA 3A6CL 5JHLL 2JIXA 5DFAA 2FAZA 4G6ML 3EYUH 1LEIA 2XGOA 2H26A 4ZI8A 1JZJA 4GOCA 3THML 1YMPA 1AGDB 2IDQA 5AQ7A 3S2AA 2R5SA 5D7EA 2CDGB 4WAAA 4A68A 4TUOA 4WTZA 2R02A 4GQRA 4HSCX 1RLFA 1VCBA 5C0CA 1UASA 3NEOA 2PP8A 2OCCE 2DKUA 3K6SB 1YOVB 4K73A 5KAQG 1JHKL 2A5EA 3GRWL 3ZDXE 2FIKB 2WZPA 3U79A 3W2DA 2JSVX 1A6UL 2O5YL 1BIHA 2PYEA 2QELA 2ZWNA 3MODL 1TSRA 2Q10A 1SJHD 1F4WH 1Y0LB 4UZGA 4MASA 3GM8A 4NENA 5DC4B 5DMKA 5IMMB 1JWSD 5D7SL 1WFYA 2DLBA 4R3DA 4K3HA 3N30A 2EIZA 4YK4C 3AM8C 4FFVD 1VZHA 4Q14A 4IU2B 3ATBA 3DURB 3CFNA 2JLLA 4K71B 4LAJH 3MKQA 4Q94A 3IFPB 5CIPB 3TA3B 4M0WA 2Q8AH 3K2KA 4M1GL 2ONDA 3ZU8A 4EN3A 3U9WA 3Q7AA 1AIFA 1QX1A 2BS71 4BFFA 1OAKH 1I9JL 4ODVL 5IJBC 1V5OA 1DQDH 2J44A 4QHKJ 4MNHB 4MAYB 1UJKA 4QUOA 1G7QA 1XFPA 3TCXA 5FO8B 3UQBA 2EXYD 2JCCA 5C8JB 3Q06A 3GYZA 5JIHA 2SODB 2Y4UA 1J18A 2BOCA 3FJTA 4ZPVB 5KBMA 2VYIA 4JKPH 1LD7A 3NSDA 1Q1JL 2HJFB 3H9HA 1M1XA 4JKKA 4GNKB 3NAWA 5FR6A 5TSSA 4WHDA 4ODUB 5E23A 1IE5A 5F1IA 4WEMB 4M93C 3Q3FA 1BVLA 3GJEB 3EJQA 3QI9D 4KK6D 1R4XA 5I15H 1G7HB 4NRHB 1MAMH 2DM3A 4RFEB 1BXVA 3FWVA 1QTPA 2AXGB 3E37A 2XTJC 4LCYA 1FH2A 4GKOA 3D9OA 2YN3A 3BAKA 4OGAD 2JJTA 5MERA 1HSBA 1SBBA 2XUWA 2ZWSA 2R51A 3NJHA 3O6MH 1LP9F 5FKPB 4YNDA 1EAPA 4DN3L 4CSSA 4PRDB 1IC7L 3ZT5A 4F8QA 1N68A 5TE4L 2ASQA 3TUOA 3MOAH 5T5FH 5HJ3A 5C7ZA 2WLNA 2P5WB 2MOVA 1SZAA 4PJIB 5AKTA 3IDYB 2MQGA 4NLAA 1SYVA 4QAMB 4HIIB 4MB3A 4Z7NB 2A1WH 4JL9A 3FB8A 2VRRB 5CJOH 2XN9C 5BMIA 2BJML 1IGFL 4V33A 3QDMA 4APFA 4BFKA 4A90A 3VG0H 4P46B 3T2QA 2KATA 1BA9A 3V61A 1DLFH 1EDYA 1NCDH 1BQUA 2BTEA 2RCSH 4GPVA 5FHBL 3AI5A 4UWFA 4DQAA 2ESVE 4JQXA 3UTSE 4RX4D 5TDOB 2ENJA 5CHVC 5FXCH 5FWRA 1DN0B 4XAKD 1GHFL 1X5YA 2R29L 5FW8A 4W81A 3LXFA 3POCA 4ZUVB 5IVZA 4LVOC 4FU3A 3LYAA 1OGPA 3QDJB 3SJVA 1PYWB 2VSKB 3MAWA 4X83A 1XCTA 3UTOA 1ZP0B 4JVWA 4NAWA 3G6DH 1WCBA 1AKJD 4OW0A 3U7ZA 2CHWA 5I82A 1UADC 2BW5A 1BQHG 1K8IA 4LHUD 4WHTA 3RWEB 2BYEA 1DANU 4NFBA 2VZSA 5DUMH 4R90H 2NYYC 5F0JB 1TZIB 2X6IA 5HDQL 1OCZE 1CXKA 1X5KA 4U3CA 3ULVD 5HKPA 2XC8A 2BNUB 3STLA 4A7TA 2LMCA 2IQAB 4RF0A 5E6JA 1THAA 1KJMB 4LEBA 1KEMH 3MC0A 1QFWL 3HC3L 1LJMA 4HT1L 3MCG1 2MQCA 4OGQC 2P58C 2GRQB 1VZ6A 4F6RD 4MRCA 1AFVL 1IEBA 5C3TA 1BQ5A 5DRZB 2APBA 5JDJA 4DZBB 2DMHA 3U3WA 2ESVD 2C7UB 5J3HC 3WKPA 3EO9L 3Q5TA 3DROA 3GMMA 1IHGA 2EVHA 4N0RA 4FQ2L 1X6LA 2A73B 3ALBA 2F53B 5TR5A 5DPTA 2NDGA 3IAPA 4XB8A 1J0YA 2D7TL 1E67A 2ILRA 1H8SA 3ILEA 3V0DA 2L0TB 4YDOA 1WBZA 3IGLA 3CSGA 5DR5L 1GS6X 4HF5H 1JN6B 3MLVL 4GU5A 1ZLEA 3PS6A 5IW3A 5EN2A 4E9VA 2X6JA 2WLHA 4HJGB 4C7YA 1YECL 4H1LA 2WLBA 5BYRA 3N42F 1CLZL 1OM3L 2K8CA 3T2OA 4ZSOA 4FXGC 1U6AL 1N6VA 3U4EG 2EYSB 1OAZL 1T80A 5F0PB 3EFUA 3JWNC 1OAXH 4U04A 3NCJL 1HK6A 1ZJAA 4K7SA 5I8EB 4N39A 1S9XB 5G5GA 5CINL 1KCVL 1W80A 4HJJL 4P2YA 1LQBA 2OMNA 4FNLH 2QC8A 2J09A 1E4JA 3QUGA 4NWUH 5DVNA 4F7MA 2EDHA 3G6JF 4F3VA 2BO0A 2F74B 1KBGL 3S36L 3D08A 3MLRH 1KJ2L 5ESVA 2LLNA 3QSKB 3JTSA 3VFKA 3KWVA 5DD5L 1YRKA 2ITFA 3LS4H 5GGUB 4L18A 4FYTA 3LY6A 1WGDA 3ZSTA 2Q0ZX 3TZVB 1RUQH 3UFIA 5ICYA 3JZYA 1BBJA 2ZAIA 3E34A 3CTTA 3W57A 5BZDA 2PTVA 7CGTA 3PPAA 1FGNH 3D51A 2FO7A 3U7WL 4L9DA 3Q7JA 4IOSD 3X11B 5I6OA 1NFDF 1I7RA 1EIBA 1UKTA 3ZUNC 2LHEA 2NR2A 3AV8A 2ETBA 2OJWA 3S5LB 1MQKH 3CHMA 3PWPA 4CHKA 3RKDD 1KYAA 1M57B 1T6VN 4EUTA 3ILDA 5G5DB 3UF8A 3WTTA 1OIOA 4UUJA 2N7EA 2DQTL 1IGJB 2LRWA 1BLNA 2Z4QB 1MJUL 3NBNA 2MCPH 4OZGA 4ACFA 2YKLH 5DCNA 3LPZA 3N5AA 1OWLA 3GZSA 4KXAA 4TQPA 1ETB1 2R9HD 3AT0A 1OW0A 3ARDC 4FCHA 1DDTA 5DFWH 2ACZB 3NJMA 2HP4A 4Z7UB 5DJZB 2AEOA 2CNZA 2WTRA 3OC8A 5HYSA 5KSVA 1N4QA 2W38A 3D09A 4I1OB 4NHUA 2Y5TA 3PWNB 1T1WA 4I3RH 4TUJB 2VZ3A 1NBVL 2MBEA 2ZYIA 2AXVA 5K33A 4YFEA 3LZNA 2QFRA 5C2TB 5BNXD 3SGHA 4F2MA 1NMAL 5D5MB 4JG0H 4PGCA 4XXWC 3ZL1A 5GGVH 1R47A 4Y2OA 2UVFA 1BXUA 4JR9L 1REIA 3CZUB 3G9VA 4BKSD 4OFIA 3Q3JA 3UI2A 3G6JE 3EFDL 4L3EB 2GUYA 4JQVC 4P5SA 3TJEL 1VSCA 2P24A 2DL2A 1CU4H 3CFQA 5LN4A 4AW4A 1Z32X 1FNHA 2WTOA 1JL8A 4LGRB 3RPKA 1A5RA 4I6EA 2GAZA 2AEHA 2DWTA 3V6OE 2JU6X 2Q20A 2QSCL 4IS6B 2HRPH 3QCAA 4JO3L 5F88A 3WS6A 5LGJA 4UDUB 3KPSD 3F7PC 3O4ZA 1G7LA 3BUPA 4TUKH 4Y4FD 1QAWA 3IHYA 3H54A 4LLMA 4WHCA 4KHXH 3UL4A 1XF4A 5EE0A 3RNBC 4EI5B 4XNBA 5E99L 2TAAA 1NFDE 4FA8A 4K2UH 4ZMZA 5L2JB 4E2OA 3FKUS 2AXUA 1OCRB 2D03L 2XRZA 1UC6A 3ELQA 1KTKA 4WWMA 3GI8H 4BA0A 4DK6A 1EMTH 3LTVA 3CIRB 3QJUB 4WHYH 4BERA 3W2DL 1FNFA 3UIPC 1UQSB 3IKOB 3QFDA 2JRHA 2VRQA 1S64A 1HDMB 4NQEE 3RJOA 1N6ZA 1QOAA 3SE9H 3CF6E 1FZKB 4AUJA 1T2JA 1VJSA 3EG9A 3FO9A 4GAYA 3C5JB 3T9WA 5EPMA 1E0ZA 4X6EB 4PB0H 4DQOH 1D5XB 2ZJSL 4U1IB 2H6FA 2VDPB 3ZQWA 3GI9H 1OSPL 3PPSA 3MA7B 3P0VH 1KPVB 4KRLB 4Q2ZA 2J43A 1FH5H 4S0TD 3JWOH 1HEZB 5ENWA 3BKCL 5F3HA 4OGXH 4XNYL 1JGDA 4JE3B 1AC6A 1LO5D 3KYMB 4GUCA 4NO5B 3AY4A 4YUEH 1CD8A 3DHJA 2VXSL 2C4FU 3H3BC 4LHUA 1FC1A 4BM7A 2NQDA 1TYRA 2X4RB 1IGTB 1WD9A 4DTGL 1CF8L 5IUSA 5IWLC 2VH2A 3H6NA 2AK4E 1AI1H 2Y7LA 3WJJA 5H7PA 3N41F 5L4MA 4YIQA 2GRRB 1WITA 2GKIA 3EOYG 1ID2A 1K5NB 3I3TB 2BIMA 2Z8VC 4FLQA 3P2BA 1FVDA 1OD7A 5DWUL 5HJDA 4ZFFB 5E51A 4EI5C 4F80A 2BRRH 2ESVA 2NY0D 3KBEA 3EC8A 4OCSH 1G6RH 3U0PB 4PJCF 2J8SD 2YAFA 2FLMA 3NTCL 3QIJA 3OKNA 3GK8L 2GFBB 1T0YA 1FVEB 3L6FB 3S7GA 1NGWB 4EJ1C 1HYSC 3DEOA 1KTDA 4X6CF 4R5VA 2R2LA 4YXLH 4HDOA 1CS6A 4PW4A 3FTUA 4LIQE 2CGYA 3ES6A 5L4IA 4A66A 4S0SD 2JYEA 3MUUA 4P9HC 3SKJL 3ZE2B 2EILE 4I0PD 2ZOKA 3STBA 3E1F1 4OLUL 5DC2A 1HNFA 3LZOA 3VMNA 1D5XC 1ZLVH 1GGTA 5KNHD 2W59A 3GHEH 3OX8B 4KDTC 2PWGA 5FW7A 3FUFA 4PJ5D 1X4YA 4MMXA 1DQQA 1QSEB 3EIJA 3IDNA 3NCFB 4R0LB 5HGBB 1TZ1A 3TWRA 3CFBA 4UT6L 2ISDA 3HM6X 1V54B 4TOYL 2XZDG 4FA7B 4FZEL 2EMSA 32C2B 1I1FA 2VTBB 2YD3A 5FYJU 5BVPH 4TYUA 2GJPA 2DZJA 3MTNB 3LZFL 4Q6IB 3SE4A 4HOMA 5LWYL 2HTME 3D39D 4NJ9L 3EGDB 3H55A 1BU9A 3MRQB 4JFFB 1MVFA 4D9RE 3LJ3A 3IJSB 1DZBA 1QILA 4XPFL 4R96B 3SPVB 3QQ9C 4XI0A 2O30A 4CC4A 3K80A 1ED3B 3CX5K 4Z0BL 4DO5A 2MLBA 4N90E 5DQJB 5IEKB 1D5MC 2A9CA 2I7SA 1XCTL 3QT2A 3V4VL 4P5TB 4U1NA 5A40E 3IGAB 3K9OB 4LNFA 1SFHA 5DQDL 2X28A 1V1PB 2PO6C 4PR5A 4X98B 5EOTA 4ZZKA 2WTPA 1TQUA 2N7AA 5LNEA 4N3UA 1P53A 4IRZH 4WI5A 2IWFA 3WY4A 2WNKA 5DBKA 3TBTB 4D8OA 5KG9A 3IAM1 2F19L 1J8HE 3CVDA 5DJAB 5DYOA 5F9OL 4GUQA 2V7NB 4NBZB 3AWGA 4YSTA 5IBTH 2O6VD 1OAJA 1SHWA 2Y36H 4PJCE 4QXGH 1O6VA 1JDAA 1A3RL 3VFUA 1J1PL 4N8UA 1J12A 4Y9EA 5I1LA 2EC9U 3T77B 3D25A 2TRHA 2Y0SA 4IM8A 4IOIB 1AQKH 2AJYL 5EIVA 4JFZL 3ZEFA 4YVUA 1ET5A 4X6CE 3C8YA 4R7VA 3DXMG 2QQKH 2H6PB 1WGRA 3P0YL 4NQDE 2E4FA 3IU4L 2AABL 4EFOA 1S78D 5LP0A 2L05A 4XOCA 2VLME 3K3QA 1T04A 5CZKA 1XF3B 5J0BA 2C9UA 2J1ZA 1S5IH 3V4PA 3RWIB 3JVGA 2LUEA 1T0MA 4JZOB 1A4AA 4F7TA 3X23A 3CKBA 3VFVA 2OSXA 3DGGA 3AE4B 3DBRI 1OF2A 4U07A 1TNBA 1L0QA 1XGPA 2YUXA 4IK6A 3ULUF 2ZP0T 1AS7A 4FL4B 1FORH 4JG9A 4KJWD 3PJSB 4K5PA 2AJXL 5F9AC 3SHSA 1U2VG 2MRIA 3FU3A 3K1KC 3P4OB 2DI8A 2V17L 4M5TA 2OSWA 3WO3B 2RDHA 2BC4B 3OJMB 2G30A 5M7QA 2ARWA 3R1GH 1GCFA 5BW7C 3CIQA 4RA3A 2MYOA 3HMXA 4IHOB 3STZA 1UWMA 1SOKA 3ABKB 3N3KB 3BO8A 5HRYA 2QKIC 3GLZA 4P5TC 5FYKE 2UY7A 2QYUA 2D0HA 5CMWA 2YD6A 1UZ6F 1T7XA 4Y1AE 5TQ2H 3REVB 1SGHA 5DRWB 2BOBA 1QRNE 1N70A 4AEEA 3L4UA 5DZPA 1KGUA 1QFHA 5L88L 1I4FB 4DNLA 5ANLA 3OLIA 2G9KA 4BHUI 2FK9A 3QYNA 3QHZL 3QCUL 4NCDA 1EEUA 1JCSA 3CLWA 3HBPA 5E9DE 4UTBA 3C72A 2WO3B 1HFUA 1DBKH 3P3UA 2M63A 1IJNA 4FZ8H 3CLJA 3R2TA 3A4RA 3QB2A 2DB8A 4B8CB 3MRCB 1JZ2A 3C5ZB 4QRFA 5LDSA 5GRZA 2JJVA 2OL3B 1MZCA 3DSUA 2YJQA 1G0XA 4RH6A 2XZTG 4AEHL 5LBVA 1OK0A 3AAZB 4L9PA 1JWMB 5C0DA 5SX5K 1BPLB 3WNNA 2KANA 2VW6A 2KFJA 5GRVL 1NEUA 4A2GA 1AYRA 1A25A 1JNLH 2BW4A 3HRZA 2BXYA 4HKZB 4NBYB 5FYKD 2X6FA 1N0QA 3G6JA 3CHXA 3D85D 3KGUA 2ZXWB 3OXRB 3QPQD 5BZXA 1NI2A 2BIPA 1G6VK 4AYEC 5HY9A 4RBPH 2VABB 5DJYB 2PW2A 4LQFH 1KB5L 3N06B 4LLGM 2J1XA 3V6OA 4L4TB 2IQCA 2C5LC 3WDHA 1L7YA 2R56L 1DFXA 1HT6A 2HKHL 4OQTH 4WEUD 3ULUE 1XZ0B 2Y5PA 4L8SC 1CK0L 3KAEA 3NS1A 3AXLA 4YWGL 4RVBA 3BIBX 3CGTA 3PZ4A 2CIKB 2DIAA 4Z68A 5CP7A 5DD1H 2CO4A 3EBAA 4QXTA 2EUZA 1F2XK 4ANVA 5HVWA 2I25N 4LAQL 4DI3A 1KTCA 3IRPX 4GPKA 5LXGH 3VXTB 2KM4A 2JYTA 1E42A 2Y2TA 3FB5B 2HMIC 3ZOAA 4TRQA 4FLSA 1AO7B 1U95A 1XEEA 2YHCA 4NX0A 3ZL4L 1FNGB 4GW1B 1WY8A 4OZHB 5EUKA 2D7MA 2NY6D 3GF8A 4YHPB 3DV6A 3BVMA 3BFWA 5B38G 4KC3B 1FLRL 2FYVA 3U83A 4GXUN 3MX0A 1SBSH 3K71B 1N0XL 1XCQA 4D0DA 7PCYA 2YBRB 5SV4A 4KIKA 2CWRA 3WANA 4OM1H 2ZUSA 2X4PA 4ZHOA 4WNFA 5CWSB 2PETA 1JZFA 5B1CA 3PTFC 1OB1A 2EE0A 4KDVA 4USAA 3WEAA 1RVFL 4BY6A 2ZCHH 4UAOB 1WWAX 5KYNA 4JKNA 4NNPH 1FYHB 2HWZH 1JFQH 5JPMB 3SCMA 2VDQL 3UJJH 4OIAA 3GMRB 2WXHA 3A67L 1A4BA 3BQUB 4ASWC 3KM2A 4ABWA 2F7OA 5ANRA 4P2AA 4HUUB 4M6OL 3V0EA 4U63A 4ZX3A 2GVYA 2ATKB 4PS7A 1WTGT 4FD0A 1KJ2B 1Y18A 4LEEA 1NUGA 3ZYKA 3T1FA 4ZMXA 5GZNC 3VSUA 1D6EC 3AMKA 1TCRA 4PLKD 2OEWA 4WUUE 5J6SA 4F2FA 4Z1PA 3MLZH 3Q5MA 3FYEB 3EF4A 3KL5A 3P30H 4LLDB 5DWPA 4R4ND 2GUOA 3PGFH 1C16A 4F58H 2DD8H 1BREA 2Q7NA 2OMWA 5L9DH 4F92B 4XPHH 3I6KA 2IV9A 2J6WA 2BNQD 1KWKA 3VD9A 1OGTA 3BK1A 3FHEA 1GZHA 4L29B 4MDIB 4DKEH 4Z77B 2H3NA 1FAIL 1UM4H 1A7OH 3H42H 3QZBA 4MZ2A 3TGXA 3WHXA 3GMNA 2ALAA 4BFOA 3VD1A 3DK2A 1TGZB 1MDAA 2CLVB 3IMVA 1A4CA 2FJHB 3HOGA 1UM6L 5DHVH 3SDDB 1GS7A 3HNVH 1LO0H 4G6FD 3WNLA 4AI7A 5AB2A 5HHQA 5IQ9B 1GJWA 1YA5A 5IZ7A 2WXIA 3BAJA 2Y7SA 4CMMA 5FR3A 1P1ZB 1FXAA 4ZMPA 1C08B 4CBPA 2DTSA 3OXSA 5GJSH 1ZGLB 1T7YA 3DJZA 2NCEA 4Y5XC 1XR8A 4IM3A 2J8UB 2YSSB 12E8H 3N71A 2D2OA 1UJJA 1BOYA 4I6LB 3I75B 1CG9A 2DYBA 3P4MA 4B96A 3AXCA 1TLKA 3BQUC 3NABH 4OCMC 3N04A 3I9GH 3VG9C 1TVBA 2LSVA 3ILQD 4RGNC 1KLUA 2QADB 4W4OA 4HXDA 4S17A 3QPKA 1I1AB 4KFZC 5KOVC 3PL6B 4I9WE 4NNXA 1LMIA 3GP7A 2WMNA 3VXRB 2OR7A 5B1AE 2PWDA 2CS4A 3ESLA 4LSSH 2ZQKA 3OGCB 3QCTH 4N0FB 5CJQH 3ZRFC 4R3SB 1J8HA 3F65A 4Y2LA 1R3JB 1PGBA 1A5FL 5KYWA 3AG3B 2WXJA 3L3KA 3MJ6A 4NRYB 1DBBH 2WN3A 4YHOH 1RHFA 4PJCA 4YOKA 1PX8A 3OWEB 3TIEA 1ZHKB 3W9DB 1RUPL 4YN3A 2DQJH 4PRIE 1TO4A 1A02N 2X0VA 3WUWB 2CK2A 3UADA 1QG3A 3A9KB 4PP2A 4X6CA 1P1AA 2JIXB 3D2UD 2R69A 2FBWB 4FP7A 1LEIB 2H26B 1WFOA 2WQWA 5F6HI 1HS6A 1AZRA 2DLHA 5G4NA 1E43A 2ZT9C 4Y19E 3AXHA 4U33A 3SDDC 4ESKA 1U8LA 3RJQB 4FXKA 4TUOB 1U33A 3UTPE 3LVEA 1KLXA 2DEXX 1M05A 1MCDA 5C0CB 5F7WC 1ZPSA 2JRIB 2WNMA 4PGBA 4QXVA 1J9TA 4E71A 2Y22A 4ONGL 5CBNA 2JWZA 3DPBB 3AG4E 3HHRB 1X9UA 2DLGA 1OOAA 3Q8AA 4K5BA 1H8NA 5C6PB 2PYEB 2A6DA 3UM0A 5ITBL 2YUWA 3VD2A 4NENB 5DMKB 3X14A 2VJ8A 4UBDC 5KWDA 2EIZB 1T2QL 1CGYA 3O4LE 2QQLH 4NUJA 25C8H 2A83B 2HJLA 3PL6C 1DDHA 1PD1A 4XCCH 4GRLD 5F7NC 1G84A 4H8WL 1BZOA 1ZEAL 4X9IA 4TNEA 2NCNA 2C7NB 1HILA 4PJHF 5IMKA 2NXZB 3PRZA 3CSBA 1AIFB 3UZEC 4CJ0A 4EN3B 1HZKA 4LNIA 3ZTDA 4KKBD 4XMVA 1HTQA 2HYMA 2J6EH 4BH8A 3D0VA 2VDKH 1WY6A 5C0IB 1G7QB 1TETL 2IWGA 2F0YA 3C6EA 2JCCB 3C0RB 5C3LD 4FG2A 2BOCB 1JG9A 1LO4L 5A2JH 3ZJUA 3BP6A 3ZYLA 1KBKA 4OF3A 3A9JA 2K8BA 2D07B 3H9HB 2LJIA 2WOYA 3EZ8A 4JIOU 1NOLA 4NY0A 2YS4A 4GXFA 1I3GL 1BVLB 1HG5A 1KEGH 3HMXL 4OIFA 3O4LD 3TIDA 2IH8A 4KROB 4ZXBD 4HUNB 4LCYB 1KG0A 5GJTH 2ENQA 4NPJA 3CXDL 3WD5L 4NJAH 2CK0H 5MERB 3WTVA 1HSBB 1SBBB 1DJXA 4G5ZH 5DRXB 4ZDHA 4HUVA 1FO0H 5AIJA 4RH4A 3SGDI 1F41A 1OCCB 2A38A 1FFRA 3KXFD 3VXPB 1EAPB 1U8MA 4BZ1A 2FH6A 1RMFL 4RGOS 1GB1A 4G24A 3GSWA 1FZOA 2WINA 4W9FA 3FQXB 2QVFB 5DZNA 4FQIH 4WGKA 2OI9B 4PH8A 3NDYE 2YHEA 4UTBL 2LUMA 1I42A 4CBZA 4UNIA 2B16A 2XKNA 3SDLC 1OAUH 2RHEA 1O1RA 3VQMA 1DFBL 5IVNA 3FB8B 1MFDL 5GZOD 4ZOHC 4A7SA 3SNXA 3ARRA 3Q47B 4MJHA 2VXQA 2V0PA 4KKJA 3QDMB 3F64A 3D06A 3SIKA 2FT6A 3CCHA 4H2CA 2ADFH 2BFVL 2TSAA 3Q1EA 5C09D 3SDXA 4G70B 3H8HA 5AAWA 4HS2A 2JB6A 3M46A 1A3LL 4HXAL 3IS0X 4JVSA 5CFAA 3ZDWA 4GUOA 5JW4N 4RZCA 3PNLB 4Z23A 3AKLA 2BSTB 1CD0A 3UAJD 4LOEA 4PJHE 3FYIB 1PFDA 4N2CA 1YN4A 4JRLA 1R24A 3TT3H 4GRMA 3AW5A 5IVZB 5JQHC 1MI0A 4DHJD 3SJVB 1A6VH 5BO0D 1SA5A 2KT7A 4WFHD 1XCTB 4DI4A 2BVOA 5KUMA 2WLYA 4PD4J 1IKNA 2GRNB 5TGBA 3B56A 1WCBB 3RWFA 4WF7A 1JRHL 4Y4KB 2QGDA 4PWHA 5D70L 3D34A 1QNIA 1MY7A 1K8IB 2UZXA 4WHTB 5D7LE 2DEWX 2F15A 4R7NA 3EHMA 2EINB 4PRBA 3JQ0A 2E75C 5GGTH 2WKOA 3DLQR 1WAO1 4JHRA 2BNQA 3L2MA 3LNHA 3STLB 2HX9A 1S2EA 5C9KA 5F9DC 3Q7FA 4JPWL 2NSMA 2V3FA 3VYOA 3M1OA 5J57B 3IETB 4P6VF 2DYPD 1AZVA 5HDBB 3N55A 4JO8A 1MHPH 3LN4A 4UZUA 3WTYA 4D3CL 2G4GA 3MC0B 3MRGA 1T7WA 4YLBA 1ZVSA 5HHVH 1GAFL 3TX4A 1IEBB 3TG5A 2WM9A 1Z9NA 4O02H 4XVUC 4B5EA 1Z3XA 3QC8B 1KZYA 3J8F7 5DMGC 1HI6A 2D7QA 2YAOA 4QRRD 5FQ8A 5E24E 2FTAA 3QIWB 3L22A 1OT1A 5FUOH 1NCUA 3DROB 4M8RA 3GMMB 4UQEA 1SJXA 3CK0L 3POHA 4JPIB 3WKML 5G04J 2M2DA 4XI5D 3U4BH 1N5YL 4NHCL 2HE0A 1LL1A 4JFDD 3TYGH 4ZOCA 2R15A 2KDBA 1QI4A 1KACB 4JC8A 4ODTH 1A9VA 2XK5A 3O13A 1MCFA 3P4LA 1U8OA 1WBZB 4WJG3 1YEJH 5FUZL 2CKBH 3EHBD 4IKJA 2WJ7A 2FEEI 3NP4A 2NY2C 5EN2B 1X5FA 1NLBH 4G7YH 4G3YH 4H1LB 4FCAA 1P4BH 3UG5A 4ZSOB 1N94A 1YCSA 5AKVA 1ETA1 43CAA 1HAUA 2IQ9L 1IUEA 1MHQA 2H0PA 2PABA 2JLBA 3QUKA 1G43A 4FMKA 2G3NA 2QZQA 4APQC 4C4KO 2GI7A 3K6FA 3ZO9A 3O65B 1U4AA 3GHBH 4KKNA 4Y4KC 4MELA 4MVBC 4FS0A 2KN5A 2E3TA 1V05A 1J8KA 1JS4A 1XD0A 1YLBB 3QGVA 5D72H 4ZNCD 4XWTA 1YVLA 4M43H 4ALAH 1PEWA 3S7BA 1WZ1H 4IIQC 4DGYL 4F7MB 1OGWA 3L4PA 1GW6A 2C2LA 1QOKA 1YA0A 5ENOD 3PQYE 3UTSA 3NG0A 2X0UA 3NACL 1ZA6A 1KN2L 3QWOA 2Z31D 1EAQA 3JTSB 2FECL 3VDCA 5DJCA 4YSUA 2ZUQB 2QTEA 4LHJB 1QNFA 1NBQA 3IRCA 1OXYA 3NEEA 1KPRA 1YG9A 4LSTH 2P8PA 1BVZA 4LIQL 4Z3TA 4J8YA 4LRIC 5K5YA 5KSAC 3O6FD 2XX0A 4XMPL 5MHSE 1BBJB 3QIWC 2WLKA 5EWIH 5HDWA 2Y1ZA 3ABVB 3H3PL 3B9AA 4X4YA 5BZDB 2MWCA 3OBAA 4KX9A 5CO1A 4E9YA 3MZLB 3VXME 1I7RB 2KHAA 5A2AA 3D9IA 1H0DA 3PWPB 4UT7L 4G8EA 3HG0D 2YAQA 3WAJA 3L8QA 3UIYA 3E0GA 4GW5A 3HVNA 2WYZA 4U8VD 4OGZA 1BG1A 5I1IH 2MEJB 3OHMB 1KB5B 4Q6YA 4X5PA 3NBNB 4PRIA 4OZGB 1FRRA 1BFOA 2MNWA 3GJFK 2ZX7A 2VLRE 1JPTL 5D71H 1X5XA 4KHTH 5C0GA 4FHKA 3U1PA 4N3CA 2IDTA 4DUXA 1WC7A 3DYPA 3UPVA 4N9GA 1EAJA 3T6VA 2ICWI 5CGYC 4CN1A 1FNSH 1QACA 4O9HH 2Z59B 3EUB2 5HYSB 5KSVB 4Y19A 2WTRB 1XGUA 4IBTA 5C2BL 3LD8B 2FX7H 4NHUB 5CRVA 5C71A 2O5XH 1F8TH 3ZBMA 2Z92A 4MS8D 3C87A 5G04C 4JM4L 3HG1E 1Z5SC 1Q0YH 3ZDXB 5KEZA 4MXQC 4PGCB 1ROEA 1O0VA 2CHZA 3O6KH 3WY3A 2XN0A 4Y2OB 2KACA 2IONA 4PCSA 3TV3L 2GT9A 1CYWA 1FF5A 4K8RL 3FCBA 4HHWA 5F9WC 4HKJB 3OAYK 4EPSA 3IE4A 5F7BA 1HVXA 3O4LA 2BIQA 4K0RA 1I1CA 4ZXBA 1IC4L 2QGEA 3VWKD 1DBJH 3S8GB 3HBZA 3H85A 4TTDC 2GAZB 3QQ4A 3VB9A 4AQ7A 2VSNA 2ZNXA 5DRNA 2VN4A 2R69L 3WYRA 3KXFA 3AC0A 5F88B 3SQBA 5LGJB 5HBBA 3LRGA 1G7LB 4R26H 5CIPH 3NJXA 5ISZE 4LLMB 2FUQA 2W3RA 2HTLC 4HROA 1XF4B 2ZTBA 3D7PA 4FG6C 4RIRB 1AYFA 1XO3A 2JKSA 3TMPB 2XVGA 2GI9A 5GZOA 1BAGA 4PB9H 4XPBH 5GS1B 3RTQB 1FFPA 2VDQB 3P1MA 3F3HA 3P4SB 3QXWA 3HI5H 5ADPL 3EADA 3QFDB 3TWUA 1WAEA 2ZONA 2PNDA 3HE7D 1F1DA 2X5PA 4E74A 3KYOA 4H88H 1DBAL 1VA9A 2IBGA 3EG9B 3FO9B 1KUMA 3FO2A 4GAYB 4I77H 4YDZA 1VPOL 1ZVYA 4YDIH 3OJ2C 3DDFA 3PV6A 4OD3L 2Q2EB 2WY3B 5EPMB 5FYKL 4AIEA 3DSFL 4HBCH 2H6GA 3UAJA 2GPZA 2RGSA 3DX3A 3HC0A 3CC1A 2FCNA 2KOXA 3T2PA 1GOHA 2NR6A 2VQ1A 2XZZA 4ETYA 1AVAA 4AQAA 1FIGH 4LSRH 3GXTA 5C0BE 4Q2ZB 4AT6B 4KMQA 4ACLA 5ENWB 1Q38A 5F3HB 1JGDB 2O72A 3P42A 2PWEA 4PV9A 1JGUL 1PC2A 5KVFE 4AYSA 5FECA 3ENEA 4DX1A 3MCLH 4I8DA 2I60H 1HX8A 3C8DA 1IPGA 4GH7B 1GYCA 2AZAA 1LO2L 5CSZA 2Y5EA 2H2SC 3KLDA 5E5RB 2XN2A 4A3TA 2DZOA 2DYPA 4BBNF 5T3ZE 3DO3A 3RWDA 3ASWA 3PAZA 4N2SA 4YIQB 5JW4M 2X9ZA 2OHFA 3DBHB 4II2B 3TBVA 2WPGA 2YXVA 1FVDB 4Q58C 3D4YA 1UH6A 2ESVB 1F90H 2HT4D 2AV7A 4G7RB 3UTSB 4QRRA 4CCAA 2VN5A 1OARL 3BUYB 1LFDA 2WDRB 2ITDA 4PJHA 3OKNB 5GS1C 5LBSH 4EZKA 3RTQC 2L3ZA 3KQ4A 3V5DA 4JFDA 4M6MH 1KTDB 2IDFA 3V4UL 3ABLE 3E2HB 1RERA 3UJTH 3ES6B 5A3ID 2V8SE 4YBQC 4K7PX 5D7JD 3FTZA 2VDOL 4YL8A 3EDJA 4BZ1L 3RIAK 1EDHA 2VZTA 2ZOKB 1AOZA 3ULUL 2R0ZL 1N5AA 3SGKA 1PGRB 4F7ZA 3BDYL 4PG2A 2X4UA 2B4CH 4LCWE 3RNGC 4TNFA 3AAAC 2KDIA 4MMXB 3I4RB 4MHHG 1DQQB 3BPLC 1H8LA 2XVLA 5JOPE 4L8BA 4PT5A 4HJUA 4JZYA 2X8XX 4QOKD 4FJYA 3IDNB 5JQIB 4DXFA 2VXQL 1XAKA 2VUKA 3SODB 4P57A 3X3GL 3CFBB 2ILLA 3A24A 3OKLA 1EJ8A 5FKAA 3R18A 1FFOA 1I1FB 4HWEH 5FAAA 4ONHA 1NIDA 3FQTA 3L5WA 2HT3C 2OMBA 5T1DL 1JYVA 3BZFA 3JXAA 4ICUA 1JWBD 3JYBA 3L1GA 4KDIC 1IGMH 1RPKA 1JGVH 4HAKA 2JABA 1IT9H 5E08L 4HXIA 3QRGL 3BQVA 5JNYA 3GXUB 1P7KA 3LXUX 2JQZA 1PCXA 1XVSA 1UD5A 3L1EA 1U0QA 3O6FA 5GRWA 4I1PA 1Z2KA 4PR5B 4OH2A 1QI5A 4HPLB 5J6HA 5T3XD 1ZRUA 4QNPF 3CR3A 3V2XA 3MU3A 1SA4A 2F8XK 5EOTB 3ZRCC 4AMKL 4Q9QL 3P9MB 4LLAA 4FQ1L 4HJSA 3ZE1B 4KQ4L 5JMRA 1TQBB 2N9KA 2D7NA 4DAGL 3GE3C 2YZ1A 1A7NL 4WU5A 5DYOB 4KNUA 4BFIA 4JHJA 3MXWH 5I76A 1OWNA 1TJIL 1OQXA 4LO9A 5EX3A 2V5MA 2HR2A 3ESNA 3B2VL 2OJZH 4HH9B 5GPRA 4TQ8A 5KYUA 2JUOA 3MGOA 4WFGD 3VFUB 4AM0B 1OP4A 5I1LB 1F9JA 3KUDB 4L4VD 3G5XB 3RWGA 3D25B 1N7ML 3AITA 1I85C 1WJ3A 2R83A 1NDTA 3PAYA 3PQYA 2JJSC 4OSUL 3UTTD 4K3DL 4MMXC 2BS4B 2RQEA 3P11H 4IYKA 3NIGF 3A6BL 1GRWA 1TT6A 3VR9B 1TF4A 1KTLA 2WN2A 4ZW3A 4TSAL 1T04B 2FQEA 2D4FA 2GW1A 1T0MB 2K7QA 4XP5L 4L4JA 1ZS2A 4F7TB 3VFVB 1UWYA 3DGGB 4HZAA 1OF2B 4C47A 1F4XH 3D1MC 1GJIA 2Y07L 4M1CC 5ENRD 4ZS7L 1A7QH 1NBYA 2H8PA 4DKFL 3N40P 3G5YA 4DXGA 1YN7B 1FFTB 5CEZD 3K46A 1KIQA 2FBOJ 4W9IC 3MYVA 3HVZA 1ZXQA 3VXMA 2OJ1A 2CQVA 3PWLA 1ACYH 2I1KA 2WDTB 2BOLA 5MHSD 4U1MA 4Q4IA 3STZB 1BLIA 4XCFL 2VXUL 3BO8B 3NP3A 5F7DB 3IXEA 2UY7B 3NRPA 4PGDA 3SE8L 3VFMA 2VERN 4B27A 5C97A 1ET9A 4PLJD 4EECA 1QD0A 3CX2A 3LB8C 4BTBA 2BOBB 1BQRA 2XG4A 1ZV2A 1T21A 3MLXL 3VWKA 4WWID 2FIDA 2EACA 5HVGB 2CDEA 2AI0H 4AQ8C 3QG6A 4DDID 4LSUL 4C4BA 3RRNB 3KL0A 1PGAA 1CT8A 4Z7IA 4G0NB 2AKRA 2JTDA 1CFSA 3TTYA 4QNPE 3N42B 1TQCC 3RURA 1DVTA 1NWOA 4MYPA 3L10B 3VU2A 2Z8LA 2WWOA 3V5KA 4WI8A 3HB3C 2F54E 1BFSA 3HG1A 4Q7DA 2CBQA 4M61A 4OLWH 3LYYA 1RZ4A 1IKOP 3EXLA 2WHIA 4GP5B 1R75A 5ACMA 4P2QE 2KJ6A 4AM9A 3EF7A 4MM3A 1KNOA 3HS8A 4JUTA 3TXAA 5C0DB 5E8DL 2NZIA 2B9AA 4O51A 3IJEA 1M53A 5JW4Q 3HRZB 3RX9A 1ZLUK 1CDHA 4Q4EA 3TC9A 4X5QA 3G6JB 3ZIYA 2Y2WA 1KCRH 1OP9A 1PY9A 1VRAB 4KKLC 1IM3D 2J71A 3NIGE 3X17A 5LJYH 1KBWA 1X5HA 2JVCA 2WQVA 1VEPA 4N1EA 3OKDA 4UQYA 2EVGA 1TEYA 2GBUA 2NY5C 3MP9A 1YYMH 5MEQA 3UJIH 1R19A 2B9BA 2ENYA 2B1AL 1GC1L 1ETJA 2N4IA 2IANE 2OCJA 4QXWA 4PCYA 5J1SC 5EE1A 2PKDA 2OM5A 1KELH 3AXLB 3IGUA 2CPCA 1ADWA 3HC4H 5BZWA 2NUPA 5CP7B 2WUCH 1E4WL 1LD8A 3F7KA 2FB4L 4KPHH 3MBWA 4NKMA 4QXTB 4TULH 5CP3H 4HP5A 3G7TA 1DYQA 1MH5A 1XLQA 1CDYA 2LGYA 5FA4A 3CE1A 4MBRA 3DVGA 2WNWA 2Y5BB 4P23C 2EEDA 3J9CA 3QEQE 1BEYH 2HLFD 1AYOA 1JZDC 2WDVB 2CGRL 2AQQA 1EXHA 4AGMA 5LOZA 1U95B 1A1OA 1QWNA 4BUHA 2LO6A 2NY0B 3PGDA 5EUKB 4KTEL 4XO4A 3DI3B 3DV6B 4Y9GA 1CC3A 3F83A 4LCUA 3S3JA 2AQSA 3MX0B 5ANMA 3RX8A 2V3DA 2NTSP 3DJSA 1QPXA 1INDL 1ES0B 1OAYH 2C1OA 3CFKA 3WKQA 3MHSD 3VUYA 4D0DB 1JD9A 2HRHA 1CR9H 2VRAA 4KIKB 2EADA 2XLLA 1HQ4A 4LNUD 2X3BA 2KBXA 5D7JA 3TWVA 1ZB1A 1DVPA 2VDPH 3EFOA 3WEXA 4EKXA 1YEKL 1OB1B 4BK8A 5J8OA 4K7FA 3LPFA 4XKCA 3LEXA 4FQLH 1PTZA 3FFCE 5D1XD 4LNKA 3UAFA 3W1YA 1WWWX 2BSRA 3JV4A 4G6AC 3FUEA 1DCEA 3PHAA 4Y7MA 4AKPA 4NC0B 5G55A 4EOWL 1E5AA 3RU8L 3JUYA 3SCMB 3SYOA 5CR1A 3ZGQA 3ML8A 3B9KC 4GTMA 3BVXA 3H8NA 3TO4C 1SF0A 2C5DC 1D9KC 3VGFA 3N1YC 2PQNA 1MFEH 1U4FA 2KMWA 4MX7A 2SAKA 4OLZH 4NNYB 1Y18B 3QUXC 3T1FB 4NCC2 3ZMNA 1D5ZC 4HJ0C 1FSKB 2D0GA 2G4EA 2VDLL 1MIMH 1TCRB 3MLSL 4UV7L 4GMVA 5I5IA 4U7KA 1CGUA 4TRPL 4GGQA 1NL4A 5FX3A 4QHUA 5AYUL 3U7YH 4JB9L 3KWWA 1TNOA 2L7EA 1WZKA 1C16B 3QS3A 4L1TA 2EILB 2OMWB 3I6KB 4LPCA 4Y4HD 2EDKA 5LCVA 3K9IA 1OGTB 2KZWA 1QLEL 2ED8A 4LLYA 1KXVA 4LCWA 3US9A 3N1FC 5HI5D 4AM0Q 2H3NB 5E1HB 2HM8A 1P6WA 3WHXB 4RMVA 1QZEA 1WE5A 3GMNB 2LGNA 1WQVT 3OKKA 3TFKD 4HU8A 4NIYE 3CQPA 3T0EE 2X6VA 3BK2A 5HHQB 2AC0A 1OQYA 2APWA 4K9EL 3OZLA 1R33A 4CMMB 1NKOA 4PP1C 4JG1H 2R0WH 3EBHA 4IJ3B 3OXSB 3UTTA 1GGCH 1NCJA 4O6FA 1E40A 3OG6B 4BWUA 5EZJB 1XR8B 2PLTA 5BUAA 2EMTA 3A33B 5B3SE 3DHIC 4UI9C 4POUB 2F7PA 1CGVA 1ITBB 4G6MH 5HHNA 4K3EL 1WEJH 4Q9CA 1E6JL 1P2CA 3JUZA 4MT5A 1TVBB 2B5IB 1T66C 1JZIA 1KLUB 5JHDE 2IMNA 2B7DT 1FSKC 4NNXB 4DKTA 3MKRA 2P45B 5ADOL 5I1HH 1UZXB 1F6LL 4N9F4 5FK9C 3RVUC 1JHKH 3RRQA 1J8HB 4JM0A 3DC0A 1AGBA 1M71A 1OQOA 1A6UH 2O5YH 3T0ED 1RUKL 2HVBA 3BN9C 3L3KB 3MODH 4LNVA 3RVWC 2AJ3A 2N1TE 4PJCB 4Y2DD 1YAIA 3TIEB 4Q97A 1S9VA 1GZHC 4RMRA 2QC9A 3QWQB 4X6CB 3FO0L 3QNZA 3L95A 3GQFA 1F4AA 1GW0A 4YSQA 2K25A 4WNSA 3PZ3A 1U8LB 2P49B 4FXKB 1JGIA 4M1GH 2PEAA 2O6FA 5E7FA 5LQBL 1M05B 1I9JH 3AVEA 2Z7YA 5BXOA 3BUTA 4PGBB 4C4KT 5ICXB 1A70A 4IHBA 3SHQA 1LDPH 5LAPA 4M3KB 3ESOA 1GYVA 5AVZB 3ZHNA 4P9MH 1XD3B 5T1KD 1DOIA 2E0IA 2I2YA 3BUIA 4XZUA 1ILSA 1VCAA 4PRPE 1Q1JH 1PKQE 3QBTB 3V0AC 4LE8A 4WI7A 3MO1A 3DBHI 4IIZA 3H7PA 4YLQT 4Y1AB 3W82A 1RZKL 4HIJA 4QD2E 4OVZA 2HJLB 1IM3A 1DDHB 3MNZA 1OSZA 3BN3B 3GZOA 3DSSA 1DVZA 4PJ8A 4IW0A 1J0GA 1HILB 3QJTB 2PP9A 5IMKB 3PAUA 1SPDA 5A6CA 3U6XS 3BAEL 4ANWA 5E9DB 4NZDA 2Y06L 1IE4A 4BH8B 3H6JA 1K9TA 3D0VB 3KW8A 4PWKA 2WM0A 4YO0A 5EO1A 1N60A 1ZLWK 1UWXH 3NDZE 2YWYA 4P2RE 3SBQA 4M7ZB 2W9EL 1SXCA 4IRJD 1MG2C 3UC0L 5TE4H 3WDIA 3V2OA 4H1LG 4D0BA 2F54A 5KS9F 3EDDA 2GIYA 5HPMA 4AYMC 5BS0E 1U2HA 2GIMA 3R3MA 2ID5A 1G0YR 3BP6B 2R1XA 4FHBD 3A9JB 3PV7A 2V5SA 1EF5A 3FU5A 4LMQI 3ARZA 2F8OA 4A55A 5PAZA 3W1SA 1YMHE 1MQSA 5IBLC 2NY4C 4KAQL 3OF6D 3V8CA 5FIOA 3GWJA 1DSWA 2OL3H 3QUMA 5FYJD 3VXQA 1TKWA 3IYLW 2BF8B 4U6YA 5DJ0A 4R8WL 1NTDA 3QUZD 1EZLA 3TIDB 2KCLA 2L4OA 4W70A 1KG0B 2GRLA 4J8DA 3RYMA 4CN4A 1U3ZA 2ENPA 3GIVA 4F8TA 4KI5D 2I38A 2PUQT 4JHWL 4ZDHB 3KLHD 4HUVB 4O60A 4P1BC 4F7AA 1GHFH 1KV7A 3UP1A 1AHKA 3K2IA 4F1PA 2R29H 1N59A 2VDOB 3CXFA 3ZLQC 1U8MB 4ODBD 4ZRPA 4MAUL 1YEIL 1I7ZA 3GSWB 1N8ZA 2WINB 1WM2A 1YN5A 5CHEE 2OXGB 1N26A 2XKNB 4HK2A 4WUKL 2IPKA 2V3EA 1NIBA 2R2HA 3B43A 3IJ7A 3FT0A 4FTVE 4HWNA 4UQ9A 1P7QD 4D7BA 1FFVA 3KVQA 4V2CB 2DLFH 2Q7YA 4Q9BA 4RMQA 4X5LA 5BS0D 1B4RA 2KDFB 3Q1SL 3EFFA 1CDJA 2J07A 4HLEA 4OJDH 5HDQH 4DESA 2MWSB 2VDML 5LNGA 3WCQA 3P54A 2K7PA 3SDXB 3CCHB 3QEQA 4DT2A 4L1DA 4PEEA 2DQFB 3GEFA 1QBBA 5FV1L 1L9RA 1QFWH 1WICA 2JB6B 2VM9A 3HC3H 5I16A 4UQ2A 3C60D 2KVZA 3SR6A 5A2KH 2AZUA 2YD2A 4NQVA 4RZCB 1F13A 4GB9A 4QRBA 2WWMC 4R9HA 4ETQA 4R4FL 3MI6A 3ZGHA 2BCKA 2CO2A 2XTLA 4NZJA 1K5WA 3QNYA 4J12A 1R24B 3ARED 4GRMB 4FXCA 1CTNA 2YGPA 2HXAA 3EO9H 1T83A 4PLOB 3QAQA 2BVOB 2AEPL 5TGBB 4FQ2H 5I19L 3VVWA 1FE8H 1UWFA 5EG6C 5HYSG 1XMEB 4KJQC 2CU1A 2D7TH 4YHML 2UZXB 5KS9E 1HOCA 4N85A 5FGSA 4YWGG 4R7NB 3H6AA 4PRBB 5DQ9A 2XRAL 1FIQA 3FFCA 4Y4HA 2BNQB 4FC8A 2VKXA 1B6DA 5DZJA 3RWJA 1B9KA 1MW0A 2ZX8A 2XA8L 2F5AL 3NZHL 4G1EA 4J3OD 4XHJC 5AW6B 4XEIG 4K5OA 3VX1A 1LO3L 4NC1C 4YSCA 4ZFGH 3TM6A 5I4DA 1EEZA 1C5CH 3OKOA 3LN4B 4RGMA 1CLZH 3IN0A 1OM3H 5HP5A 4XRCA 3MRGB 1KBVA 5I71C 1U6AH 1ZVSB 1T4WA 3FRPA 4LLUA 3ULUC 1JVLA 1OAZH 4X8GA 4BQBA 5AVTB 1TPXC 5E00A 2YC1A 1JZ4A 3OAWA 5IHLB 1JPFA 1LE5A 1IM9D 3V52L 4OF6A 1HI6B 4OZ4A 4LLQA 1TS4A 5AZGA 4XXCC 15C8L 3RGVA 5HSFA 5CINH 4HJJH 2M1MA 3V6EB 1KJ3L 4FABL 4XPGL 2D0FA 4NNJB 3U2JA 2XXFA 4MGKE 2PYFA 1GR7A 5ID0A 4C4VA 2QEJA 4HKXA 3HAEA 1TTCA 3S36H 2J4WH 1U8OB 5A16A 2XK5B 1KJ2H 1AR1B 4M4RA 1EF1C 1U41A 4HETA 5IB3A 1CI3M 1LK2A 3IE9A 3KVPA 1C4CA 3M63B 3L82A 3TVMC 3O3EA 2AWTA 4NLHA 3IHVA 5KVFL 3K6NA 1YCSB 3RKPA 3LEVL 3WFDL 2CD0A 2W92A 43CAB 2WP9B 3QUKB 5F0LB 2JF5A 5C08D 2DMCA 3CFJA 4U05A 4KSLC 5B4MD 4GTTA 1AWDA 3SD5A 1HTOA 2N9XA 3UERA 3JYCA 2MQ0A 4WENB 5T3ZL 1MFWA 3T0EA 4F15B 5F9JA 2NBWB 3F5WA 4K94H 2CO7A 4Y2DA 4N22A 2WGXA 3ROOA 1IAOA 3S37X 2EDNA 3VD5A 3EJUA 4N0YL 3L3OA 2MJ3A 1OV8A 1ZA6B 3QWOB 4HLZH 2GBRA 3V62A 3NFSH 4D9LH 1NDMA 3V60A 2QMKA 3MNDA 1KPRB 3NIDF 3KBHE 2FUTA 4G6KL 2P8PB 4DGWC 4LHUG 1IBYA 5K9KA 1XR9A 1RD6A 3DKHA 5JHDA 4DX2A 4G9DA 5J1AA 1NUFA 4QFVA 3CMGA 3EGXA 1T1YA 5H2BA 4NAMA 3FC4A 2AK1L 4FG0A 5B1AB 5LCVL 4AY5A 1B3JA 2YK1H 1MYOA 4JFEE 5JOEA 1B2WL 4Y9FA 5T1KA 2ZU6B 1ITCA 1H0DB 2CLZA 4EI6A 1SSNA 3FHAA 5DK2A 4G8EB 1NMAH 1B0GA 4RM8A 2IDYA 3ZGZA 1OHQA 2VWEE 3QR2A 1G6JA 3QFJE 2QL1A 3PGCA 4ZFQA 3RVTC 5I1AA 2MKLC 3RY4A 4PRIB 3U0WL 4AYBA 1BFOB 5FM4A 4FERA 2N1VA 4AQ1C 3KWTA 2APVA 1TTGA 3EFDH 5C0GB 3B7YA 3TJEH 3N40F 3BDBA 1WC7B 4LP4A 4N9GB 1RCYA 5KVDE 1H8OA 4MD0A 3ZXRA 1R7SA 4FXLA 3C3QA 5AW9B 4Y19B 4I85A 3QOUA 3APCA 1MXDA 1L6ZA 4F15C 4LCCC 1XGUB 4G8LA 1CD9B 3C2SA 3JYUA 1OLZA 2A0LC 2AP2A 1SJEB 4IRJA 2Z92B 2BB6A 1HX0A 3KBPA 3Q6GL 1PL3A 1A4KA 4UQIM 3AG4B 4I3SH 2OW6A 4QAYA 1SE4A 1GB4A 2H6IA 4JFED 4Y5YC 1ISNA 4ZT1A 4B0MA 4G82A 1B89A 2D03H 3TA4D 1BMWA 4XOAA 2GT9B 4Z8FL 3OF6A 1DVUA 2VUYA 5CLWA 4OZIF 1D5RA 4L3CB 3W2DH 2NNFA 3QCVL 4KSKC 3LY8A 1SUJA 5HYFA 3O4LB 1K1AA 3VXSE 3QUZA 2EUXA 1FCHA 3FY4A 5IQNA 4UQBA 3FQWA 4C4UA 2FUHB 5IEHA 1NGYA 1USQA 1V3LA 3S35X 4BSXA 3QQ4B 2EEBA 4R2GD 2ZJSH 3UXGA 3NIDE 3DO7A 3ATAA 3SQBB 2FCMA 3KPOA 4GBXD 5BOZG 2ZPKL 1OSPH 1R4MB 3AGWA 1T5WA 3CVHA 3KEDA 5E5MB 5AW4B 3BKCH 4P2RA 4XNYH 4HHGA 3WFEH 3ZRHA 3R7RA 5KJMA 2HT2D 1RURL 4LJOB 2VXSH 2LU3A 1P7QA 2Z8WC 4X6FA 5E6IA 5BS0A 5JMOC 2GBKA 3LB6D 1KT0A 4XMLL 3V55A 4QQIA 1FFPB 2AJSL 4F9PA 1ZIBA 4WNEA 2VDNL 4HA1A 3S7FA 1GC1C 3PHOA 2XV6B 4DTGH 4OLYL 2RB8A 2W88A 2ZOTA 1YMHA 4OGYL 4DK3A 5CCKH 1C77A 1SN5A 4BK4A 1MFVA 3JT0A 3KYOB 1IZJA 1P84K 3FO2B 1WH0A 3ASGA 3VXSD 2XEWA 3GBEA 3LDBC 3PV6B 5GGRA 2VDLB 5DWUH 1YAZA 3ZUVB 3HC0B 3M8OL 1U8IA 2PTUA 5CLZA 4CYEA 1WGVA 4WWNA 1LXMA 1V81A 3AREA 1YMMD 2VQ1B 4JLCA 3LRKA 4AQAB 2O6DA 3NTCH 1J05A 2ICWJ 3GK8H 2MHKA 3GMOA 3KYNA 1ET6A 3EU5A 5EOCL 3Q3NC 4Z95L 4G43A 4PV9B 5FECB 2IXQB 3UH8A 3H4HA 5D8JL 2IBZY 1GY1A 1QLEB 3MNVA 1HWWA 5I1JL 4UU9A 3KCPA 4FTVA 1F86A 2JWYA 1EVTC 4LZKA 3SKJH 2F1BA 3T08A 5CSZB 2W07A 2N3JA 3BINA 2DYPB 3S2CA 4FI8A 3DMMD 3RWDB 1AHMA 4OZFG 4WEBH 4OZIE 3SBTB 1MCQA 3RHWF 4YDEA 4JHUA 1UZ8A 3OG5A 3TBVB 3ZKSD 4ZHBA 3FEXA 3WAPA 1O9VA 2BRQA 5KJ4A 5AG9A 5IKCM 2AV7B 3BG1B 4RRPA 1WRFA 4QRRB 1Q5WB 1ZE3C 4FZEH 2WB7A 3ARYA 5D2NC 2B0SL 2ITDB 1JROA 4PJHB 2C9AA 4FQXD 2DZNA 1Y8RC 3R0MA 2KJHB 3FUHA 3V5DB 1TOXA 5BYQA 3ARBA 3TNNA 2Q5WD 2Y23A 4F2EA 2VXVL 4XPFH 5ECJE 3EHBB 4O5LL 2FHCA 1P7FA 2MOWA 5D7LB 3NY5A 5INCA 2KT6A 2VMJA 3EH3B 4D2NA 2FCBA 1N5AB 1R3HA 3WIHA 4P7IA 5J9PA 2XQ0A 2A9NL 2CMRL 4CYMD 2RAMA 3MFFA 3Q44A 2H9GA 5FDYA 5AKSA 1HXIA 1CUOA 2Z1KA 2X6HA 4L8BB 4NUQA 5C08A 2MH7A 4P57B 1TQVA 1IGIL 5GHWL 4WY7L 4DIXA 4YSDA 3OKLB 5MENE 2UZIL 2F19H 5FKAB 4FFWC 1FFOB 3HUJA 4HRNA 5EFIA 5F9OH 4F8CB 4ONHB 3TF7C 3L5WB 3FQTB 4JFXA 1I4PA 5AUIA 2BKFA 3BZFB 4RAVA 3AMZA 1TZHB 3CFDB 3E80A 3GSVB 4CO7A 1VGKA 4NN6B 1A3RH 3HE6D 3EYQC 4TQEL 3OXGA 2J56A 2WCSA 2CSPA 2AJYH 2MNJB 4EIGB 4JFZH 5GS0H 1QR1A 1UUNA 3P0YH 2P9SG 4GTVA 1OTTC 3UROR 4PI0A 4CVXA 4OAVB 1TN8A 3IU4H 2AABH 1P7KB 3VXUD 2B39A 2NY7L 5B8CC 2AJAA 2I2OA 3DJRA 3BAXA 3RULA 3O6FB 2WXOA 1CDGA 1CGWA 5I1CL 3WSQL 4OJYA 3CZGA 2KL6A 4HOTA 5J6HB 3VI3F 5HYJE 2NZ9D 1X44A 2J49A 4DO4A 3CZSA 5KSBF 3QR0A 1DQLH 3D4GA 1H3PL 2AJXH 4WU5B 2YR3A 4BFIB 4H1LH 1WXVA 2BKRB 4G8GD 1E2ZA 3VGDA 1ZV9A 4PUCA 4RDQF 4BFEA 5GIRA 4MMZC 1HZ6A 2H0JA 2O5NA 3R06A 5KYUB 2ADGA 3MGOB 4MCNA 4U0RC 3CMOH 2GSGA 3RWGB 1D3CA 2WUBL 1UBIA 3PQYB 1ORSA 3BOVA 2XZQL 5ERWA 1MX6A 1E8WA 4Q9RL 1MVYA 1ZVNA 3CAFA 1CCZA 5ESAA 1XDTT 3RIAF 2EDXA 3K5SA 4OD1L 3ZN6A 5L88H 4KTDL 3H7SA 4K3GA 3RVVD 2XQYK 3BWUD 1YYLL 1N5WA 2WP3O 2YAHA 3CDZA 2O5ZH 4N5QA 3LNDA 4YL4A 3EO1A 5IQLA 1NBYB 2FGWH 3G5YB 4ODWA 3FUJA 1DHKA 2X53A 1SXBA 1ZLVK 5HYJD 1YN3A 4ODXA 1KIQB 4PH4B 3HKFA 1E9PB 5FW6A 3DWLG 2XX1A 3I6GA 1O7DE 4MNQD 3UBXA 3VXMB 4AMWA 4ZTPH 4HWUA 4JFEA 3U0TA 3PWLB 1CVSC 5IGXL 4JNXA 3VRAB 4K5AB 2ZX9A 1FYTE 2Z35A 4U1MB 3NCXA 3FOMA 3MV7D 4XX1G 1Q4NX 2DIJA 3P69A 4AEHH 4NXSA 4XGZB 4PGDB 3VFMB 3ZTCA 4N2NA 3WTSA 5AVSB 3QDNA 3AG1E 2BFGA 3RVXC 3NHEB 5DSCA 4WJPA 2XG4B 3HM3A 2AYOB 3VWKB 1VRSA 4Z7WA 3ASOE 4BRVA 2VN6A 2KQ7A 2BPBA 2CDEB 3GFUA 4IBWA 3QG6B 3RL2A 3NAAL 1OTSC 4L2YA 4WTQA 1CT8B 1I3VA 1NMBL 2ZICA 3ECBA 3VI3E 2R56H 4HZLA 4L1LA 1M94A 3TLRA 1RU9L 1IV8A 2BZDA 2HKHH 3V5KB 5KSBE 1JYNA 4K3CA 3HG1B 4MJID 1CK0H 1JUFA 4M61B 2VDMB 3RFZC 1FHGA 4EXKA 3Q2AC 5IHWA 3C75A 4YWGH 3UEQA 4PRHD 4JFHD 5C0RL 4MM3B 1KNOB 1FYTD 3GEWB 2WU5B 4LAQH 4O51B 3IJEB 4M7JL 4G7VL 5JA8B 5D96B 1U58A 3ZKND 4Z7VA 3L45A 2AVPA 1TQWA 2C9PA 3QIBA 3VXSA 4AGLA 4N8CL 3GOEA 4E6HA 3ESKA 4OJFL 4KX7A 4HGKC 4R4BA 3HVEA 4IQHA 4TXVB 3LXBA 4DFIA 3U52E 1YMMA 3OKDB 5IROC 1FLRH 2IO3C 5MEQB 1RUML 3L9RA 1CLCA 2H41A 5J13B 3Q2VA 3GKWL 2Q76A 1QKZL 4XZ4A 5BZWB 3FILA 2G3QB 2NUPB 4E9WA 2KC7A 4M02A 1T20A 3FQ2A 5SWZE 3MBWB 2CRZA 4NKMB 5CJ5A 1P5UC 2A6IB 3MRPA 5I23A 1MH5B 1SIFA 1RM6C 2BYVE 4CDMA 5FA4B 1FDLL 1RVFH 3HNSL 3S5ZA 3DVGB 1UVQA 1CTOA 4XP6L 2EO7A 4FFZA 5DJXA 3V0VA 5BCAA 5HPOA 1WXMA 4M56A 2NYZA 3WELA 2AXHA 1MFAL 3BPNB 1H5BA 4L2LA 1TYQG 4G9FE 1A1OB 3BW9A 2DYSB 1WZAA 3A67H 4ZMVA 5D2MC 4G8KA 5F8RC 1S63A 4LCUB 4FQXA 2EEAA 5ANMB 4MB4A 4M6OH 2ZD0A 2R4RH 1EO8L 3CFKB 2C1OB 3FKYA 1KJVA 3DX0A 4JVUA 5HG2A 5EIBE 2UX6A 3KH4A 3UC2A 4JO1L 5AL8A 3PRMB 3LIZL 3WEXB 1FZMA 1BD2D 1PAZA 4PJ9C 3QWZB 1TSHA 2E47A 3CVHL 1E4XL 2EKEC 3E6FA 4MA1C 2QT6A 2BSRB 1ACXA 1DJHA 3JV4B 1D3ZA 3MCKA 1NDDA 3D8MA 1WMHA 3AMLA 1X5IA 4UF7C 2BYTA 2AHIA 3T2NL 4PG9A 3VWJD 3I3DA 3QDGE 3EYVB 4OZIA 5FYLD 3AECB 1V27A 3MJGX 2BHUA 2I07A 2JH2A 4WV1C 4UOW0 5J13C 3NCMA 5IJKC 4XWOC 3D3VD 2IG2L 1PZUB 1UM6H 3OSKA 4MX7B 3DVIA 3TWCL 1WGHA 2HB0A 3MLWL 2PCXA 3FT3A 3HE6A 5TK2A 5EIIA 2ZNVB 1HO8A 3VH3B 4HS6A 2N7DA 5FFGA 1JZHA 2N9PC 2J0JA 3FU7A