2WXIA

The crystal structure of the murine class ia pi 3-kinase p110delta in complex with sw30.
Total Genus 276
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
276
sequence length
919
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVDCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The P110D Structure: Mechanisms for Selectivity and Potency of New Pi(3)K Inhibitors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
total genus 276
structure length 815
sequence length 919
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2009-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 2wxiA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wxiA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2wxiA03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wxiA02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 2wxiA04
4EZJA 4L1BA 1E90A 4OYSA 4PH4B 4EZKA 3NSJA 5H4ZA 2CHDA 1WFMA 4V11A 4UWGA 4LT7A 4UWLA 4DNLA 5G55A 4EZLA 3FDWA 4NPKA 3R7QA 3PRZA 1E8XA 4UWFA 2DMGA 2X6FA 4ANUA 2WXRA 3PREA 4QAMB 2I9CA 2X6KA 4KZCA 4PS7A 4PS3A 2BWQA 4GB9A 4FJYA 2DMHA 2WXPA 4URKA 1GMIA 3SD5A 2RD0A 4UWHA 1QATA 4AOFA 3FBKA 4WEEA 4PS8A 1E8YA 3KWUA 4BGDA 4KITB 4ANWA 4JPSA 2Q0ZX 2EP6A 5CCHE 3TJPA 5H4YA 2ENQA 2X6HA 3T8MA 2WXLA 4WWPA 1UOVA 1E7UA 1RSYA 2CM6A 4NPJA 4ANXA 3QAQA 2X6JA 2KI6A 3QJZA 3TL5A 5CCGE 1E7VA 2V4LA 4F92B 4LDCA 1DQVA 1YRKA 2FK9A 2K8MA 2WXHA 4FJZA 1V27A 3QK0A 3P2BA 2CHZA 3DBSA 4QJ4B 4FULA 4OVVA 2X38A 2A5UA 4L1LA 3MJWA 1DJWA 2WXGA 4FHJA 2WXMA 2Y3AA 1WFJA 2CJTA 1DJIA 3APFA 3IBEA 4FLHA 4XX5A 2Z0UA 4HVBA 4DK5A 3B7YA 4F1SA 3JZYA 2NQ3A 3N5AA 4MJJA 4L2YA 5EDSA 1W16A 4QJ3B 4WWOA 2CHXA 1QASA 2WXQA 3APCA 1E8ZA 1RH8A 1UOWA 4FHKA 1TJXA 5G2NA 1K5WA 3L16A 3NZSA 4G11A 2K4AA 2YRBA 2A4ZA 3IHYA 1CJAA 1DJGA 2QZ5A 3HN8A 3L17A 3F00A 3QR1A 4OVUA 4Y1TA 2ZKMX 1TJMA 3RPBA 3W56A 2Q3XA 2QZQA 3F05A 2FJUB 4FA6A 1E8WA 3TWYA 4BFRA 4F93B 4J6IA 3HHMA 3ZIMA 2K3HA 4UWKA 3RDJA 2CJSA 4KZ0A 2WXFA 4FADA 1RLWA 4XE0A 4QJ5B 2WXJA 4HLEA 4WWNA 5CCJA 3ML9A 3OHMB 3ML8A 2R83A 3IM1A 4XZ4A 2WXIA 4GNKB 1DJXA 3F04A 3APDA 2YOAA 2CM5A 1DJYA 2ENPA 2K45A 2CHWA 1UGKA 4NS0A 1W15A 2B3RA 4TV3A 4TUUA 3R7RA 4NP9A 1BYNA 3PS6A 3ZW3A 3L08A 4ICXA 5ANLA 3HIZA 3M7FB 4LCVA 4ANVA 3QARA 2N1TE 5JHAA 2ENJA 3PFQA 4AJWA 5KJ7E 4F91B 4WAFA 3KWTA 3LJ3A 3L4CA 2D8KA 5ENNA 2ISDA 2WXNA 4L23A 3ENEA 2NCEA 2LHAA 3DPDA 1A25A 4A55A 3L9BA 3QR0A 3F01A 1DJZA 1BDYA 3LS8A 3CSFA 2WXKA 4IQHA 3W57A 4ICWA 3S2AA 2X6IA 3L13A 2JQZA 4Y1SA 3OAWA 5JHBA 3NZUA 1HE8A 3ZVVA 3L54A 3CSTA 1DSYA 1BCIA 1DJHA 2UZPA 3GPEA 2NSQA 3PYCA 4TS6A 5T8IA 1CJYA 2WXOA 4IHBA
chains in the Genus database with same CATH superfamily
5DIZA 2DM2A 3L2MA 4D2NA 1OGAD 1JVOA 4HDQA 5SWQA 3ZKJA 4M7ZC 1CYXA 5HS0A 3C5ZA 3QB2A 2QKIA 3UADA 4YGAB 4K81A 5KJ4A 1QLFB 4BK8A 4PLNC 3D9JA 2BYFA 5D2LB 1KEMH 4I6JA 4PS8A 2E75C 2NY1B 3BPCB 3AE8B 2NBUA 3Q8EA 4IKIA 3ZYMA 4KRLB 2VGXA 1MJ7L 25C8L 3IMSA 3FFCA 5GHWH 4BSWB 1FD6A 1GJZA 2I2YA 4U2ZA 4R26L 1IM9D 1TKWB 3FB5A 4ODVL 1KT1A 3GBMH 3KPNB 4Y19D 3KWLA 4J4PA 3CQPA 3EGDB 1JHKH 1Q94A 1TJIH 3NEOA 2JCCA 2XYBA 3P2TA 2Z8SA 1PFOA 4NQUA 4U33A 4NWUH 2RBLA 4GT7A 3HNVL 5E9NA 4N3UA 2CJUL 4GMSL 2ZUXA 4FQIL 2Y4UA 3SPVA 5J5EA 1T0QC 1CN4A 2WB1A 3A33B 4OI8A 5EORH 4MZ2A 3UJIL 1A3RH 2RTTA 4KKAC 3CFJB 2WTRB 4YHOH 5KVGE 1W80A 3RNFC 1GC1C 4Z0XB 3H7SA 4HEMA 1Q0XL 5TF1L 2KQSA 3EA6A 3UQBA 4W4NA 1FPPA 1CF8H 2QHRL 4G8FB 5GJTL 3I3TB 5CMAA 3MTXA 3VDZA 5F9WC 1U8KA 2C4XA 3HN8A 2GKIA 1DFBH 2DLHA 1K4DB 4FA6A 4YHIB 4RGTA 2A6IA 2ICEB 1QSFB 4OZ4B 3PXHA 3RVWD 3WIAA 2Q7NA 4QT5A 2DJ4A 4XCCH 3F2LA 5DUPH 2XN0A 2NY5C 2VL4A 3FCGA 5I5JA 4UI9K 5DUPL 3K1DA 1RM6C 3AAAC 1PZSA 4M93C 1Q94B 4CC4A 2X2UA 3RU0A 2CKHB 2I5YL 3GSOA 3MRQB 3PQYB 1UM6L 1M1SA 1MH5A 1ZA6B 2HKFH 3U36B 5MHSD 4NZ8A 1GW6A 2OULB 5CS7A 1JDDA 2LSUA 4CEMA 3ZLQC 5FOBB 1IEAA 4KTEL 4XDCA 3IB4A 4N8VA 3Q2AC 1CLYH 2G2RB 3ZE0F 1TS3A 1TT5B 1B0RB 5I82A 3T8VA 3LYAA 4Q6IA 1R6VA 2BMKB 1DVXA 5D1ZI 1TVBA 5E6RB 1O7DE 4F3FA 3FILA 5I73B 4AVHA 2Y7OA 3MA5A 5HDQL 3ALBA 1I8LC 2B14A 4MH0E 5SWQB 1S9XA 2IBZY 4P16A 1LL1A 4PJCF 3EH2A 2PCFA 3E8VA 4HCRH 1MHCA 2BVTA 4XP9L 3PHOA 2CQVA 1VJSA 1HDMA 5BQDA 2H9GA 3QUML 3N1QC 2XWBB 4KZDH 5LGHH 2WUCH 1NIAA 1TJFA 2ZOKB 3RGVA 5J08A 5IUCA 3DO7A 5J0BA 4KU1A 2MNUA 3HKZA 2YAMA 1JV2B 3TN0A 5E0FA 1KOTA 3O2VL 1WA0X 1OFFA 1DN0A 4EUPG 2BP0B 4D9QE 3MKGA 4GSDL 2D03L 3P9LA 4TXPA 4WUUB 3I9AA 4R7XA 2IPUG 1OIOA 1NFKA 2ADFH 3GZNI 3ZR5A 2X6FA 4ANUA 2J57A 1V7MH 2OJZH 5B39A 4WHYG 2MOQA 3KYAA 4L29A 1I9IL 1Z5SC 5DLMH 4FBJB 3WA0A 1OQYA 5CHNA 2K0RA 4ZRKA 5F3HB 5B1AB 4IBLT 1E7UA 3RTQD 2VJ8A 2EILB 1MPAL 2V4LA 2XZDG 4IM3A 1SDDA 1J8HA 1M6OA 4F53A 3M1OA 1DBJH 4PY7A 2YBRB 1PFCA 1SOSA 2EDYA 2ZOTA 3K91A 3SGJC 4S17A 4K3CA 1OB1A 3BG1B 3RZCB 3CFBA 4EBQL 2EH7H 3SOTA 2PO6B 5FO9B 3DBHB 4OV5A 1AGDA 4KBPA 4NN5C 3AG1B 5IQ7H 1C12B 3NZHH 1K72A 3U9WA 1PY4A 2QDWA 5EF3A 4HMEA 3MFFB 4RISL 5DMYA 3HPJA 5DK2A 3FH5A 2BO0A 3G9AB 5CWSB 4WI0B 3APCA 2EIJB 4P4RA 4Y4FC 1KBGL 1PVHA 5D7LA 1PZUB 4NWTL 4L9LA 1Q0XH 3I9GL 1OCZE 4FXCA 1NJ9B 2BXZA 5DJCB 3U9UB 5EEWA 1LILA 3DOSB 4LCCC 4MJ6A 3NQIA 4PBDA 2Q3XA 5IP4D 2VW6A 4LVOB 3KPTA 4KI5F 5FW6A 1IO4C 5KS9B 2A9AA 3K2KA 4GP5B 3Q75A 4XX1E 3TO2A 2EQDA 3R0MA 4JK0D 4AQ8A 1MCJA 2GHZA 3IN2A 4PUBH 1QW9A 5CCJA 4EEEA 1KCKA 2GJ6B 1BEYL 2YSSB 2KATA 1KV7A 1YEHH 4WFHD 3RDTD 4YOKA 3QS3A 3D7PA 2FAZA 3HBQA 2VXTH 2JWUA 2NUTB 2WGNB 5DHVB 4CMHC 3CN4A 5BO1H 3MEKA 4TVPE 3VA6A 1FORL 1Y6NR 3CZSA 2DMKA 3WAJA 2A77L 1OCOB 1A5EA 3AUVA 3LIZL 4MMYB 4KY1L 5LCVL 1R46A 4FQJH 3VFGL 3X2QE 1TZ1A 4ZMTA 4X8QA 4JQIA 2OYKA 5KVGL 4NBXB 3IDIB 5SWZE 3GSUB 3ESNA 4NI3A 4NUGH 5FAAA 2RCSL 43C9A 2OJWA 3MRGA 4XXWC 4Z76B 1FGVH 2WYZA 4RLYA 3K5SA 2X4OB 2H26A 2J9QA 5INCB 3DBXA 1DJZA 1P5VA 3WNJA 2WQVA 1Y0LA 2P43B 3FO2A 4JDTL 2Y22A 3OHXB 4IU3B 2DEYX 3C9NB 3CHQA 4FS0A 2YD1A 2Y6SC 3DUSB 1I7UB 2D7MA 3NCBB 2QCZA 5EIBE 1R34A 1JVLA 1JXKA 2EQXA 3MRFB 3AMKA 3UPVA 2GY5A 3GJFK 1FRDA 3H9SA 3P9LB 2E6QA 1SQMA 2P5EB 2AJUL 4EZLA 3WXVH 3ZTDA 2R69A 3S8GB 2W95A 3JSSA 5L7XH 5ESQB 5MENA 5IJKA 4WTZG 5HJGA 5D70H 1M1XB 1ZT4A 1CIUA 3PWPA 1F41A 1FCGA 1FFOA 4R4FH 1CDYA 1Q72L 2M2DA 3SKOB 2WO4A 4WWPA 1YZZA 2IGTA 4OM1L 3EH5B 1QZ2A 2Q2EB 3ETSA 1PPIA 4MNGA 3BGMA 5DZLA 2BRQA 5BMHA 4R97C 2NX5A 1YYCA 2CE6A 4N28A 1NI1A 5IB4B 3KBFA 5EN5D 2JTYA 2ZUVA 2B1AH 4LK4A 4RM9A 4M6NH 2Z9TA 2LLLA 2VDLH 5KW9H 3NS1A 4APQD 1CWVA 4YNDA 4UB0H 4QHMB 1G7MB 2IQAA 2OXGA 4DESA 3RURA 4N8VB 2QGBA 3JZYA 2N9LA 1U8QB 2QHRH 4HS2A 3FTSA 1I4FB 3IFWB 3LVTA 1QASA 3H6JA 2ORBL 3JCKC 4XE5B 5EIDA 3DX9A 1JRHH 3MCKA 5FZQA 3MRLB 5IEHA 1S5HB 4IJTA 3IS0X 2GITA 5ARFA 5EORL 3SDXB 2BVEA 3SKMB 3UT8A 2NNXA 4FQIH 3U46B 1OAXL 5I0YA 2DYRE 5I1DA 4OKDA 1T2QH 2A0LC 2IY0C 1MFAH 3IRZA 2X1QA 4YSUA 1XLOA 2J55A 3RY4A 4AIEA 3BLBA 3BP6B 2R8SH 4QTHA 1OTRB 4AZ8B 1JW9D 3HN5A 2Z31C 1KB3A 3C6LA 1HHHB 4G8FA 1AS6A 1ZS8A 1DJXA 2IJ0A 2NTFA 1V1OA 5KYYB 5DVKA 3PHWB 1QHPA 1WZ3A 1NEZA 4FI7A 3BO8A 4YE4H 1DJYA 1HQRB 4Z18A 1Z3XA 1C9FA 3FFDA 1CK0L 1XCTA 2AKRA 1AGCA 3Q3JA 2CO7B 4RLDA 3I4RB 1WCQA 1OGPA 2OMXA 5A7BA 1RPKA 3OM3B 4P2QA 4CDHA 2OMXB 4JM4H 5CERB 3LH2L 4FFWC 3Q6BA 4X4XB 5GGSB 2B1HL 3UOAB 2GJJA 2Q3AA 1TN8A 4G80A 2HTKC 3N40P 3UDWC 3FFCB 4BSWA 1V80A 4YL4A 1IBHA 4NZDA 4N3TA 2GJ6E 3UKUG 2IADA 4KK8D 3DTUB 1MVYA 4U3SA 4KHXL 3E6HA 1ONQB 3UMTA 4QR7A 5AAPA 2LVOA 1N5YL 4CC1A 4BX9A 5JJ6A 2DIBA 2NZ9D 1X6NA 3CD4A 3NJLA 5E8DH 1LWRA 4ALAC 3P0YL 3TBYA 5I1CL 1SSNA 4FCHA 2BNRE 4MB3A 3G2UA 2WQ8A 5F7BA 3TG4A 1XGQA 2KZTA 3L4XA 4BM7A 5DJ0A 4KBQA 4AEIH 2KDGA 1NMAH 3V5KA 1THAA 3U0PA 3KLHC 2IOLA 3AQZA 3MLTB 5E51A 4YPJA 3L7FA 4GO8A 4L8DB 3QB7C 4XN9A 3V4VL 3VU1A 1T4KB 2NY6C 5FK9A 3ECBB 3MCKB 3V6FA 1P53A 3BQUC 3UO1L 3UEQA 1XFPA 4OIIL 1NP7A 1F3JA 3DTDA 3GMMA 2ZXQA 2WXLA 3HE6B 3P0GB 4Q9CA 3OKOA 4PRBA 3ARGB 4LPYA 3PNWB 4IBSA 5CD5C 4Z7WB 2BWIA 3KVPA 1V27A 4PJBE 1A4AA 5BW7C 5KSAC 2Q9OA 4GDKB 3FCTB 1X9RA 4EKJA 4NJ7A 1EO7A 1QO3A 4JQVA 2CBOA 2UYLB 3QKYA 3C3QA 4R7LA 1C5BL 3X0WA 1A8ZA 3SO3C 1A5FH 1E0ZA 4KI5D 3WTXA 2HAZA 4J2XA 3MA9H 2ILRA 2G60H 2CJ3A 2VLRB 4HU2A 3FEXA 1TJXA 4DN4L 3MHSD 4HV8A 3DHJA 1G7HB 3O45B 4NX0A 3IFNL 5TSSA 1OCWL 3V8OA 3QDJB 5D7IF 2HRHA 2HG0A 5F7WC 2P5EA 2ICWB 2ZICA 2VIRA 2QLVB 4MRCA 3RI5K 4F15C 4OH2A 1TTNA 1NKOA 4MB1A 4PWGA 1ANUA 1ZT7B 3GJFB 5B8CC 4JFQB 4MA8L 1P3QU 4KVGB 1FVFA 1DUYB 2CK0L 5DMGD 5IMOA 2FD6L 2ZTBA 4P2OB 5ENOD 1MHPL 2NY1C 2X4UA 4BQ8A 3LKQB 1OB0A 3R06B 1Z66A 2J07A 3CXFA 3FO2B 4YHLH 1TTCA 5AW4B 4S1DD 5AALA 4WW2A 5BCAA 4U3HA 1AACA 3MKKA 4QMEA 3TEUA 4ANKA 43C9B 4F27A 1L7IL 1OSPH 3PHQB 1JGEB 5BRZE 3CU1A 3OPZL 2XQ0A 2BZCA 1A17A 3CSPA 4XMKH 5I8OL 4HJ0C 1FMAD 4HIIB 3ABKE 1EH9A 3BFOA 1PDXA 3GRGA 3EIJA 1QFHA 1VF5C 4HH8A 4O2CA 4PJHA 4R0LA 2C9PA 3S8WA 3BP7B 2VNCA 5B1BB 4GIPD 3O0RH 5ISZB 1INEL 1I3GH 3Q44A 5DT1H 4UZGA 3ULUD 5AVSB 4OCRL 5MI0B 4UT9L 3OGCB 1CDCA 1GYWA 3WIHA 4EBAG 5ENSD 1TO5A 4RIRA 3BVUA 3HZVA 1CO1A 3LKRA 5FDWA 2LTQC 5KS9A 4LHJB 4PVLA 1C08B 1CDBA 4PJDB 4HPYL 3MV9A 5BQ7B 4X42A 2AWIA 4AYMC 1K1AA 4GUCA 5FQ7A 4PS7A 1KXTB 3IJYB 4AIZA 1G4MA 4O1NA 2PO6D 3AG2E 3TJHD 5D4QA 2D10A 2V9RA 1CT8B 2WB2A 3D52A 5AQBA 3A5VA 1JUFB 4FABL 1IKNA 1C4PA 1YYHA 3MRKA 4NKMA 4YDWA 1N70A 3LQZA 1EO8H 2P9KG 1C12A 1FZMA 3QXDA 2BKFA 5CINH 5L4MA 5DTFA 2NVUI 5FO9A 1OB1B 1F02I 3CX5K 4PP1C 3VWKD 4HXAH 3RZCA 2J53A 2ADJA 3GO1L 3KPOA 1JYNA 2QZAA 2XGMA 3KPMB 4Y16A 3ZDZE 1CBVL 1N0XH 1B4LA 3MKQA 5D2MC 2LSVA 1KB9K 3EYOB 4NYLB 4UV4H 2LD9A 4JXTA 4XR8C 2RGFA 1EJFA 1TT6A 4OUOA 4K8RH 1O9ZA 5DHYB 5GS3A 5E6OA 1RIUL 5JXEA 3ILQC 1YMHE 4YH6A 4P3CL 5KVFE 2IPKB 5I75B 2P8LA 2X70A 1GGCH 3RFZB 4J3OG 1WAEA 1JRPA 2YAHA 3QDGD 2X5PA 4BSVA 2XN9A 1ETJA 3AM8A 4LLQA 5AVWB 4U7MA 4GZ3A 1AGEB 4D3CL 2C7UA 3GSVA 3NCYP 3QWRD 3T6XA 2K22A 1A9BA 2BNQE 1WD9A 3V7AE 5I71B 5IWLC 2EADA 2HX9A 3L48A 4HIXL 1BIIB 1BQUA 1Q1OA 2P5PA 5FM8A 5JLZB 4JJ5A 2VLLB 4PV8A 2QY7A 2W55A 1LO3L 1CI5A 4MEMA 5EH1A 1BZOA 1QOFA 3EOAB 4OCLC 4I2ZA 4PWEA 2VLRE 1T0YA 4LRNL 4S0RA 3QYMA 1AOZA 5DJ8A 3LD8C 4EPZA 2DQTH 3F12B 2H9GB 4M1GL 5AD0B 4XP4H 2LLNA 1HIMH 3PHOB 4KGRA 4DN3L 4U04A 1FT1A 4A2HA 3O3BB 3D12B 2P5WB 3LVEA 4N2BA 4M7JL 2TAAA 4N2OA 4PJEE 3VGAC 2BJMH 3QARA 4V3IA 1TVBB 3AB0B 3WL9A 1TSHA 2ZUSA 4U7KA 1OGSA 3DSNA 3QT2A 5DVOA 1T83A 2OXHB 4PPTA 2VH5L 2J09A 1BYPA 2BPBA 3CZEA 5IB1A 1G7QA 3TA3C 5BMFL 3B1TA 3VX0A 2Y69B 3C2SA 4WNEA 1K85A 1R4MI 3DIDA 3TWWA 4TRPH 4XP6H 3OL2A 2WLIB 2VERA 1T04B 3T4YA 1B3IA 1T6WA 3LPGA 1QBBA 1HXYA 4CADB 5CSZA 2OMZB 4FAAB 5FIEA 4KITB 5ARGA 1VLXA 3OR7B 4NPYB 3IAM1 3PWUB 4V11A 5GS1A 1FNFA 1O9VA 5JPMA 3PU7A 5G55A 3UIPC 4MNQB 3TWVA 1KY6A 3D34A 4ZMOA 3ZO5B 1EYHA 2VL5B 3OMIB 3QAZC 1T5XA 4LCUA 4MVBC 2HT2D 5CMAB 4CBZA 4LLMB 1P5UA 1GMIA 3I50L 3NDYE 2EXWD 4BGDA 3UBGA 2VQ2A 5C2UB 3HB3C 2KD0A 5IBTL 3X3FL 1NM4A 5CEYB 1RSFA 4KXAA 2JKJA 1ID2A 1MZZA 1IEBB 3CVQA 3NH7L 3VH8G 3GEFA 1WX9A 2DICA 1AWCB 3ONKA 3GSXA 2I9TB 2L83A 3PWVA 5FECB 2B9BA 4PJCE 3T04D 1EMTL 4I85A 3PDOB 4WV1C 1K52A 5D1QD 1W8NA 4PJ7B 2JSVX 4IOFD 1JZGA 1WBXA 2F5AL 4PJDE 5E8NA 2EIKB 2OW6A 3B7YA 4DK5A 2NNFA 5F89B 4R7VA 3UAFA 3VWJB 3LQAL 4M1CC 3TV3H 5MP6L 1LP9E 4P46A 5JQ6H 2QKIB 3DVFA 5B8CA 2M17A 1PZCA 2QZ5A 1IAIH 1U8LA 4C56E 5CR8A 1FI8C 3GXUB 3DOIA 2CJOA 3BSZL 3O11A 2UY1B 3UMVA 3VI4E 3CHOA 3KBHE 4B8CB 2F18A 1UD6A 4MAYB 1A6WH 1A3ZA 3PP4L 2FJHB 2R23A 3KSLA 4WKZB 4RRPA 5H8DA 5I15L 4XGAB 1FVDA 3KNBA 1BVLA 1IQRA 1RFDL 2B3IA 1UOKA 3V9EA 2VRQA 3RZFA 4FA7B 2XA8H 3PJSA 3A3YB 4GRLB 4ELKA 1H6UA 3EFCA 4M1GH 3GZOA 2ZYIA 3DV4B 1JPSH 3C60B 3QQNA 3VD4A 2A9BA 3GZKA 4Y6CA 1TETL 1JBJA 1Z5HA 5ABAA 3REWB 3QHTA 4PM1A 1K3ZD 3CWGA 1H6PA 3D2TA 1RW2A 1YN7B 4IOFC 5FHBL 3TNNA 4BTAA 4PJIA 5D7EA 3FCSA 3L9RA 1BQHG 1ZY9A 4U05A 4ACPA 1Q9WB 3WJJC 5GGVY 1A1OA 4XPFH 1N8ZB 1H0DB 4R7DB 2QVKA 3GRWA 1AZUA 3K74B 4GFTB 1VADB 3V6CB 5JZ7D 2PYEA 4KI5E 4OGZA 1Y18A 3QH3B 2XNAC 1YQVL 3CLEH 4XT1C 1V5OA 5DWUH 5EU4A 3LYRA 3QDAA 2P46B 2Q7YB 3L5HA 2A6KB 3K2UL 3DX8A 5ESAB 5E2TL 4O5LH 3BE1L 4LEBA 5F2FA 1MCRA 3U66A 5A43C 4PB0L 1BJ1J 3AZUA 4O4YL 5EIVA 5B1AE 1M94A 3EFFA 2JQZA 3FT4B 2XV2A 5IW3A 2YJLA 2L7UA 4GYBA 2IY0B 3FU3A 2YNQA 2W0FA 5C07B 5T1DL 5LNDA 5E7FA 3ARVA 3D0LA 5A2KH 4HK3N 2GB1A 1YY9C 4I3GA 4RSVA 1KTJA 1S7XB 1AH1A 2VYRE 1Q10A 4CYMD 4D0CB 5GXBB 1MQ8A 1PSKL 1IAKA 1B9KA 4G70B 1PYWB 5JIMA 1E8XA 1ZTXL 5AJLA 3N85H 4CVXA 2DBYA 1LGVA 1SA4A 1DQKA 2ZXDA 2Q7FA 2AK4D 3G6DH 5HI5C 4URKA 1H8NA 3GS7A 4DX1A 2A1WH 3L4YA 1XH2A 5C97A 1NGZA 5C0FB 4FABH 3RK6A 1TSRA 4LPWA 5IK3A 3VNZA 4ZZKA 2ENQA 3L81A 2ZJSH 3PT2B 3QDNA 1G5AA 1Y1DA 4POUB 1OWMA 5E1QA 1I4PA 5I23A 5GIRA 1I4XA 3D39A 2IWGA 4AEHL 4PCKA 4WURA 3CFIC 3EYSH 3DK0A 3EH4B 4Q4EA 3Q5MA 3TWUA 4QHPA 5DFWH 3S36H 3UO8B 4UTBL 3Q6FA 2AMGA 4B9CA 1OCCB 3MRDB 5DK0B 5HHOD 5EE9A 1R47A 3D18A 3LPZA 4PD4J 5AQ9A 4WHTA 4KRMB 1MY7A 3WUZA 5KSVA 4AJYV 4WQOB 3P3TA 4KPHL 3C2AH 4A2MA 2QQLH 5EO0B 2Z93B 2NR2A 3NCEB 1QLEB 1JRUA 1I3GL 4ZFZA 2YPKB 4BJLA 1TIUA 1IIKA 3IYLW 3FK3A 2Y9RT 1VERA 3MRJB 3PQYE 4KGSA 1K4CB 1CD8A 1F6FB 3D18B 3O2WH 5CLWA 4IRUA 4JN1H 4BHUI 4A8XC 4YZWA 2BOBA 5GSVB 1HH9B 3VTVA 4LGPB 4FNTA 1PZ5A 4X7SL 3MV9E 1BEXA 4U1KB 5IFHL 3ZXAC 3H2PA 1NL0H 1BVNT 4MMXB 4XWOD 1L9SA 5B38G 1KIQB 1TQSA 2FX9L 3O6ML 3V5HA 4U96D 1FFNB 3MHZA 4LKXB 5KNGA 3TWTA 1QEWB 1UFUA 5A23A 3L4TA 1P1ZA 4H7YA 4JFEB 3ABZA 1ZLUH 2KDEB 2RFAA 2EO9A 4W4OA 4LE8A 3L10B 4BKSC 4QFVA 3MR9A 4PMEA 3PV1A 3HVNA 3LOWA 4A7GA 3KQ4A 4TMAB 2C8NA 4LSTH 1UVQB 2RIKA 2R39A 2WQ7A 3ZHEA 1NCUA 1QQEA 3ZYLA 3ENEA 4CGWA 3TZVA 2XRAL 2R17C 4JGJA 2FF4A 4REZA 1KIUB 1MDTA 2EECA 3Q1EA 5KVDH 2AGJL 3TPUA 5BOPA 1URLA 2VLRD 3FU7B 1EK3A 4F15B 5CP7B 1VDVA 3MODH 1OM9A 1ZV2A 1YN6B 1QPPA 3MCXA 4Q56A 3V5DB 3GUTA 1QTPA 1QT9A 3A4RA 2JQAA 2FCBA 3KLAB 1CDHA 1NGWB 1H6FA 1WR6E 3QYNA 1B89A 4UWGA 1UEMA 2XZAH 1ZKHA 3SDDD 5HVWA 4RG9A 1FNGB 1TNOA 4UM9B 4TQ8A 1BI8B 3M3JA 3D09A 4DQAA 4F7ZA 3W2DH 4KZCA 4KKQA 3U2IA 2J52A 1TGZB 3P30L 2XEEA 4J0UA 3N44B 2NPTB 1OE3A 3QDGE 4HOZA 2CS4A 3KUZA 2V2XA 4Z3HA 3V6OE 4K3EL 1INEH 1YPZA 1CFSA 3AG1E 4HIHB 1GW0A 4AYFB 1WUZA 1HXMB 2AJVL 1M4VA 2I07B 1J1XH 4UI9J 1M05B 1X3DA 2AABL 2VZTA 3BJ91 4G6FD 4RAUA 4AT6B 4UIKL 4MXWL 3CC1A 1RURH 5MEND 4AQ1C 1MFNA 3ZE2B 5MEQB 4NO0A 4PJEA 4APXA 3SGKA 4KXCA 4Q8BA 3VDBA 1L0PA 2OJRA 2W59A 4MSWA 5I1CH 1OWNA 2XQYA 4IBUA 1T89A 2HPTA 1IX2A 1SHXA 4X6CA 3QI9B 2VUOA 4Y2DC 4Z7QF 1U8LB 1H6EA 4FQCL 3P1UA 1YNTF 3AE7B 4QY8A 1T2XA 3LKNB 5D2LE 2YMOA 4O9HL 5GRVK 3TYGH 3Q06A 5BV7H 1L2NA 1DJGA 2BVQB 2ZXEB 2X2YA 3BIBX 1UZ8A 3D9LA 1XGTB 1ZV5A 3PH0C 3L3OC 4TQ1A 1PG7L 1Y07A 1GL4B 1F4WL 1G94A 2ARJQ 2IALA 3MOAH 3URZA 1D5RA 3QZPA 3QPKA 2RA1A 1WWCA 2WCGA 4OQTA 4LCWD 5E75A 2L52A 3MU3A 3DHHC 5HPMB 1J05A 5BMIA 1A9EB 1KY7A 5I18L 1QMUA 4KVMA 1I4QA 5K39B 5JXEC 3GBNH 4PJHE 5E6IB 2R0WH 3ISMC 1NBYB 1UGJA 2XC8A 1XGRB 3BWZA 3RJQB 3U64A 2A6JA 3NVQA 3DV6B 1A3QA 2JH2A 4HOSA 5T5FH 1IC7L 1PKQA 4XBPA 1ELKA 3RVTC 2CZNA 1IGYA 4P2RE 1DBAH 3FZUC 4FOMA 4U1IB 4TUUA 1D6VL 4BQ6A 2D3JA 2VQ4A 3KJ6H 5AFAA 3D39D 2YFOA 2CCLA 3ZDYB 1WEJL 1A9EA 2B4CL 1XQQA 3MGTB 5HDBB 1EUVB 4JVSA 5JW4M 1UATA 3KYMB 1L7TH 1AQKL 2BC4A 5EN2A 2P42B 3SB3A 1NSNH 3DX6A 4AQ8C 5F93C 3L95B 5MEPA 5E24E 1L6VA 1PG7X 3M17B 1NM9A 4RMBA 3ROOB 3H6NA 3ZDWA 1M4KA 4JWUC 4MBGA 1RIVL 1UZ8B 3QRBA 2VE6B 1T04A 3SQOH 3T4YB 1ED3A 1MWAA 3A6BL 3EJTA 4XBGB 5D6CA 3UGEA 3W57A 4Y4HD 2A99A 1D8EA 2XG5A 3KPPA 4U6TA 4YDIH 1RAMA 1F56A 4BTBA 1L9QA 1G9NH 4DP4X 2KMCA 2VDOH 1AS7A 2VMCA 3JYCA 1U3DA 1U92B 3C87A 1RLBA 3DPBB 2F74A 4L1BA 4RNRB 3AFLA 2YLKA 4KQ3H 4Y4FD 1FAIL 2O5ZH 2FLBT 5FYLE 5SV3A 2H6OA 2JX5A 3TFBA 2QSDA 3EIFA 3H2QA 2Y7SA 4I0PB 3GNMH 3JXAA 1P7QA 5CKAA 4ONGL 2P45B 4DP5X 4QAMB 5FR3A 2VDRB 3PE3A 4M1DH 1CE1H 2HLFD 3RSEG 3UT7A 5HHVH 1XHHA 1HHKB 2V3FA 3D50A 43CAA 3SGJA 4BINA 3LD8B 1OEYJ 1HCYA 1UT9A 4Q0XL 1NYRA 4JEUA 3PWNA 5F9AC 4EN3A 3UIOC 4FI8A 5GISH 1RSYA 2VLMD 3EDJA 1HZLA 2XBZA 2Q5WD 3OKMA 1G9MH 4XI0A 5LNGA 1YRKA 1AMXA 1QYMA 4Y5YB 4N2LA 3BYTA 1U8MB 1UBIA 3OF6A 2UX7A 4L1LA 4PVMA 3MC9A 4HXBH 1VHPA 2JB6A 4C56D 4AI7A 3MLVH 5CZXC 4FDWA 4GINA 2E6XA 1AGEA 3PDGA 1U91B 3QNYA 5BV7C 1KELH 4X6EB 1QFPA 5CP7A 5BRZA 4PP2B 2R56L 1RYJA 3I74A 3VQMA 5C0GB 1FBIL 3EOTL 5E6NA 2V17L 3KYNA 4W9LC 1XCQB 1W0VA 4YHYB 3N1MC 4PN6A 2GBRA 1RIHL 3F00A 2PXYC 4PW9A 3T4AB 2X09A 2ITDB 5D1QC 1NSNL 5JIQA 4KNSA 2H7WA 3LXFA 3EHMA 3RGVC 3DHIC 3UCRA 4JHRA 4RMVA 5CZXD 5K69A 4LGRB 2H41A 1ZB1A 2QVFB 2VSMB 4YWGH 3HS0B 1NCWL 3K6NA 3UJJH 4ZFOL 4M7CA 4MMZB 3WFBL 4S0HA 5EZPA 2YRZA 4TLTA 2KOXA 1YQ3B 2YR3A 2WLBA 5LX8A 2PPEA 4XB7A 2X3AA 5E8PA 4KO7A 3AB5A 3H7LA 2B0OE 3ZDMC 3MGBA 4CAGA 3TBTB 4N87A 5BVJA 2PYFB 5T3ZH 4JLCA 2ARWA 1UGKA 1XB3A 1CBJA 1ZLSH 1SEBA 1X7SA 1MJ0A 3N41B 3TXMA 4Y0GA 4GLRH 5BZWB 3FQXA 5AAWA 4ATWA 3NJTA 1CD1A 4AGPA 5IHHA 5L88L 4OFPA 5CLZA 2P80A 5GSRB 4N9GB 2P9RA 2LO6A 2V5TA 4L9PA 5F6HJ 1DBBH 1AG0A 4OZFH 2X12A 4AX3A 3S0PA 5KWYC 2RFXB 4NSKB 3WIFA 3TBTA 2QKIC 2XOTA 1WJ3A 2ZKWA 4H8WL 4H0HB 1T5XD 1EA9C 4G8EA 5IUSA 1JZ6A 2NCNA 1Z3GL 4JO1L 1WZ1L 3UAJD 1BXXA 4AMXA 1BOGA 4GTVA 2A4CA 4HOTA 2MKWA 1FIQA 1ZXHA 3KD4A 3MYZA 2UXGA 2QPFA 3GI8H 5EF2A 1GA2A 3JTSA 1S63A 5LBVA 1HXYD 2AJSH 4GOCA 2XBDA 1HKLH 3QCUH 4UQYA 4Z7WF 3EGXA 3NUHB 3ZJUA 4DSYA 3DX3A 4YDMA 3IN0A 4IRJD 4WFED 4EBAA 4ZS7L 5GRJL 2FATH 1P7HL 3BMWA 1JK9A 3QXAA 2V5QC 3CQFA 3ARBB 2YAPA 4RA3A 4C58B 1DSFH 2V2WB 2PEAA 3OX8B 5TFSL 1EFXD 3CGHA 4BERA 4QHUA 1N0LA 3BZDA 5TK4A 4K3EH 1J0IA 3NRPA 4NDMA 4JFYB 4PP2A 3GKWL 2GI7A 3ORJA 1IM9A 4JHWL 5D1ZA 5E9DA 1MCDA 2B2XL 3GKZA 5IVOA 4K94L 1UELA 2VDKB 1FYTB 3U4EA 2MQ0A 1JTOA 1ZHBA 2P24B 1HHIB 3UTTE 2OI9C 4Y2LA 4KT6B 2CU3A 3X17A 5F0JB 3L3KB 4PBXA 3H3BC 1TQCB 1QZNA 4G3XB 1E7VA 5KNHD 4U1HB 3BYTB 2X28A 1QSEB 1PYWA 2KKCA 2PM6A 1NMCC 1CLOH 4M62H 1QFWI 1V5JA 1PLBA 3MLRL 1IU1A 1JD9A 2VSNA 2CKBH 4PJ5D 4G50A 2WXMA 3ZKJC 2XU9A 3DJSA 2JJWA 3RZCC 1WPCA 4FQHA 2B3AA 2K8CA 2ICWA 4JVUA 3O2VH 3C5SB 3PWNB 2PPAA 4NN5B 2DEXX 5FQ4A 3NIDE 3GYRA 3UBHA 4C4UA 1DBKH 4U0UA 3RX7A 3D9MA 4DP2X 5LN4A 3ZDXF 2OX5A 2YRBA 3IU4L 3QG7L 4JR9H 3CH1A 4YHKH 3QEGH 5L8LB 5C07D 1Y8MA 5LG6A 1HL5A 5SWSB 1C1EL 4F1PA 3INOA 4LVEA 2EIBA 2VC2H 3ZUCA 4RF0A 4FFYH 3WSQL 4X9HA 5DSCB 3P63A 1BQKA 4M61A 4MBRA 1PCSA 1QO3B 4A04A 3VI3E 5T1JA 2OZNA 4D9LH 3G5YB 3FCTA 4ZO8A 1WBZA 3KCWA 4GCNA 1NWOA 1S6NA 5KN5A 1HK6A 5LJYH 5FOJA 2K8HA 3AS8A 15C8L 1H0DA 3KPPB 4G42B 2J6EA 3RNCC 1R3KA 1OM3H 3ECUA 1GOZA 1AO7E 2DBJA 2VE6A 5AVUB 4HD9A 4JRXB 4F7CA 3GMMB 3C5XA 1MCCA 5FYKH 5AZUA 2FX9H 3O6MH 4ZAKC 5HDOA 4AKQA 3EGRA 3NIGE 1MELA 1YQ2A 4FN0A 3L95A 4QYOB 4DCQA 5M72A 1EAQA 2HKFL 4FTVB 3V6FB 4R4ND 4BKTC 4ELKB 1KF9B 4MQ7A 4FD0A 3VWKA 5F71A 4I9WE 4AIXA 2M4NA 4MFHA 3GB1A 4G6KH 3L08A 4WHDA 4N86A 4MNQE 1EZSA 3C60D 3CC5B 4D3CH 5C3IA 1X44A 2NSMA 3DMMA 1QTSA 2M0AA 2MJDA 4MAYA 3CDYA 4K9EC 3FL7A 5JO5A 1FZKA 4KJYB 1GCYA 4HEME 4Q4IA 2P3YA 2M1KA 2KC0A 4M7LT 3TIEB 5I24A 1LEIB 1QLBB 1HZHL 4GA1A 5EWIL 3L9BA 1YEJL 2WTPA 1ZLSL 2KNBA 1J48A 1VACA 4XKBA 1FNEA 1FH2A 1M7IA 2YD3A 3LRKA 2ZUTA 3RNBC 1ACZA 2VJ0A 5DRWB 3BLKA 1N4SA 1VCBA 3I2CL 3ZPDA 3IDUA 3HA0A 3OWRA 5C7ZA 3TH3T 3VFNB 2ATKB 2F7RA 3K8MA 5I1AB 3Q2NA 3K2IA 3JYUA 3KBPA 4PJ7E 1Z32X 3D39E 3BPLC 4ZBJA 1G9NC 3BGAA 5BZDB 3ZE0E 1MCLA 3TCLA 3MUUA 4NZRH 2YGVA 4W6YB 4ZFOA 2OYMA 4J3OH 3GBDA 1G6RL 2P52A 1XGYL 2BY2A 1EUUA 2GTWA 2W5PA 3KWUA 3EH1A 3L2NA 2GT9A 2X6CA 2WIMA 1BLXB 1MW2A 5F9JB 2A1WL 2JZZA 5C9KA 2H0PA 2NTFB 2LU3A 1TCRB 4TQPA 3T0BA 1VFBB 4NO0B 4ANXA 4X9IA 2JJTC 2BCKA 1UD5A 2WNKA 4PWFA 5AAMA 2L3ZA 2UUDH 2VL5A 4DFHA 2HT2C 2EACA 3FRPG 3JWNC 5D93B 2CDGB 1HXMA 2X87A 2WWMC 3PPEA 3SYQA 2JUOA 2OMZA 3WE1A 3IAGC 4GSUA 1F1DA 4JCMA 4QXTB 4UQ2B 2BVCA 3US1A 2WUBH 4HWZB 3V30A 2PTTA 1N10A 3NZSA 2ERJC 4ZUUA 2FO8A 4ONFH 3D2UD 4YHMH 4MYWB 2NX5E 3O9WA 2I7OA 2VLME 5M94B 1JGVH 4FG2A 2B6CA 3U0TB 1G7MA 1IGIH 2IQAB 4XCCL 3LRMA 2KFKB 3W9CB 3QHZH 4GTRA 2PWGA 3CN0A 4PJBB 5E00A 5KCMA 4WJ5B 3H42L 2Y6SD 4YDZA 2IC2A 5MERB 3ZSTA 2NX5B 4Y4FA 3A1QB 1OAKH 3FU7A 4LCIL 2ACZB 4NQKE 2SEBA 1NGXB 3LS5L 5I19L 3ASDA 2Z64C 5G5GA 3ALXA 3S2CA 5K59F 1MVUA 4HUWA 2XICA 3Q8BA 5J12C 1N0QA 4YVOA 5IZ7A 2Z3FA 1GGYA 2EXYC 2F19H 1OT1A 5FV2A 1M53A 2PCPB 3G7TA 1WXQA 1NZNA 2GRPB 4JZJA 2NBWB 4AUUA 4LPXA 4NCDA 3PS6A 3V2OA 3QQ8B 1FF5A 4U1GB 3HNVH 4KX8A 4HAFA 5F1SA 1QPXA 2CWRA 3D51A 4FMVA 1X9LA 3DXKG 4GTQA 4LHUA 4R4NC 4UAOB 5FINA 3LY7A 1ZVSB 3HMWH 3NA9H 3Q5TA 3DIVA 3MXVL 3VFVB 4YDOA 1A9BB 3CBJB 3E80A 4M7KL 2J71A 3KJ6L 2DJSA 1I8UA 3JV6A 1YNTB 3NFNA 5FKAA 2J25A 4WIQA 2F8VA 4RAHA 1N59B 1JE6A 4K9EH 3UL4A 2N0SB 2WGSA 3Q3GA 3QXUA 2VSKB 4FNSA 1MAMH 5E8EA 2EDRA 1V2YA 4LNNA 3KAAA 1U4FA 3D25A 1CLOL 5D0OD 1S2EA 4Z7NB 4K1RB 5DDHA 2WAHA 2WINB 5ITZF 3NEEA 2IO0B 3IDIA 4LESA 3T3MB 2ZVOA 2AJ3B 3MKQB 3B3IB 3AJIA 3EYOA 4LCWA 3JQ0A 4GG6E 4XCNA 4E42A 3RKVA 4N2FA 4DETA 4PJXE 5HI4D 3T0DA 4AVIA 5L2JB 4GB9A 1B0IA 3OLGA 4F2MB 1TIFA 1R5WA 3MRIA 2FNWA 1FLRL 1MI5A 2W07B 4B9FA 4UOJA 1GAQB 4QXUH 4CBPA 2OLDA 5A3ID 2NDGA 1XSOA 1FNVA 1JUFA 2BSCA 4Y5VB 1I8LA 3W3BA 4BFEA 5IQOA 2N1WA 3KM1A 4NC1C 3JWNH 2RKKA 1Z5LB 3QW9A 4HQQL 2X6JA 4NPJA 1MRDH 2XIIA 3MRDA 1A0QH 4D7PA 4I7ZC 2H6FA 2EO7A 3WLWC 4HRLA 1NDTA 1SJMA 2V5YA 2JRIB 3JUZA 3RPKA 2YUVA 1BQLH 5T1MA 3LSOA 2JLPA 1BZ8A 3D39B 4M5YL 4W9FC 2Z92B 5FYLD 1C08A 4BSJA 5D6JB 1NBZB 2YQ8A 5KSAB 3SJVD 5TH2B 1RK7A 1SVBA 3GQFA 1XR9A 1BF5A 2WZ5A 4RESB 5G5DA 4ZMVA 4JAMB 2BNUB 2ZF8A 3GGWB 4HJIA 2V5FA 4YEEA 2NNAB 5C2BH 1UOWA 3SU8X 3MUGA 2XIDA 2EDXA 4QRQB 4PCTA 2ATPB 1FHNA 3CVBA 4PJAA 2GIYA 2X41A 1NBQA 3GXFA 3PZ4A 1KSRA 5E6ID 3FUFA 1RP8A 1OP5K 1K51A 3M63B 4LSDA 1EU3A 2B1HH 4G3YH 4H5SB 3V62A 3TJHC 4ZHOA 3MFFA 3LXAA 4Z3GA 3KLKA 4C57C 1N4QA 4NXKA 3MC0B 2PMZA 3PUUA 3RDJA 1UJKA 3VSUA 5FYKU 2N4FA 3PZ1A 1I3UA 3ZDZB 2VLKE 2AQRA 2AEPL 3Q15A 2EDBA 3CHRA 1FO0A 4CU7A 5F6IB 2YSTA 2AJYH 3AE6B 2WDVB 3DX7A 1BJMA 1T03L 1GC6A 3AG4B 2LU4A 3BESR 4LRNH 1OW0C 5D2NB 4KDLB 3DX8B 4RGOH 1NAMH 3WUWA 5IW6A 1HFUA 2XJKA 4WVRA 4OUUA 3G3LA 2BYTA 3TVMB 4FXGA 3VUAA 3ULUE 1FA4A 4WENB 4WIPA 2Y0SA 3IVKA 5IB3A 5KSBF 2OSLA 2FYYB 3KE0A 4AYEC 5DD6A 3N43B 4GDLA 3BQOA 4IBTA 1G0XA 2NQCA 4NO5B 1AXSB 1PFDA 1PJ9A 4Z7IA 4KTYA 3ZL4L 4CDRA 4IWOA 4TKWA 1XL4A 3DVNU 3OXSB 3ULUF 4IM8A 1FBIH 4ZDHA 1BQHB 4GP8B 4JKLA 4K5MA 3MNVA 1S7WA 1IKFL 2PR4H 3HRPA 2VN7A 3AUWB 4MCZB 2AV1B 1KPSB 3VRBB 1AR2A 5IEKB 3T0XA 4UB0L 1RIUH 2CU9A 3S98A 1REIA 2ZYHA 3NIFB 2HUHA 2QKSA 4TUJA 3NB2A 4HLZH 4HS6B 4NQDA 3BPOB 2LEKA 3P11H 4JG1L 2Z31B 1FFVA 3O11B 1KFYB 2YUZA 3A67H 1MI5D 4Q9QH 2EIME 2RALA 4PEEA 2IOMA 4PRHB 1LM8B 2YLMA 2XVKA 32C2B 4W9DA 2O1AA 5KSAD 1R0AH 4MDJB 1U8JB 5JW5B 3OKOB 3AXHA 4PRBB 4Q6IB 4L1TA 1UH6A 3SD5A 3CVIH 4IBQA 5I6OA 5GRXG 2ZJDA 2Y69E 5D70L 1W0WB 4U1SA 2R05A 2GGFA 3DETD 3OVUB 4PRPB 1QLEH 3QQXA 3ZHDA 2DWZA 4BA0A 1T7ZA 3HB3D 1QQRA 2X40A 5DUBB 1Z2KA 3PDOA 3IXTA 1M9SA 5FGSA 2I9TA 3GSXB 1URIA 1LGRA 4X6BB 1HOEA 2BFVL 1JZ4A 4P5MB 4XOEA 3BD3A 3HC4H 4AM0Q 3IEGA 2D3GA 2H0JA 2R9HD 3TBBA 1TTRA 1A6UL 2H2SC 3GXPA 3MNDA 4NQTA 4FLBA 3QCAA 5D2MB 4ZW3A 2JRHA 3BHBB 3EFUA 3LH8A 4KI1A 4P6VF 3TOPA 1CZ8H 1TVHA 4GP4B 1CLVA 4Q6YA 3VMNA 4Q9RL 3RA7L 3SDAD 1G3NB 3V60A 4AWJA 2ZJSL 3Q49B 5DCCA 3VTXA 3E6HB 3RD2A 4YSTA 2BOLA 1XMWA 1HSAB 2CGYA 4GQPH 1AYOA 4FFVC 5D5MA 2ZKHL 3MLWH 3VR9B 2OMNA 3B1UA 1L7TL 1MW0A 1SM3H 2NY4D 1I9JL 5DGQA 1H9DA 3O0RL 2CG3A 1OZTG 5LHDA 1Z9PA 2J1YA 1F18A 1QSZA 3KGTA 1XR8A 5K9QG 2H2SD 3BPNB 4N2DA 2G9HB 2VMEA 3J07A 3QFJA 5CBAA 2MCPH 3O8XD 3MXWL 1UHVA 4IK6A 3A6CH 3OPZH 3VFTA 1JZ5A 1HAWA 3OWEA 1VCBC 5C09E 3U30A 3BAIA 5LBGA 3WNLA 4BCZA 5GZOA 2YOAA 4NQCB 3IFLL 4N2CA 2XN2A 3POCA 1TQCC 2CM5A 2FTAA 4EF3A 4HJTA 2A38A 1G7JB 2K45A 4MB5A 4ZD3L 2YN3A 1YHPA 3OJ2C 1MFVA 2IWKA 3VRJB 1PGAA 3I6SA 3PAVA 4LMQI 4TSBL 2ZD0A 1XB8A 1OY3D 2BZDA 1BZDA 4OB5H 5HYJE 3P4QB 2BVUA 2D31B 2PN5A 5HBBA 3H1UA 3MLPA 4L4VB 1B3JA 1SE4A 2XENA 1X7QB 3EJNA 3VTYA 2WSKA 4GKLA 4U6YB 4WNSA 3EJZC 4WWMA 3D08A 4H8UA 2DLBA 1PBYA 4MHHI 4R84A 4UV7H 3QUYD 4M48L 4BFFA 4WUUE 5KJLA 1NBCA 5CBNA 3NGBB 4G1MA 4GEJA 4ICWA 4JJ5B 2G60L 4DN4H 2IDUA 4I4WB 3DVGB 2DDQH 4JPVL 1XBRA 2F54E 4M8QA 4WW1A 4MQXC 4MJSA 1YUKB 2YXFA 3HHSA 4P48A 5E6ZA 1AQHA 4NFCA 4JPIA 4OJAA 1MFUA 4X80L 3RNQA 2F08A 3PSEB 4NM8H 3MGOA 3JTTB 5KBNC 1ZHKB 1MCPL 1KBPA 1XF5A 4HK0A 2UV3A 3WFEH 4DHLA 3X12B 4ZXBA 3VQIA 4XOAA 3SCMB 4I18C 2BP5M 5B4MC 3PREA 3RFZA 3VHTC 1WYJA 4MNGB 4YDKL 2V0PA 4XO4A 5BV0A 4DP0X 2KYIA 3NBNB 2XBBC 4LNBA 5B3JF 4NY0A 1QATA 1SN2A 4HJEA 3LZRA 1LEKA 3T0EB 1V3KA 1SA5A 5I76A 1DEEB 2Q6WA 2J0JA 1MCKA 5FCUL 3KGUA 2X89D 1CGSL 3L9EA 1UM4H 3G6JE 2YPVL 1ZLUK 3D9AL 4OLWH 1I7ZA 4Y16B 1T7VA 1JHLL 2D31A 3C8DA 4JQVC 5LG1A 2EIJE 3AULA 5BOZG 2JK5B 1J8CA 4OLVL 3LEYH 5D1QA 1PC2A 1X5YA 3EJYD 4FQQB 2R2QA 1WGGA 4K03A 1W2KT 4FQLH 3EGSB 3NSXA 5DR5H 4S2SB 3U7YL 3MRKB 3NEXA 1IGTA 4NKMB 2Y06H 4X4MA 4E5XA 3VYOA 4HQQH 1JNLL 2BVOA 3IMWA 4J27A 5E5MB 2Z0DB 1UWXK 1BU9A 3B9VA 4HZ1A 3QC8B 2DLEA 1PKOA 3AADB 4A2GA 2P2CP 1WUNT 2CCVA 3AT9A 1ECYA 3V7MA 2J56A 5DQDH 4P05A 1HH6A 1N9PA 3EYQC 4PB9L 3ULUC 3B6SB 1D9KD 4MD0B 4IW4C 4MD5B 3LEWA 1EUTA 3KDMA 4G5ZL 4JY6A 2J43A 1HAUA 4GKSA 3UAEA 4GTMA 2D7QA 2GFBA 3L5IA 3UGUA 3D0AA 4BOSC 1CLYL 4Z77A 3VD2A 2IDYA 2D3NA 2DI9A 2C5DC 4RMWA 1FSKC 3E0GA 2CPUA 1CK0H 2NXYC 5C0IB 3L5XH 1KTKA 3GSNH 1SXZA 1OAJA 3U2SB 1S7QA 1KLUD 4XPHH 2I5YH 5AVTB 3DJRA 2BHYA 3DGGB 2H0FA 4PJHB 4M5SA 5TPWH 3T6WA 1A7RH 1GJUA 2YSSA 5D7IE 5AAOA 5F8QC 4X9FA 4C4BA 4F5CE 5LXGL 2WV3A 3QUGA 1TEYA 1QD0A 2E7MA 4ZO6A 3FB8B 1IARB 3FRUB 5IY5B 2ZX8A 5KJ7E 4DLQA 2GUYA 2OMBA 1ICTA 3FPXA 4DFIA 4MCYA 2Y1VA 1D5XA 4P23A 7PCYA 1BQSA 3HRZA 2F5BL 4M7JH 4NBZB 5I75C 1A70A 3OG5A 5LXIB 2JV6A 4XC1H 1EWYC 5IBUB 3I75B 2DV6A 4H0GA 4X7DC 1I9EA 1JRHI 4TYUA 3EO1A 5DZVA 4W9ZA 3X1NA 2NZ9C 3TWSA 1TJHL 1JPSL 3GM0A 5JW5A 2DQEH 4JMNA 4K15A 4KJQD 4RGNE 4AENB 3WTSA 3SNXA 3PCYA 2C1PA 3A4DA 1J18A 1GY2A 4YTNB 1XO3A 2P28B 4L18A 3ARFC 1OQXA 1BCIA 3N91A 4JFQA 3GMOA 4EPSA 2XWZA 3IT4B 4UQAA 4PH4B 4LPUA 5D71H 2GQHA 3OKKA 3RWFA 2QMTA 5CD3B 2D5GA 1ASQA 5E9DD 2V2TA 2KBXA 5LCWJ 1KTLB 1Q9OB 2YEQA 4PY7B 5EU3B 4DXGA 1S4IA 5I1JH 3L1EA 3ISWA 3X2QB 1XNFA 2E76C 5DMKA 5C0JB 4IIZA 1QRNE 2OM5A 4EUPH 3T3PB 4HISA 3WFZA 4QRRA 1MCFA 3IJSB 1WIUA 4IRJA 5IBUG 5JDSB 1CGYA 5FYLL 2DQFA 3QC5X 1FFRA 3NSDA 1ZTXH 3U2JA 1Z6TA 1EEYA 3QEUB 4UAOC 3U6RA 4MRBA 3TL5A 4F92B 4W4OC 4LNKA 4ZAKD 2ODHA 2H6GA 3QRGH 1ZA3A 2HX8A 1ZU2A 4G5ZH 2IBBA 1UC6A 3VXME 2IANE 3UAJA 5HJ3A 4N2MA 3DXAA 3A9JB 2QQNH 3SE3C 2Y07H 3MBXL 4JRLA 3GO1H 4ODWA 4ODXB 4WUUA 4HOWA 4QRUA 2RDGA 5E5LA 3QUZD 4PRNB 1J5OH 3RT3B 3NIGB 5FA4A 2LGIA 3ARWA 1HNFA 2P80D 2WBJB 1T1YA 2VUYA 3NRQA 2DQUL 2DYPA 2X9YA 4KROB 1S64A 3NK4A 3I6KB 3QEQD 4IRSA 4QO1A 5DWUL 1MFEH 1N19A 5E70A 4XVSH 1AC6A 3L8QA 3V5KB 3ECVA 4NUGL 2WCSA 4UINL 1SBBB 3VG9C 2MBOA 2Y36H 4LVNB 3AEBB 3IVFA 4MM3B 3VFMA 2JIXD 4RZCB 4UIMA 3LDBB 5IG7B 4TQ0A 5JHDE 4HETA 1I53A 4H1LG 3TBYB 5B1BE 2ICEC 4KSLC 3TSSA 3D3VA 3JWNE 3UTPE 1UTDA 1HEZB 3LEVH 1YEIL 4M6ML 3VGDA 1JCKB 4FNRA 1AHWC 3VRJA 1T0PB 3VCLA 2K0PA 2PABA 1UB5B 3F04A 5C0BB 3WE6B 4PSRA 2FJGA 4XNBA 4Z3JA 1GZQB 3BKCH 3TBSA 4HDIB 2UYZB 4JFSA 4V2CB 3U4BL 2BSED 4G80B 5D4IA 1DANU 4PJAE 5L6YL 4WV1B 4N90D 2DPKA 4XODA 4XXWA 4KXKB 1FL3A 5F6HI 3VFTB 1CGVA 3DGCR 2XUWA 1AQDA 4LDTD 3R1GL 3PNLB 2V4HC 4XN5A 1D7CA 3W9GA 2AVGA 2X9XA 4QT5B 4WAFA 1XCTB 5KTEL 1MJDA 3FFDB 2FEDD 4OZ4A 4TUKH 3BO8B 3WMQA 2VT0A 4IRZH 3GUFA 3DYOA 1HJCA 2XTJD 2FO4B 4YBHA 4HB5A 3E9SA 1HSAA 3F8UB 5D7JD 3UTZB 1PQZB 2OJEA 3SE8H 4K5NA 4LJOB 5FYKL 1PMYA 2F5AH 3EJYC 3PHSA 4XCNB 3WLBA 4E42B 3BKJL 1BAFH 4MAYC 4JANA 3TNMB 3QJSB 5EEXA 1A14L 4KKAD 2AJ3A 3B3IA 5FEBA 1L0XB 2BIQA 3FONB 3SOBH 4CVWA 5HGHB 4FHBD 1QR4A 1LD8A 5IVXA 1FG2A 5I8KH 4ZX6A 5HJBA 4GZDA 2QELA 5ILTL 4IHOB 1KENH 3H7PA 4XOBA 2CMRH 3H9DA 4TM9A 1NYQA 2BWFA 4XXDB 2VGEA 4GAGL 5BUPA 2ZXGA 4A3PA 1JZHA 4KMQA 2LWPA 1F13A 1K5NB 4W9KC 2N7SA 3AU1A 4Z7WE 2FR4B 4PRPA 2EE9A 3NFNB 2WUBL 1IGFL 1U8QA 1NENB 3TJPA 1EZUA 1WZKA 1UH3A 3C6SA 1CGTA 3SEBA 4QHMA 4XAKD 3QXWA 2GBJA 4MDJA 3TUOA 1S0PA 1SJHB 1XQ4A 5CEDB 3ZHFA 3QEHB 2WNWA 1FFTB 1CBVH 3TESA 2P48B 5IGXH 2EE2A 2YHEA 1QACA 4CJ1A 1J9QA 3RIFK 2OCJA 3F7PC 1OW0A 4NQDE 2CRMA 5F7NC 2IAMA 3S7DA 2PCPA 4OF8A 3DA0A 1R75A 3BWAB 1DNPA 4GQRA 2XVGA 1FRRA 1QW8A 4P06A 5CEZE 2RR3A 4FHKA 2G3NA 2CGRL 1JNLH 1YEFL 3EJQA 2IH8A 4UUJB 2BH0A 2MQJA 4J3OC 5KZCB 3K81A 5GGVL 3WNIA 2UWQA 1ELRA 2QILA 1EHXA 1U93B 2W80C 3NA4A 4E68A 3L17A 3E4BA 4I6EA 1C8PA 2AEIT 2DYSB 3UXFA 2OVBA 4TULL 4JM2B 3N42F 5ACZB 2YWZA 4X9GA 4X98B 3HNTH 1AXSA 2XZQL 2ZQKA 4JO5A 2BGFA 2CDFB 3D85A 2WBJD 3O6FC 4FG6D 5SWZB 4HJUA 3UPCA 5DD6B 4N2GA 4DP1X 2KZBA 1KCUL 4O02B 1ZT1A 4XZ4A 3SYPA 1ULVA 1AE6L 2BSSA 4NN7B 1RAXA 2UZYA 4J1UA 1I7RB 2XDHA 4XPGL 2DQHH 1DVZA 2YINA 1BXAA 5LDSA 1Z9MA 1YMHA 1PL3A 5EBWA 4GW4B 4J28A 3RL1B 5I0WA 4ICUA 4LF3B 4BZ2L 1WC7A 5L95C 4XVTL 2WAQA 2HR2A 4EJ1C 4OLUH 5BOJA 2VZ3A 4JRXE 1DC2A 1FO0B 1KTRL 2VDNL 4ICXA 3NZ3A 3VMOA 3OKNB 2K1MA 2HTLD 1BD2B 3SDYH 4YWGG 2I25N 2Q76B 2VUKA 3OAUH 3BAKA 4A2EA 2N7EA 2BCKB 3WTWA 5ICXB 2WWNA 1LK2A 3GMQA 4YXHH 2UZIL 3OB0K 4G6JH 3ALPA 2QTEA 2W1NA 2X8XX 3RL2A 3U48A 1MREH 3ZTJG 3QGVA 3FOLB 2Q3ZA 4L0PB 1E4XL 1GZPB 1JWAD 4JKKA 5E56A 4JFZL 3WTVA 3CSFA 1S9VB 5CJ5A 1UH2A 3S2AA 1VZ8A 3NACL 2H89B 3JBG7 2EKIA 2Q2LA 4BUHA 4GTTA 4BAXA 3GGWA 3CN3A 3L54A 1XIWA 1JGLL 2XWJA 3BIKB 3UTOA 2JXTA 2YHCA 2C9WB 4QHLB 3LPWA 1AZVA 2IOOA 3NPSC 1JPTH 4NLAA 4QHNA 2FEZA 1JCQA 4QDGA 2IO1B 1LQSR 2HFTA 3HBPA 1H8SA 2NYYD 4Z0BL 4JO2L 1AZNA 4MS8D 4OQTL 1BAGA 3GXMA 5HI7A 3IDMB 1HXIA 5K9KB 3EJCA 1VACB 3QG7H 4JR9L 4ZRGA 3ZX1A 1DCLA 1W72H 4OZIA 1YQ4B 5DC4B 3PGFL 3CDZA 4M6AA 5DRNB 3JUYA 1LEIA 4HSCX 3ZE0B 1JWUD 5DRZB 2O6VD 4EIUA 3AVEA 2YA1A 5L0QB 4HJGA 4XNQB 3ZTJH 4R8WL 5ISZE 3S96A 3GINA 3HCVB 4OLZL 4XMUA 4YLCA 1TKGA 2VMDA 4RVBA 1RZGB 2X2IA 1A2YA 4FJZA 1M7DB 2RACA 3QK0A 3GXDA 4G6ML 2BSDA 3RCZA 1J8HB 1M6OB 5LB1A 4APQA 3WALA 4ZHBA 1RUKH 1IHBA 1KTDA 1U42A 1ZLWH 3T65B 2GK0B 2MJ3A 1JXFA 2IFFH 1Z0MA 5CHFA 2JKIS 3REVA 3H4FA 2WVVB 4NHUA 5T5NG 3RRUA 3GIVA 2UZXB 4I1MA 3FQNA 1EJOL 2J4BA 2YEPB 2P9PG 2JJSC 2AC0A 2BY0A 1CZPA 1CGWA 3MBEB 1T1WA 3MREA 1PLGL 5CJOH 2CUHA 4WHYH 3GSNA 3BMVA 2YD9A 4HEA1 2XTJC 1FDLH 4TNVF 3STZB 1SIFA 2PLPA 4M1DL 2VO5A 2OVFA 3GK8L 4BFRA 5AWNH 1KT2B 4YHNA 4ZSOA 4O1PA 4P0DA 3B9KD 1BQLL 2WX1A 2BP0A 4FADA 2VDPL 5H94B 4PREA 4K7FA 2O5ZL 3J7HA 5JXAL 3ARED 3OC8A 3D4CA 2C1OA 4W9JC 4AS1A 4F20A 5J9PA 4NUJA 2GUOB 1IQUA 2G75B 4Y4KB 4QD2E 5BYRA 3LXBA 2IDTA 4YHLL 3UJTL 5IOPA 3TCAA 1DANT 2DQJL 4R2GD 4PGEB 1FLRH 3IMBA 4WJPA 1HWHB 5BZXA 1E5CA 3KYKH 5KYNA 1VZ6A 4PLJD 1BMLC 3PE4A 2FQEA 4PV9B 3VG0L 2H1PH 4FKHA 2LASA 4MRUA 4BFOA 5ANLA 5B38B 5FTPA 1YNTE 4Q89A 3QWOA 5ENRD 3CK9A 3HPLA 3HG5A 4U2YA 4JPQA 3MV8E 4ZQKA 5IJBC 1HL4A 2LUMA 2ARJA 4YHPB 1HHJA 1A22B 1YY8B 1MCOH 5LCVH 5FOBA 1CLZH 3NVZA 1DBAL 3PABB 3FF7A 3JUIA 3L3OB 3W9EB 3KXFD 4QHUB 1EAJA 5DMGC 2R29H 2PLTA 3ATEA 3QQDA 4AEFA 2MFNA 3EZ8A 4FF9A 1T83C 2Q1EA 1A7BA 4OLYH 3UTTA 1K53A 1ZS2A 2ASQA 2AEHA 5JOFA 3QUZC 4KKRA 5I0VA 1ES0A 4QIRA 3UQ3A 1MJ8L 1EO6A 4AQ7A 4YGVB 5E7BA 4AH2B 4MGXA 4M4PA 3GZQA 4PJFF 2NXYB 4AMKL 3RJVA 2FSEA 1ZGLP 4AUYA 1SQ2N 1ADQA 5IP4A 1VZ7A 1FYHB 4ZG1A 2DNFA 3C3OA 4LNGA 4ACTA 4GN1A 3HC0A 2GHWB 1DDHA 4WEEA 5DFVD 2WNGA 3QEQE 3OR6A 2JKRM 2KDYA 4XNZC 5GXGB 2IVFC 1QBLH 2NY6B 1ZK5A 5H2BB 3ETBF 3WIFB 4ZZFA 3C5JB 2EUZA 1IUEA 2DENB 3AEEB 4PJXB 4BXSV 4ZFGH 3RP1A 2R2LA 2R1YA 2EIKE 3RO3A 3BUPA 5F7FA 2OYPA 2DQMA 4N5QA 4BY6A 4UTAL 2IV8A 3S3BB 3T2NL 2B1AL 3BEEA 4GRWH 4KDVA 4GUPB 4YNYB 3C09C 4HKXA 4LSQH 4LCDE 4EBQH 3AXLB 4WHCA 3LVRE 2WQHA 3VH3B 3A4SC 4PJGB 5L8JB 1BFTA 1NMCB 1UYWL 3NJHA 2PYFA 5C09B 4KX6B 1JZFA 2DJUA 5IHBA 5I4DA 2OTUB 1WWWX 5DRWA 4ONFL 1E4HA 5ICZB 2KDBA 1ZOYB 5CHVC 3DOHA 2FIKB 1NFIA 3SDXF 5C0RL 3FUDA 4FTVE 5EZIL 1XGUB 3MJ7A 4XI5C 4M43H 3G9VA 2FJUB 3Q8CA 4NC2B 3RN9C 2ZYRA 5D7IA 5GZOD 3ZDYF 1A0QL 2JFCA 5ALCL 1IGJA 2R1WB 3BEVB 5ANMA 4LNIA 2IH1A 3B56A 2H1LM 3CC5A 2X2JA 2X0UA 4I9WD 3GTNA 3HI1A 1DQJB 4E9TA 2W65B 3UTQB 4MD4B 4KDWA 4OSUL 3VD7A 3LB6D 3Q2WA 3MV7E 3DXAE 5B3JE 1JMLA 3P3SA 4M6OL 2KXPC 5CRVA 1STEA 4TXQA 4QYOA 5JW4R 5KVDL 2Z91A 1LEGB 4AQAB 2MQCA 4NRXB 3CBRA 1YMMB 3RPIA 4ZAKB 4WDIB 5IT2L 4PQXA 1S1QB 3L6AA 3L5JA 5FZRA 1E6OL 4HLJA 3FRPB 3ZT5A 1R5IA 2IH3A 4Z0BH 3PG2A 5C0AA 3V6ZA 4QRPA 3VFGH 5JW4N 1RJZA 4I3SL 3T2QA 4FYQA 1SF5A 3FTZA 3GZ1A 1PEZA 3KWTA 3AW5A 2X4SB 5I1HH 2XN1A 2IO3B 4YSYB 1LMIA 1J9SA 5C07E 1G87A 1DZBA 1I1AD 3IAS1 3KPQB 3CH1B 5CJ8A 4JFZH 5DJDB 5D1ZB 2OX5B 4XAKE 3F6IA 3AKLA 4LVNC 4Y1AA 1KBWA 1KXQE 3L22A 3QA3B 4X7SH 4NRYB 3VJ6B 1QSVA 2NPLX 2CLVB 4GSRA 4P99A 4X2UA 2H6UA 4ZUVB 5AB9A 5C0CA 2ZX6A 3WY2A 1EZVY 4DUXA 4X8XA 3HG0A 4Z7UB 5F3FA 3ONSA 2IH3B 3ZL1A 1OT4A 2VXSH 2APFA 5HVHC 5D96B 4LNRA 3DUHA 1WHPA 1AR1D 1FN4A 5E4EC 4DKEH 2WLLA 1R5VB 4YQXH 4CC0A 1S78D 2QQLL 2ZOUA 4P5TB 3NDZE 5LN8A 3GJEA 3L3IA 1ZXKA 1ZW7A 1IQWL 1ZKAA 15C8H 2PTLA 3FAXA 3MNWA 1O5DT 5E6SB 3UTQA 1ORQB 1RURL 3R19A 2YGQA 1JK9B 3GMRB 4D9LL 2IH1B 5ANMB 4U1IA 2AJVH 2OMUB 1FZJA 1RZJH 1QHOA 4ETYA 4Z3FA 5FWRA 1PLGH 5CJOL 2F61A 5B3SB 3DV6A 3V52H 2OL3L 4I17A 4YXDB 2EDOA 4H20H 3MJ9H 4Y2NA 5G2NA 1I9IH 2BP8B 4F2ME 1XEDA 2HN7A 2JXMB 3HZKB 3TF4A 4WJQA 4Y4KD 4AG4L 3ULYA 2EYTA 2WQUA 5ICZA 1FL6B 5DYOB 1UKQA 5ECGA 4X5WA 4E9VA 3W56A 2QTVA 2Z59B 2RFXA 2DQGL 2WWZA 2JWZA 1L5PA 5HYSB 2M26A 2H3KA 3ASFA 1FGNL 3B37A 2B20A 2VR9A 2EMSA 3CPUA 4MHHG 3VXSA 4YL8A 5DEFA 1BI7B 2EVGA 5JORA 3K0YA 2HRGA 4YFDB 1KB5L 4XC3H 3ZZ1A 2XY1A 3C98A 4UM8B 4UINH 5ID1A 4QY8B 1XIWC 3DJZA 4R3SB 5T1DH 4DI3A 1U58B 1AN8A 2F53A 4N3BA 5FM4A 4A3VA 2Q20A 3IFPB 5HYJB 4CN6A 4MZIA 4Y1AE 2V8LA 3MJ9L 4RGMB 5CF3A 3QG6B 1U95B 3DECA 3Q6GH 4TTDC 1ET6A 5FO7A 3W5UB 1F58H 5I73C 4MBOA 4QGYA 5J6GB 1OWRM 4B60A 3WN5C 1F90L 4ILDA 5C0CE 3UCQA 1DSFL 1ROCA 5AOKA 4XP9H 2P8MB 2QEJA 3FT3B 1II4E 3K2UH 5EPMA 3O65B 3EDDA 3EHQA 4MMZA 2BPSA 2N9XA 3VNYA 3AEDB 1KPVA 2A74C 3PXLA 4JGNA 3NQPA 1HKLL 3QCUL 4U1GC 4UQIM 1MW3A 1EWCA 1MIML 4HXDA 1EXUB 1CQKA 3CX2A 3SFXA 5KYXA 2DYOA 2CLRA 1ES0B 1J86A 2O5XH 3DXMG 1BAFL 4F7EA 3PO0A 4KIKA 2M56B 4OHJA 4NWTH 3VRAB 5GS0L 1MEXL 1YEJH 5LAXB 1SGHA 1NL0L 4R5XA 4NHCL 1F3RB 2OL3B 2UUDK 3KYNB 3MUY1 5ESVA 4IKLA 1LO5A 3NJXA 2ZAGA 1JNHB 2IDFA 5HQ8A 3RPFC 1PS3A 2VCOA 4H8WH 3VTUA 4NN6C 1FNGA 4FFTA 1QQDA 5INDB 1KBBA 1WF5A 5CEXA 2GRIA 1TLMA 3IDNB 4F24A 3LRSB 4WTXA 4FNLH 5T3ZD 3UI3A 4BZ2A 2K3TA 3ZNGC 1QKZL 2AQ2A 2JB6B 3LRSA 3K6SA 1YJJA 3GUTB 5JIKA 3CGTA 1IKND 3ZUNA 3ULQA 1MRCL 2EXTA 4NN7C 3SPGA 2WMOA 1SJHD 1BW8A 5C6PB 3TPUB 4L8BB 1KIUA 2VLKD 1A6TA 1OP4A 4MJIE 3AU0A 5GJTH 4OJCA 1H4RA 3WANA 3HVZA 3MV9D 1KGUA 1NGQH 3KHQA 1IBXA 1CFTB 1A6PA 4NM4L 3V4UL 3Q05A 1ZCRA 3H85A 1NDMB 2DQEL 4IC7B 3ZE2E 4RMRA 4P59H 1V1PA 4MJIB 3BD5A 4A2DA 1KLGD 1G1YA 4P5TD 4A37A 4DO5A 4WNJA 1K8KG 3WHXB 4G26A 4I5BA 3ZTNL 2C0MA 6PAZA 4PREB 4LUNU 4N58A 4CYEA 4HUVB 4RCAA 5EOTB 1I8MB 2BW2A 3ROLB 5HI3D 2M0XA 4I89A 2D4FA 3EOYG 4XPAL 1PIGA 1VB9A 5I6XC 1O6TA 2N9KA 3K4DA 2W88A 3A9KA 3OSKA 3E33A 2JT4B 2FCMA 1EGJH 3IFPA 5GRYA 2GTQA 1WS7A 3EOTH 3KUCB 3RBSA 4X4YB 5DJ6A 3FULA 3D06A 1ZHLB 1OCRB 4TNWF 3MROA 1G7IA 5C23A 1TOXA 4GY4A 2IOIA 2CO2A 2VLJE 4ZMQA 2VGYA 1NKGA 1QTYT 2BSTA 3DROA 4XVJH 4FERA 1OUVA 1O5PA 3REVB 3WNOA 2LUEA 3LY8A 4U0QB 3RUGA 5DWPA 4IW0A 3SBRA 3S37H 3IG3A 1O75A 4JGUA 2CIIA 4LBEA 4HKJA 2YPKA 2APWA 5EUKB 3VDCA 4NAWB 5D72L 3MOQA 1G9ML 3CU7A 3A0OA 1CTNA 5EO0A 5F1IB 5GGQH 3L3JB 4RRPG 3WJMA 3WAPA 3HZKA 2JE8A 5E23A 4ZYNA 4NKDA 1WSPA 2MW5A 1HZKA 1MHXA 1P5UC 1ODUA 4P5KA 2CBMA 3RB5A 4KKPA 5KSVB 4JZOB 3ASOE 4WHTB 2MRIA 4QI3A 2K4WA 2AJXL 2CMRL 1LE5B 2Z1PA 4FTVD 4IIQB 5BMFH 4FZEH 2PW9A 4N6QA 2M1MA 1YQVH 3CLEL 3DRTB 1OT8A 2BRRH 3F5WB 4X99A 4EI5A 1JZ8A 4JG5A 1RPUA 2M63A 3IKCB 3UFIA 4G7VH 1DVQA 2V5SA 2Y5BB 5D71L 2GJZA 4UDTA 1GY1A 3O2DA 4PGDB 4RGNB 1AS8A 1UXWB 3R8BB 1IBDA 4BUGA 4WO4A 3L4CA 4GKZA 3FUNA 4X0KA 2ERJB 2G0KA 3OHXC 4NQVA 1R5VA 1F6LL 3Q5YA 3VXNA 2MBBB 4OF0A 1JPFA 5FCUH 3KSQA 3FQ1A 3BUAA 2JMRA 3ULVE 4FFZL 3SQOL 1L3WA 2I9LA 4I13B 3QQ9D 4LSVL 1HCVA 2EVIA 5BXFB 1KGCE 1UWFA 4YAQA 1DVFA 3BZFA 1LO3H 1I7TA 1IV8A 4NCC1 2ONQA 1YYLH 2R4RH 1AQKH 5C0CB 5HHOB 2NSXA 2W0PA 3HAEB 2Y5PA 3Q7FA 4YVQC 4APOA 5FZSA 1CC3A 3HZYA 4EI6B 1KYUA 1I42A 4M5TA 4YTMB 1B6UA 3GB7A 3HE7A 2B08A 4B0MB 3ESLA 5AVVB 1AQMA 4HOQA 3W9FA 2OMWB 2YD8A 2IMNA 2EYSB 2P9IG 1MXGA 3H9YA 3NIDB 3Q01A 5KBAA 4X5LA 2C2LA 2FWOB 2LZ6A 2B15A 1OWPA 2EO1A 4IOSD 2QSQA 2KN4A 1HX0A 4WI3A 3GSNL 3I3EA 5TDOB 2NPTA 3PDDA 3VXUB 3RTQB 4AY5A 2UZYB 4JHAH 5DO2D 1HSBB 3EDEA 1EDUA 4M48H 1Y6IA 3R66C 4S1DC 4F37F 2FK9A 1WWTA 3T3PE 4QRPB 2IZVB 1JF5A 2JABA 4NQED 1EMTH 4M9PA 1WT5C 5B22A 5CU9A 1N5AA 4DKTA 5TE6L 2A5UA 2LRWA 5CEAA 2P5WD 3S97C 1FIEA 1OSZA 1KJ3L 4NENA 4JKNA 5DQ9B 5I1LB 2AQ3A 4NRXA 1IRAY 3SF4A 2Y4TA 1LEGA 4OB5L 3V5DA 2FSDA 2NQ3A 1K5WA 4HFWA 2KCKA 4WWOA 2IAND 4U6XB 3C60A 3PL6D 4P2RA 3HNSL 3ZT6A 1WH0A 4GRLA 2EDMA 4OAWB 4IRJC 3L4UA 5CO1A 1S7SA 3CEQA 3LXCA 4E9SA 1RL1A 2ADGB 4FMKA 4KNTA 1H3GA 2P26A 3HZYB 3M1BB 3P73B 1P7BA 1E9QA 2OA9A 3BP5B 3LS4L 2ZKXA 4I87A 4GAYA 4XPTH 1NGYB 2AQ1A 3ABVB 4MXWH 3EU9A 4DUIA 1NLDL 4PI2A 4B9YA 2ZCZA 3ZXRA 1QI4A 1L4ZB 1IJ9A 3MR9B 5BXUA 4KHTH 4BHUA 3H9SE 2XX1A 2EUWA 2CALA 2ZPKH 2EDDA 4G2VA 2FIKA 3C6LD 1KWGA 1RZJC 4F8PA 2X6UA 4QRRD 4RCOA 3QP3A 1WXMA 4D10C 3K71B 1BHGA 4B9KC 4NQVB 1QFOA 2OMVA 1UENA 3SPHA 4B41A 2BYEA 3G08A 3TBVB 5KANI 5D7LE 1F3DH 2F6AA 1C5CH 5J1AA 2A5EA 3DSSA 2JKNA 3FNKA 4JFFD 5FECA 2GSIA 3WAKA 4C7ZA 4YLQT 1D5MA 4YBLC 2BOBB 1MJUL 1FYTD 4ZPVB 1FNHA 1AP7A 3CFKB 3UTSD 4OFYD 5B1JA 1YMPA 3ASNE 4DN3H 4NJAH 1Q38A 3C5JA 1IB5A 3BCDA 3V0VB 2BY1A 3KL0A 4J7RA 3AGVA 2J1ZA 3TV8A 3DPDA 3M88A 4QAWA 4LJPB 3MRBA 1RIVH 3F01A 4PCYA 4PG9B 2BYVE 4XCEB 5B1CA 5H37H 4YSAA 2PETA 4TNWK 2FB4H 2X4RB 4NGHL 1F9JA 4HKJB 4MZRA 3OJ4B 5DD5L 3SDAC 4JX1C 5EDXA 3S7FA 3VXOB 3NTCH 4PU2A 3QNZB 2Z65C 1JPGB 1NCHA 3UTTB 3SE3A 4C4KT 4M3KB 2FT8A 1N8OE 3AQXA 2XPYA 4MCNA 5CGYD 2WZPD 3UIYA 1EHLH 1ZPLA 2KANA 4RFBA 2MQGA 5D2NC 3QZBA 4LCTA 3HZMB 3H3PH 2UWEA 4I18B 3FMGH 1G7QB 2YBGA 3RAUA 3RB7A 3PVLA 3TVMC 3LKPA 3SE9H 1HHJB 2VKWA 4R83A 3MOBL 1UB5A 2ZCBA 3B2UD 3SY0A 3WL9B 2WKOA 1BXUA 4QRSA 4POYA 3S3CB 3PUCA 1KB9J 5FUOH 3N41F 5KJRL 1D5BA 1AZRA 2G30A 3KPRB 3FYIB 3BCFA 1R9FA 2WDTB 2B1OA 1P4BH 1EHAA 3BP4B 3T0WA 5MEOA 4NJ9L 4DOHE 2WM0A 1I9JH 2JXXA 1CFNB 2NLJA 5EDSA 2DYSE 1JMXA 3II3A 4OGAC 4U1LB 1VSCA 2QPEB 3RIAF 3RQ3A 4OT1H 2X44D 4PJ5E 2Z4QA 3QPQD 1NH6A 4IMKC 4UQ9A 5E8OB 4TOYH 4Z5RB 5IESH 4ZOBA 5IQMA 1T80A 2Y7MA 2NY2D 1QVOA 1TZIB 3IGFA 2FGWL 2B8OT 4G7QB 4JQXC 1Q1PA 4BZ1L 3T2LA 1TJMA 4NO2A 3ZRCA 1UD8A 4KI5C 4M02A 3UIZA 1ZMYA 4WFGE 3N0PB 4K3GA 3A9JA 4K3BA 4H0LC 4JHBA 3MV8B 5ENTD 1SN0A 3QH3A 1T3FB 2EJ1A 1K8IB 2VXQL 4ODUB 5F7EL 1YN5A 1AXTH 4LMQE 1NI2A 3ES6B 2VSDA 4GKOA 1LO5B 4LEXL 4U7SA 3ZJAA 4MJ5B 2X70B 1RZIB 4P5TC 2O61B 5GGVH 5CZVH 3BUYB 2LXCA 1EIBA 2FQFA 3P77B 3TGXA 1QEXA 1WV7T 2CPCA 3PJLA 5JR1H 3VWJD 5JMOC 4KIKB 1P6WA 4QRRB 5JDSA 3Q2VA 3OZ9H 4LLYA 3SZ7A 1E6JH 1XF4B 2GK0A 3VI4A 2Z34A 3CFEA 4LLVB 3BOVA 3D6GA 4MA3B 2J4WH 3MV01 4BE5A 1LFDA 2QC8A 2OSYA 4AGLA 1RZGA 2Z0BA 3RWFB 3ZT7A 3AU5A 5SWSE 4HGMA 3RAJH 2EELA 4XCFH 1UJ3B 4JREB 3PRMB 4ZW8A 3QEQB 4DP8X 4CRWA 1KB5B 3FU6A 4U95D 2IWFA 2G2PA 4TSAH 1UT1A 3FQRA 5ADPL 4BVUC 5AZEH 4BZ1A 1N54A 4HIJB 2P1YA 2HUEA 3I6GB 4X5QA 3ZDXB 3N9GH 2CD0A 1N2RA 1S7TA 1ZGLA 4JZNB 1USZA 4ZUSB 5J13C 2GOWA 1N4RA 1SZ9A 3NSFA 1TY0A 2UWJG 1D5XB 4P23B 3S35X 4QHLA 5TR5A 3O0LA 1I8IB 3CHPA 3X3GL 4X5WB 1NFAA 3CVHH 4JO8A 4XVOA 2Z6FA 3R9MA 3JV4B 7FABH 2OMTB 2XG4A 4N8UA 3U1SH 3QX1A 3OGCA 3HUJE 2ZWZA 4FZ8L 2JXMA 2KDFB 1IJNA 1ENFA 3D9OA 2CLZA 3FY4A 1NAML 3FBKA 2AEOA 3FOLA 4OZHA 1YC8A 5T3XD 1S7QB 1USQA 4KXDA 3RL2B 3ECQA 5GRUH 4AYDC 4BKLA 3X23A 3QORC 4BCYA 3ARDB 1EDHA 1W91A 4K07A 4OD2A 5ERWB 2D73A 3OXLA 3MA7B 5C0EA 1JYXA 4PFEA 4H25B 3D9IA 4GKSB 1X7TA 2VDKL 1V7NH 1BGXL 3MNWB 3TEYA 3W1SC 5JPMB 4A20A 4X0NA 5KHQA 4FHJA 4RFEB 2EDLA 2WBWB 4MD0A 4Y5YC 5DEZA 2JELL 1G6RB 5D6DA 1J0GA 1V81A 4GTPA 2OR9H 4F1SA 2IBZX 4DP6X 2Q86B 2BVPB 3AE9B 1GMEA 1UA7A 3RA7H 3R9AB 1GYCA 2SODB 4G8AC 4PBWD 2BSSB 1OSYA 5C8JB 2Z0EB 3LKQA 4NACA 5I1GH 3IPEA 4MTMA 1HOCA 1ZUD2 2E7LC 3NJKA 3CKCA 1DUYA 5CIPB 3RGHA 5IMOB 5D66A 4EKUA 3GJFA 3QC1A 5AUMA 2KX0A 2QGEA 1IYGA 1YQBA 2QADD 5EU5B 3S3PA 4Z7OB 3S36L 1S3SG 4BK5C 3A4FA 3CVCA 3U82B 4YO0B 3P02A 4HYTB 3AWGA 3QA3A 2JNZA 2O6EA 4JN2A 4RMAA 1HILB 4GKNA 2MH4A 1I4HA 1KGYE 4MLSA 4FQXC 2EINE 4O2FB 2VQUA 4J8RB 3U9PH 1G7HA 1FUNA 1M7UA 2AJXH 1U8PA 3N32A 2IPTH 2XWCA 3GLDA 3DTXB 4ZPTA 4ZTEA 3F12A 1MJJB 3HC3H 4WEBL 4L1DA 1MHEA 3C3RA 3RRMB 3CLFH 3I50H 4H88H 2HFGH 4I43A 5AVXB 3QUMB 4TKNA 4HBDA 3RWJB 3SGDI 2B3RA 1KLXA 2BNRB 3B34A 2MJEA 3T6ZA 3UDWA 4C83B 4LRZA 3KGRA 1WG0A 2I60H 3QEHA 3X12A 3LN5A 4YPGB 2IAAC 3QFDB 1Z9SB 4JO4H 3QPXH 3DVNB 4ZMNA 4WDIA 4IOIB 3RVVC 3VXMA 1SLUA 4KDTA 2WCPA 3WJJA 4GA2A 3RY5A 4MJSB 4N0FA 1KZPA 1IKFH 2XVLA 4AE0A 4HOUA 2CXGA 1XGPB 2D7TL 2VMFA 3GIZH 4JQXA 4LKCA 2IGGA 2W65A 3KLSX 4J4PD 4OF3A 4IKKA 1HE8A 1B2WL 3NMEA 4PTUA 4ZNEA 2X4TB 3CFCL 1BEYH 2GI9A 4ZTOL 5E76A 2W92A 1HINL 4H7XA 5H92C 1Z1WA 4XPFL 4Y8DC 4XMLL 5ADOH 4DTGL 1T2QL 2R4RL 3L1GA 4UILH 3WTYA 4ELDA 4ISVB 2IAMC 5C6TL 2VDRH 4WEMB 4LTUA 1NFDF 3I3NA 2W9EL 1R7SA 2KXJA 1PQZA 3FEYA 5LNK1 1SY6H 1HNYA 4LDLB 4M93B 2Y4SA 4KZEL 2Y5TB 1R4NB 2J2ZB 2F8XC 3FH7A 3VXRB 1G7JA 4LAQL 1QYGH 1J8RA 2ICWI 1MQKL 2X3MA 1HQ4B 1UWEH 3OXGA 4KRPC 3DVGX 4YX2L