2NXPA

Structure of ntd2 domain of the human taf5 subunit of tfiid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
149
structure length
149
Chain Sequence
QPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription initiation factor TFIID subunit 5
publication title Structural analysis and dimerization potential of the human TAF5 subunit of TFIID.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nxpA00
2J4BA 2NXPA 2J49A
chains in the Genus database with same CATH superfamily
3R7QA 5C2YA 2KC7A 3BQOA 3FH7A 4JVSA 3RIBA 1TN7A 3RJVA 3FTYA 4AJWA 2MRIA 2V5FA 2ZIRA 1NA3A 4UI9K 4AY6A 1E90A 2R59A 4IRUA 3PE3A 3ULEG 1N0QA 5B3SE 2H6FA 1TN6A 2C0MA 4WNFA 3TJPA 3KEZA 4GTRA 1NL4A 3KEAA 3G2UA 3B7RL 4FJYA 2PQNA 4EZJA 1GW6A 1S70B 4LG6A 4J8YA 3E34A 4HORA 3CQGB 2XZDG 5CMYA 3U9WA 1AWCB 1IKND 3QWWA 3ZNGA 4NURA 1U3DA 3CVUA 1QYMA 4I9CA 1PC2A 5IY5E 4LEUA 4Y6WA 2GRLA 2XHEA 2XS1A 3NQPA 3D9OA 4EPZA 3MKRA 4NACA 1OCCE 4JXTA 3C98A 1YYHA 4I1OB 2XENA 3PZDA 2GW1A 3Q4AB 4HS2A 4OAVB 1S64A 3FUEA 2M63A 3QJZA 2CFZA 2IF4A 5CECB 3GW4A 1UOHA 4CDMA 4IULA 1N94A 2X6IA 2WVIA 4BFRA 4O1OA 2XZTG 3SF4A 3G2VA 4LRZA 2KCKA 5KNGA 3Q73A 2Y4UA 4EZLA 3APCA 5B1BE 1FT2A 3KS2A 4WNDA 3JUIA 3D3MA 2I1JA 3AJIA 4C0EA 1EPUA 3ZHEB 3VTXA 3EHNA 2VSOE 3UIOC 4ATZD 2Y0BG 1D9SA 2IOLA 4RSYA 2AXVA 2WXLA 1E8ZA 5FIOA 3FUIA 4DX7D 4U0ZA 2WXGA 4GU5A 1U2VG 3SY2A 1WAO1 3BU8A 2GGFA 3E37A 3LVRE 2VQ2A 3TWSA 5JHBA 4Q96A 2WXHA 1E8YA 4GTOA 1K8KG 3V31A 4CGWA 2XPZA 3PREA 4HLEA 2OV8A 2NXPA 5CEAA 4HOQA 2XEHA 1OCOE 2X6HA 4I2ZA 3R9MA 5BXUA 4C0MA 3DSUA 3IKOB 4GCOA 2CHZA 4KYOB 5C1DA 3L17A 2IFUA 4BERA 3ZUVB 2FBNA 1A5EA 4U7EB 3I4RB 5EDSA 2LXMA 3I5PA 2XCCA 1O1SA 3ASFA 4BTAA 2LAHA 3D9KA 1OXJA 3IHYA 2WB2A 1Z6TA 4AV7A 5BNWA 2LXLA 4ZFHA 5KBAA 4LCTA 3AU5A 3QAQA 2AXUA 3ZIMA 3X2QE 4HXIA 1XNFA 3TWTA 4B8AA 1TNUA 2EINE 3BEEA 1TNBA 4TUUA 1NZNA 2OVBA 4IYPA 2OEVA 4GA2A 3QOUA 4GPKA 5A23A 4HI8A 4F3VA 4B89A 3DRAA 3NAWA 2J09A 2MHKA 3E30A 1DCEA 5KWDA 2KBXA 3L13A 4YNDA 2VGEA 1BPOA 5CRVA 1H6PA 4G26A 3TAXA 4RQIA 2OVFA 4BSXA 4HNAD 3UMVA 2XRYA 1UJJA 3L82A 3V2XA 4HQDA 3CHSA 3AS5A 1EYHA 5FQ8A 1B89A 3CHOA 1INZA 3SBSA 3IHVA 2IY0C 5KJKA 3L16A 5ENNA 2KZTB 3U64A 3RRMB 3APFA 3CVQA 5D66A 3Q79A 4N3AA 3PZ4A 3URZA 1BU9A 1X81A 3QWVA 2YHCA 3FTUA 3OTNA 3DWLG 5ARFA 3CLJA 1PY1A 4XKBA 4G11A 4KVOA 5FZRA 1DCQA 3FU0A 3V2OA 4U0SA 5FTPA 5BUZA 3ZXPA 5EYLA 5HQ8A 1JCSA 5AARA 3DPYA 3FULA 3D9NA 2L6BA 4GAAA 1Y6IA 4FULA 5A7DB 4CCAA 3UUXA 4P29A 3MKQB 3S7BA 2NYJA 3FTWA 3Q9NC 1PAQA 4DX6D 3GZ2A 5JJ7A 1SA4A 3LY9A 1IQUA 3RKVA 4FP7A 5T8IA 2DCPA 3FEXA 3Q47B 4JL0A 4U07A 1FVHA 1YMPA 3B7BA 1WDYA 3HXDA 5D0OD 3UM1A 4BX9A 1RZ4A 2JLBA 2X3MA 3CVXA 2P9NG 3ENEA 3DBSA 5G04J 4U8YD 4A3VA 2J08A 4CGVA 4WWNA 4MKTA 5FT9A 3K9IA 4TXRA 3R9AB 3Q78A 5FZQA 4F6RD 3QNKA 5AENA 4CRWA 5AJDA 2LO6A 1UW4B 2J8SD 3LPZA 3TWWA 4G1TA 5DBKA 1QNFA 3TWVA 2L9BA 4GYWA 2WXKA 4LSZE 2WXOA 2IEJA 4CEMA 4PH4B 4KT6B 5AAOA 3ASHA 1JCQA 2J07A 4J8EA 4Q69A 4UQYA 5ANLA 3EIJA 3V79K 5LOZA 3QB2A 2QC9A 3JUEA 2FO1E 4CYMD 4HB5A 3ZYQA 1DC2A 4DX2A 4K5AB 3U3WA 4BTBA 2R2LA 4U96D 3ONKA 1ZB1A 4FHJA 4GTSA 3ABKE 4APOA 2AW6A 4U95D 2VJ8A 3SD5A 2BKKB 2WXRA 4LNGA 3LXUX 4KXKB 3GZ1A 2HR2A 5CERB 1YCSB 4O1PA 4XKCA 1TYQG 4L23A 3RO3A 1OWOA 3S7FA 2BUGA 2QFCA 3JQ1A 3L6AA 3CV0A 4B8CB 1H6OA 4I43A 3UT7A 2WPVA 3BUAA 3JCKC 3UQ3A 4XX5A 5ITZF 2VGXB 3LKUA 3ZYMA 4L1BA 5LFAA 3AS8A 3F6QA 3O48A 5AQAA 2GRMA 2JABA 2HM8A 1Z3XA 2P9UG 3N71A 2ETBA 5D2MC 5BW8C 1NI1A 3CKBA 3FWVA 1BLXB 4L7TA 1Y8MA 2A4ZA 4PUCA 4OVUA 4TXQA 5J08A 2GRQB 3HRAA 4UQZA 4N3CA 1N52A 4Z68A 1V54E 3T5VA 2J49A 1D8DA 1AP7A 3C72A 2R05A 3ABLE 4DX1A 2WXFA 3UM3A 2JEKA 1HXIA 3CVWA 4JA9A 2R17C 3WXXA 1E8XA 3J5PA 2IO3C 1OWMA 4HVBA 3AG2E 3C3QA 2BKGA 1LD8A 4MLPA 2XS8A 1BI7B 3E33A 2V4LA 3BG1B 3SNXA 2NC9A 4BETA 4B93B 4MRUA 2PNNA 3ZU7B 2P9LG 5BV0A 2HO1A 2ZGDA 4B0ZA 3Q7FA 3KD7A 1BI8B 2P9PG 5FJYA 4H7YA 3ZHEA 2YNQA 3FTZA 4LNBA 3ML9A 3TG5A 4ILIA 4GTMA 3NBNB 1SA5A 3UTMA 1K1BA 3ZPJA 4CT0A 4XI0A 3EDTB 1ZU2A 2V0PA 4U0UA 1HG2A 3CSFA 3T8KA 4RG9A 4GA1A 5AQ9A 1UG3A 2H6IA 2PL2A 3NOCD 3PS6A 2XQ0A 2FO7A 2X6JA 5A6CA 2YHEA 1LF8A 3HDXA 3D9MA 5CCLA 2LSVA 3C3OA 3JXIA 4JPSA 3TWQA 2OCCE 3J5QB 3ZYKA 4JA7A 2LUHA 1WG0A 2EIKE 1S0PA 4WWOA 3PZ1A 5G05J 2C0LA 2YQ8A 1SQMA 1N4PA 3DSWA 5ARGA 3W9GA 3IXEA 4XEIG 4GYOA 4UWKA 3G2WA 2Y4TA 4HRLA 2XPYA 4EBAG 2Q7FA 4UWLA 4I6JA 5KCMA 1WM5A 4FC8A 3Q7AA 4ME2A 3DSXA 3TG4A 2RD0A 4A1SA 2IONA 3RO2A 2P9IG 1N0RA 3PNLB 4AEZC 3NZSA 1KZOA 3ONLA 2GROB 3SBTB 2WXJA 4FADA 4DX5D 1HG5A 3HXCA 4HBDA 3TWXA 4TUMA 4NIKA 2DZNA 1JUQA 2WXNA 2I6HA 5FQ7A 3D9JA 3VLFA 3V30A 5JJTA 5EIDA 5LP0A 2AXZA 3ASGA 4J7WA 5FZSA 3Q5MA 1H2VC 3Q75A 3APDA 2Y1LE 5CCMA 1P5QA 2RFAA 1HS6A 1UN8A 4G8LA 4J8FA 4I1MA 2R5SA 3LEWA 3P2BA 2J9QA 2P9KG 2I2OA 4M7CA 3CVYA 5G04C 5ANRA 3B13A 3UI2A 4HOSA 5EIBE 3HXEA 1RW2A 3MV2B 3S7DA 3CVNA 2HYZA 2XCBA 4M3OA 2LSUA 2VTBB 3IEGA 2WXPA 1MHQA 5G55A 3FU3A 2KZTA 4N2QA 1ELRA 2HE0A 4JHJA 1JCRA 1X5BA 3DEOA 3PZ3A 3TWRA 4WNEA 4APFA 4E6HA 3G2SA 1ELKA 1K1AA 1MX4A 2KCVA 1H0AA 5T4YA 2H6HA 3FUMA 5AJLA 3LJNA 1H2TC 3U4TA 2KM4A 2VSNA 3D9HA 5BPPA 5B1AE 4EBAA 3AG1E 2NSZA 4FLBA 1TNZA 3L08A 3T8MA 2AWIA 4ACKA 4GZ3A 1MX2A 3LY8A 3B7TA 1IHBA 3E32A 3FTVA 4BT8A 4HLLA 2H6GA 3MKQA 1MQSA 3FY4A 4FHKA 4DI4A 3AG4E 3E4BA 1L5JA 5BT1A 3FUFA 4UQXA 2OOEA 3SFZA 3LDZA 1BD8A 4UWHA 2DWZA 3FP3A 4GZ5A 4FLHA 3CHRA 3DSTA 5EX0A 1E96B 4XZ4A 1HH8A 4J6IA 4CDNA 1QZ2A 3DEPA 4Q94A 3TGOA 3GZSA 4KZ0A 1IYGA 1OWPA 3CHPA 4K5CA 3CSTA 4F53A 4W9RA 4JEUA 1FVFA 4G25A 3FUNA 1SVXA 2WQHA 4NRHB 3Q49B 3NOGD 2PM7A 4BX8A 1H6KA 3JQ0A 2ZXWE 3UT4A 5CEDB 4GZCA 1D8EA 3EHMA 3TWUA 5ENSD 2WXQA 2CFUA 1ELWA 3AS4A 1HZ4A 2F37A 2QYUA 5JJ6A 2Y69E 1N11A 2P58C 2WMNA 3FH5A 2X6FA 4ANWA 3NF1A 4K5BA 5EYPF 4KMOA 4YDWA 2WQ7A 3PDNA 2FF4A 4J0UA 2P9SG 2EIJE 4N5CA 2J4BA 4WAFA 5EN5D 3QWPA 3HG0D 3GYZA 4AY5A 1O1TA 3G2TA 1ZBPA 4A3TA 3TL5A 1O5MA 1MX6A 3NB2A 1DVPA 4JW1A 2X6KA 3ZW3A 3CK7A 1JWGA 4U63A 3PH0C 3OXLA 3Q9UC 3L9TA 1TJCA 1OWNA 4NQ0A 3DSVA 1E7VA 1H2UA 3SQVA 4AM9A 3IV0A 2ONDA 1KZPA 4XI9A 4FA6A 3HVEA 2FULA 4EHMA 3PUKA 2DIWA 4CDRA 2KCLA 4HOTA 5J90A 2ZU6B 3CEQA 1Z5SC 4LNUD 2CHXA 2I1KA 2VGXA 4G24A 4EZKA 2XEEA 3EU9A 4GTVA 3RSEG 2BEDA 3SFXA 2UY1A 4JD2G 1TNOA 3QKYA 3UM0A 2L0TB 2VSXE 4EECA 4F1PA 3ZN3A 1UN9A 2AJAA 2I9CA 2BF0X 3HVEB 5FQ6A 4ANUA 3ASDA 5JHAA 3ESKA 3S2AA 1A17A 3U66A 1N54A 2IU1A 2WMOA 1UJKA 4HOUA 5ENOD 3VLDA 3HYMB 1MYOA 3UKRG 2UY1B 5EKQD 2LNIA 4N3BA 3PE4A 4ACLA 1S63A 2XGSA 5E75A 2EQXA 5HKPA 4B94A 5G05C 2ILRA 3LY7A 2DBAA 2MOWA 3D9PA 3R7RA 4YDOA 3ZYLA 1QBQA 2ETCA 5DIZA 3UM2A 2VGYA 3ZKJA 3MCXA 4HRNA 4DJAA 1HU3A 4H7XA 4OVVA 1JWFA 3RRNB 4AP2A 4BEPA 2V8SE 4UI9J 4F1SA 3FUJA 2RG8A 1JPLA 3B7UX 3UIPC 4HI9A 1Q2ZA 1OY3D 3SFYA 3RK6A 3CVVA 3EU5A 3D9IA 3EUVA 4YVOA 3RU0A 1N95A 3HXFA 2RKKA 4BESA 4WNGA 2DVWA 3FUDA 5FWQA 3TXNA 4BWRA 3ASNE 4KVMA 3S7JA 3O4ZA 2J4DA 4BY6A 3PZ2A 1FPPA 2WQ6A 4DLQA 3UPVA 4TRQA 4I6GA 4J8DA 3MGBA 3QDNA 4RLYA 3CVPA 3KSLA 3ZGQA 3PUJA 4D10C 2RFMA 5M72A 1N4SA 3ZFWA 3C3RA 3FU6A 3ISMC 4C9BB 3SGHA 4WWPA 1NA0A 4GZ6A 1VDYA 1HE8A 1IXVA 4DK5A 3CQCB 1OCZE 2XGOA 3UKUG 5G2NA 4R7LA 2E2EA 3ABME 2ETAA 3ZVVA 2FEZA 2CG2A 3FUKA 4PS3A 4TV3A 3UINC 3ZRHA 3MYVA 3SZ7A 4HFGA 5BXOA 3UX4A 2XGMA 2A5UA 3ASOE 4JZYA 3MX3A 2CG3A 4YVQC 3EJNA 1XGWA 4I9EA 4GMJA 4GYYA 5CMWA 5AYWD 5HS0A 1HFAA 1KT1A 3KSQA 4G8KA 5JMND 3OXGA 3FFLA 1YA0A 4L9PA 2PM6A 3L22A 3CIAA 1DNPA 1FCHA 4I17A 4J8SA 2XRZA 2E0IA 4Y6CA 3HXBA 4GMRA 4QFVA 1KLXA 3SI5A 3T5XA 1HX8A 1LTXA 1H19A 3AU4A 5EX3A 5D0QD 1NFIE 1N4RA 3B7SA 4U8VD 3VLEA 2WM9A 4JHKA 3CKCA 5CBOA 5KJLA 2ZGGA 2Y3AA 3LVQE 3UT8A 1N9AA 4RVBA 5CRUA 2VTBA 4A63B 3DXMG 3FHEA 2QYJA 3FDHA 2C2LA 4O6FA 1QQEA 4AVXA 4XE0A 5KJMA 3MA5A 2F8YA 2V5QC 3L54A 2GRRB 2IOSA 4G2VA 4UWGA 4GA0A 3SHFA 3C5RA 4L2LA 2WXMA 4A55A 4ZHBA 3AAAC 4I2WA 4AXHA 4KZCA 1WY6A 2XEVA 1TJFA 2YINA 1NP7A 3BG0B 4I1AA 4LERA 4JB8P 4WUYA 2EILE 4PS8A 1E8WA 4YDYA 2AVPA 5HRYA 2R02A 3P1UA 3JYSA 1Z3YA 5AQ7A 1SZ9A 5T3RA 3MV3B 3MJWA 4ABNA 5BV1A 1OCRE 3VTYA 1HF8A 3T9KA 4U8HA 2R03A 4X8QA 5JA4D 1TNYA 4ATGA 3ULYA 3RAUA 2BTDA 2X38A 4N39A 5E76A 1FT1A 3AG3E 4O60A 3MEKA 5ENPD 1U3CA 2DZOA 3B95A 3I3NA 5CHEE 3FUHA 3TXMA 4MBGA 4PS7A 4BSZB 2KATA 2OEWA 2IJGX 2V4HC 3FEYA 3EHRA 4K03A 4URKA 2IQCA 4U04A 1IHGA 3OXFA 4GMLA 2UWJG 3ESLA 3JXJA 4K0RA 4DPRA 4IN3B 4LUNU 4MS6A 4RG6A 1OUVA 4GTTA 3EIQC 3FH8A 3CR3A 1W3BA 2F0YA 4YDEA 2GRPB 3SO8A 1MJ0A 4EQFA 3PRZA 2DYSE 2KXPC 4TXPA 4QQIA 3CGHA 1KT0A 2DYRE 4BT9A 5EILA 3W9FA 3HHMA 1OWLA 4AOFA 3QARA 2XPIA 2MYOA 2GRNB 1KPSB 5AN8A 2VSYA 4V3IA 1IQRA 5H7PA 5LCWC 3MZLB 4OAUC 3ZEFA 4XIFA 4I6EA 3QC1A 3IBEA 1O1RA 5ENRD 3UXGA 1E7UA 4JC8A 2L0IA 1SW6A 3CVLA 1TN8A 5HI7A 4N5QA 2LAIA 5ENTD 2QZAA 4FJZA 5AIJA 3LJ3A 4DUIA 4CZ2D 3CHMA 5FQ4A 3HIZA 4UUCA 4OYSA 3PEUB 4GTQA 3QK0A 3KAEA 4ILHB 1LD7A 1TEZA 3FTXA 1EDUA 2P2CP 2IO2C 1EF1C 2EIME 4UI9C 3DPDA 1MZCA 3LS8A 3LYAA 3RRUA 1TR4A 4GB9A 2PQRA 3I4GA 2FI7A 4A1GA 3ULQA 1V55E 3CK9A 4AIFA 5AQBA 1HO8A 3ZXSA 3LCAA 2L6JA 4JEHA 2F8XK 3D9LA 4F7AA 1SZAA 2VYIA 4GTPA 3CK8A 4GZDA 4GCNA 3FTSA 4E85A 4FU3A 5KNHD 3WG7E 4PDXA 3PEVB 5CBNA 3ML8A 1G3NB 4ANXA 4KBQA 4C48B 5FINA 4G23A 3Q15A 4ILGA 2PZIA 3EHQA 4JHRA 4UWFA 4ANVA 2B6CA 5LX8A 3DSSA 3NZUA 5KJNA 3DXKG 4GPMA 4DLOA 2WXIA 1OT8A 2QY7A 1K3ZD 2A5EA 5ENQD 4L2YA 4DRXE 4CT4A 3OAWA 2ZISA 4N2SA 3PVLA 3CHQA 5LCWJ 2B0OE 2CHWA 3PNTB 4DI3A 1N4QA 3FU5A 4HRMB
chains in the Genus database with same CATH topology
4FP7A 3R7QA 5C2YA 2KC7A 2DCPA 3FEXA 3Q47B 4JL0A 5ANRA 5T8IA 4U07A 3B13A 1FVHA 3FH7A 4JVSA 1HE8A 3RIBA 4HOSA 4DK5A 3CQCB 5D0OD 2XGOA 3MV2B 4BX9A 5G2NA 3S7DA 3CVNA 2HYZA 2XCBA 4M3OA 2LSUA 4R7LA 2JLBA 2X3MA 3CVXA 2E2EA 3RJVA 3FTYA 4AJWA 2MRIA 2V5FA 3ZVVA 3ENEA 2FEZA 2VTBB 2CG2A 3FUKA 3DBSA 1NA3A 5G04J 3IEGA 4UI9K 4A3VA 1E90A 2J08A 2WXPA 2R59A 4PS3A 4TV3A 4AY6A 4CGVA 4IRUA 4WWNA 1MHQA 4MKTA 3FU3A 5FT9A 5G55A 2KZTA 3PE3A 3ZRHA 1ELRA 4N2QA 3K9IA 4JHJA 3MYVA 3R9AB 1X5BA 4HFGA 3SZ7A 5FZQA 3QNKA 3UX4A 2XGMA 4WNEA 4APFA 5AENA 4E6HA 2A5UA 4JZYA 4CRWA 3G2SA 1ELKA 5AJDA 2LO6A 3MX3A 2C0MA 2KCVA 1H0AA 4WNFA 1UW4B 5T4YA 3TJPA 3KEZA 3LPZA 4G1TA 5DBKA 2CG3A 4YVQC 1QNFA 3FUMA 3EJNA 1XGWA 4I9EA 3G2UA 4GMJA 5AJLA 4GYYA 1H2TC 5CMWA 5AYWD 3U4TA 2L9BA 3B7RL 2KM4A 4FJYA 2PQNA 1HFAA 4GYWA 1GW6A 4EZJA 2VSNA 5BPPA 2WXKA 1KT1A 4EBAA 2NSZA 2WXOA 4FLBA 3OXGA 3L08A 3FFLA 3T8MA 2AWIA 1YA0A 4HORA 2PM6A 3CQGB 4CEMA 3L22A 4PH4B 5CMYA 3U9WA 3CIAA 1DNPA 4KT6B 4ACKA 3ASHA 2J07A 1FCHA 3QWWA 4GZ3A 4I17A 4J8EA 4J8SA 4NURA 3LY8A 2XRZA 3B7TA 4Q69A 4UQYA 1U3DA 2E0IA 3CVUA 5ANLA 4I9CA 4Y6CA 3FTVA 4BT8A 3EIJA 1PC2A 3QB2A 5LOZA 3MKQA 1MQSA 3FY4A 4QFVA 1KLXA 4LEUA 3SI5A 4FHKA 3T5XA 4DI4A 1HX8A 4Y6WA 2GRLA 1H19A 3AU4A 2XHEA 3NQPA 5D0QD 5EX3A 3ZYQA 3E4BA 1L5JA 3D9OA 5BT1A 4EPZA 3MKRA 4NACA 3FUFA 3B7SA 4JXTA 4UQXA 3C98A 3U3WA 2OOEA 4I1OB 4BTBA 3VLEA 2WM9A 3SFZA 3ONKA 4JHKA 3LDZA 3PZDA 4UWHA 4FHJA 3CKCA 3FP3A 2GW1A 4GZ5A 4FLHA 5KJLA 2Y3AA 3CHRA 3LVQE 4APOA 3UT8A 3Q4AB 5EX0A 2AW6A 1E96B 4XZ4A 2VJ8A 4RVBA 3SD5A 1HH8A 4HS2A 4J6IA 1QZ2A 2WXRA 4CDNA 2VTBA 3LXUX 4KXKB 3FHEA 3GZ1A 3FUEA 2HR2A 4Q94A 3TGOA 3FDHA 2C2LA 2M63A 3GZSA 3QJZA 4KZ0A 4O6FA 2CFZA 1QQEA 2IF4A 4AVXA 4XKCA 3GW4A 1IYGA 4L23A 1OWPA 3RO3A 3CHPA 4XE0A 1OWOA 3CSTA 3S7FA 4F53A 2BUGA 4W9RA 2QFCA 3JQ1A 5KJMA 3L6AA 3MA5A 4JEUA 3CV0A 4CDMA 1FVFA 4IULA 2X6IA 4B8CB 4G25A 2WVIA 3FUNA 3L54A 2WQHA 4NRHB 4BFRA 3Q49B 2IOSA 4I43A 3UT7A 2PM7A 4G2VA 4UWGA 2WPVA 3SF4A 3G2VA 3JCKC 4GA0A 4LRZA 3UQ3A 4XX5A 3SHFA 2KCKA 4BX8A 4L2LA 2Y4UA 2WXMA 1H6KA 3JQ0A 3UT4A 4GZCA 2VGXB 3EHMA 4EZLA 4A55A 2WXQA 3LKUA 4I2WA 2CFUA 3APCA 4AXHA 4KZCA 1WY6A 2XEVA 1TJFA 1ELWA 3AS4A 1HZ4A 2YINA 1NP7A 3KS2A 5JJ6A 3ZYMA 4WNDA 3JUIA 3D3MA 3BG0B 4I1AA 4LERA 4L1BA 2P58C 4WUYA 2WMNA 4PS8A 5LFAA 3AS8A 3FH5A 2I1JA 1E8WA 3O48A 2GRMA 2X6FA 4ANWA 3NF1A 2HM8A 1Z3XA 1EPUA 4C0EA 2AVPA 3N71A 3ZHEB 3VTXA 5BW8C 3P1UA 3EHNA 2VSOE 3JYSA 4KMOA 3CKBA 3FWVA 2WQ7A 1Z3YA 3PDNA 4L7TA 2FF4A 1Y8MA 1SZ9A 2A4ZA 4J0UA 4PUCA 4OVUA 5T3RA 3MV3B 3MJWA 4ABNA 5BV1A 4N5CA 2J4BA 4WAFA 2IOLA 5J08A 4RSYA 2AXVA 3QWPA 3VTYA 2WXLA 4AY5A 3GYZA 4UQZA 1E8ZA 3G2TA 1HF8A 1ZBPA 4A3TA 4U8HA 4N3CA 1N52A 3FUIA 4U0ZA 3TL5A 2WXGA 4ATGA 4GU5A 2BTDA 2X38A 4N39A 3T5VA 5E76A 1DVPA 1WAO1 2J49A 4JW1A 3MEKA 2X6KA 1U3CA 2GGFA 3ZW3A 3I3NA 2VQ2A 3LVRE 5CHEE 3CK7A 5JHBA 3FUHA 3TXMA 2WXFA 4PS7A 4Q96A 1JWGA 4U63A 2JEKA 2WXHA 3PH0C 1E8YA 1HXIA 2KATA 3OXLA 3CVWA 2IJGX 3FEYA 4JA9A 1TJCA 2R17C 1E8XA 3WXXA 1OWNA 4NQ0A 4CGWA 1E7VA 2XPZA 1H2UA 1OWMA 4AM9A 3PREA 4HLEA 4K03A 2OV8A 2NXPA 4HVBA 3IV0A 2ONDA 4URKA 2IQCA 4U04A 4XI9A 4FA6A 1IHGA 3HVEA 3OXFA 2FULA 4GMLA 2UWJG 3ESLA 4K0RA 4DPRA 4HOQA 4IN3B 4LUNU 4MLPA 4MS6A 2X6HA 2DIWA 3PUKA 4I2ZA 4CDRA 4RG6A 2KCLA 4C0MA 4HOTA 1OUVA 3IKOB 4GCOA 2ZU6B 5J90A 3CEQA 2V4LA 3BG1B 3EIQC 3SNXA 3FH8A 2CHXA 2CHZA 2I1KA 2VGXA 4G24A 3CR3A 4KYOB 1W3BA 2NC9A 4EZKA 5C1DA 3L17A 2IFUA 4MRUA 2FBNA 4EQFA 3PRZA 3I4RB 2UY1A 5BV0A 5EDSA 2HO1A 3CGHA 4B0ZA 1KT0A 4BT9A 3KD7A 3I5PA 3QKYA 2XCCA 3ASFA 2L0TB 3HHMA 5FJYA 2VSXE 1OWLA 4H7YA 4AOFA 3QARA 2XPIA 4EECA 3ZHEA 2YNQA 3FTZA 3ML9A 3TG5A 4ILIA 3ZN3A 1UN9A 2I9CA 2BF0X 2VSYA 3HVEB 5FQ6A 4BTAA 2LAHA 3D9KA 4V3IA 3IHYA 2WB2A 1Z6TA 3ZPJA 1IQRA 4AV7A 5BNWA 4CT0A 4XI0A 4ANUA 3EDTB 3MZLB 3ZEFA 5LCWC 4LCTA 3ASDA 1ZU2A 4XIFA 2V0PA 5JHAA 3ESKA 4I6EA 3QC1A 3IBEA 3S2AA 4U0UA 3AU5A 1A17A 1HG2A 2AXUA 3CSFA 3QAQA 3U66A 4RG9A 1N54A 2IU1A 1E7UA 4GA1A 3ZIMA 4JC8A 4HXIA 1XNFA 4B8AA 2L0IA 1UG3A 3CVLA 5HI7A 2WMOA 1UJKA 2LAIA 3BEEA 4HOUA 3VLDA 4TUUA 1NZNA 2OVBA 3HYMB 2PL2A 2UY1B 5EKQD 4FJZA 2LNIA 4N3BA 5AIJA 4IYPA 3PE4A 3PS6A 4ACLA 2XQ0A 2XGSA 3QOUA 4GA2A 2FO7A 3LJ3A 2X6JA 5E75A 2EQXA 5A6CA 3CHMA 2YHEA 1LF8A 5A23A 4B94A 3HDXA 3D9MA 5G05C 2ILRA 3LY7A 5CCLA 2DBAA 2LSVA 4F3VA 5FQ4A 4B89A 2MOWA 3HIZA 4JPSA 4OYSA 3D9PA 2J09A 3R7RA 3PEUB 3ZYKA 4JA7A 2MHKA 3QK0A 3ZYLA 3KAEA 4ILHB 1TEZA 3FTXA 1EDUA 5DIZA 1S0PA 2VGYA 1EF1C 4UI9C 4WWOA 3MCXA 3L13A 3DPDA 5G05J 4YNDA 2C0LA 1BPOA 2YQ8A 4DJAA 1SQMA 1HU3A 3LS8A 4G26A 4H7XA 3TAXA 5ARGA 4OVVA 3LYAA 1JWFA 2OVFA 3RRNB 3RRUA 4AP2A 4GB9A 4BSXA 4GYOA 2V8SE 2PQRA 3I4GA 4UI9J 4UWKA 3UMVA 2FI7A 3G2WA 3FUJA 2RG8A 4A1GA 1JPLA 4F1SA 3ULQA 2XRYA 2Y4TA 2XPYA 3CK9A 4AIFA 4EBAG 1UJJA 1HO8A 3ZXSA 2Q7FA 4UWLA 4GPKA 4I6JA 3LCAA 3B7UX 5KCMA 1WM5A 2L6JA 4FC8A 4JEHA 3CHSA 4ME2A 3AS5A 1EYHA 5FQ8A 1B89A 3TG4A 3RK6A 3CVVA 3CHOA 2RD0A 4A1SA 1INZA 2IONA 3D9LA 3RO2A 3SBSA 4F7AA 3PNLB 3IHVA 3D9IA 5KJKA 1SZAA 3L16A 4AEZC 2VYIA 4GZ6A 4YVOA 3CK8A 4GZDA 5ENNA 3RU0A 2KZTB 3NZSA 3U64A 4GCNA 3RRMB 3FTSA 4WNGA 3APFA 3CVQA 3ONLA 3FUDA 3SBTB 4N3AA 3URZA 4E85A 2WXJA 4FU3A 5FWQA 3TXNA 4FADA 4BWRA 3QWVA 4KVMA 1HG5A 2YHCA 4PDXA 3S7JA 3PEVB 3FTUA 3O4ZA 3OTNA 2J4DA 4BY6A 3ML8A 2WQ6A 4DLQA 3UPVA 4ANXA 5ARFA 3CLJA 4KBQA 4TRQA 1JUQA 2WXNA 2I6HA 1PY1A 4I6GA 5FQ7A 3D9JA 4XKBA 4J8DA 3MGBA 3VLFA 3QDNA 4G23A 4G11A 3Q15A 3CVPA 4KVOA 5FZRA 4ILGA 2PZIA 3ZGQA 3FU0A 3PUJA 4U0SA 5JJTA 5FTPA 4D10C 5BUZA 4JHRA 4UWFA 4ANVA 5LP0A 5LX8A 3NZUA 5HQ8A 5KJNA 2AXZA 3ASGA 4DLOA 5M72A 2WXIA 3FULA 2QY7A 3D9NA 5FZSA 3ZFWA 3FU6A 4GAAA 1Y6IA 1NA0A 3Q5MA 4L2YA 4FULA 5A7DB 1H2VC 4CCAA 3UUXA 4P29A 3APDA 4CT4A 3MKQB 5CCMA 1P5QA 3S7BA 3OAWA 3FTWA 4C9BB 1HS6A 1UN8A 1PAQA 4I1MA 4J8FA 2R5SA 3GZ2A 5JJ7A 4N2SA 3LEWA 3LY9A 3PVLA 3CHQA 3SGHA 4WWPA 5LCWJ 3P2BA 2J9QA 2I2OA 2CHWA 3CVYA 3PNTB 5G04C 1IQUA 4DI3A 3FU5A 3RKVA 1VDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4B A;  2NXP A;  2J49 A; 
#chains in the Genus database with same CATH topology
 3R7Q A;  5C2Y A;  2KC7 A;  3BQO A;  3FH7 A;  4JVS A;  3RIB A;  1TN7 A;  3RJV A;  3FTY A;  4AJW A;  2MRI A;  2V5F A;  2ZIR A;  1NA3 A;  4UI9 K;  4AY6 A;  1E90 A;  2R59 A;  4IRU A;  3PE3 A;  3ULE G;  1N0Q A;  5B3S E;  2H6F A;  1TN6 A;  2C0M A;  4WNF A;  3TJP A;  3KEZ A;  4GTR A;  1NL4 A;  3KEA A;  3G2U A;  3B7R L;  4FJY A;  2PQN A;  4EZJ A;  1GW6 A;  1S70 B;  4LG6 A;  4J8Y A;  3E34 A;  4HOR A;  3CQG B;  2XZD G;  5CMY A;  3U9W A;  1AWC B;  1IKN D;  3QWW A;  3ZNG A;  4NUR A;  1U3D A;  3CVU A;  1QYM A;  4I9C A;  1PC2 A;  5IY5 E;  4LEU A;  4Y6W A;  2GRL A;  2XHE A;  2XS1 A;  3NQP A;  3D9O A;  4EPZ A;  3MKR A;  4NAC A;  1OCC E;  4JXT A;  3C98 A;  1YYH A;  4I1O B;  2XEN A;  3PZD A;  2GW1 A;  3Q4A B;  4HS2 A;  4OAV B;  1S64 A;  3FUE A;  2M63 A;  3QJZ A;  2CFZ A;  2IF4 A;  5CEC B;  3GW4 A;  1UOH A;  4CDM A;  4IUL A;  1N94 A;  2X6I A;  2WVI A;  4BFR A;  4O1O A;  2XZT G;  3SF4 A;  3G2V A;  4LRZ A;  2KCK A;  5KNG A;  3Q73 A;  2Y4U A;  4EZL A;  3APC A;  5B1B E;  1FT2 A;  3KS2 A;  4WND A;  3JUI A;  3D3M A;  2I1J A;  3AJI A;  4C0E A;  1EPU A;  3ZHE B;  3VTX A;  3EHN A;  2VSO E;  3UIO C;  4ATZ D;  2Y0B G;  1D9S A;  2IOL A;  4RSY A;  2AXV A;  2WXL A;  1E8Z A;  5FIO A;  3FUI A;  4DX7 D;  4U0Z A;  2WXG A;  4GU5 A;  1U2V G;  3SY2 A;  1WAO 1;  3BU8 A;  2GGF A;  3E37 A;  3LVR E;  2VQ2 A;  3TWS A;  5JHB A;  4Q96 A;  2WXH A;  1E8Y A;  4GTO A;  1K8K G;  3V31 A;  4CGW A;  2XPZ A;  3PRE A;  4HLE A;  2OV8 A;  2NXP A;  5CEA A;  4HOQ A;  2XEH A;  1OCO E;  2X6H A;  4I2Z A;  3R9M A;  5BXU A;  4C0M A;  3DSU A;  3IKO B;  4GCO A;  2CHZ A;  4KYO B;  5C1D A;  3L17 A;  2IFU A;  4BER A;  3ZUV B;  2FBN A;  1A5E A;  4U7E B;  3I4R B;  5EDS A;  2LXM A;  3I5P A;  2XCC A;  1O1S A;  3ASF A;  4BTA A;  2LAH A;  3D9K A;  1OXJ A;  3IHY A;  2WB2 A;  1Z6T A;  4AV7 A;  5BNW A;  2LXL A;  4ZFH A;  5KBA A;  4LCT A;  3AU5 A;  3QAQ A;  2AXU A;  3ZIM A;  3X2Q E;  4HXI A;  1XNF A;  3TWT A;  4B8A A;  1TNU A;  2EIN E;  3BEE A;  1TNB A;  4TUU A;  1NZN A;  2OVB A;  4IYP A;  2OEV A;  4GA2 A;  3QOU A;  4GPK A;  5A23 A;  4HI8 A;  4F3V A;  4B89 A;  3DRA A;  3NAW A;  2J09 A;  2MHK A;  3E30 A;  1DCE A;  5KWD A;  2KBX A;  3L13 A;  4YND A;  2VGE A;  1BPO A;  5CRV A;  1H6P A;  4G26 A;  3TAX A;  4RQI A;  2OVF A;  4BSX A;  4HNA D;  3UMV A;  2XRY A;  1UJJ A;  3L82 A;  3V2X A;  4HQD A;  3CHS A;  3AS5 A;  1EYH A;  5FQ8 A;  1B89 A;  3CHO A;  1INZ A;  3SBS A;  3IHV A;  2IY0 C;  5KJK A;  3L16 A;  5ENN A;  2KZT B;  3U64 A;  3RRM B;  3APF A;  3CVQ A;  5D66 A;  3Q79 A;  4N3A A;  3PZ4 A;  3URZ A;  1BU9 A;  1X81 A;  3QWV A;  2YHC A;  3FTU A;  3OTN A;  3DWL G;  5ARF A;  3CLJ A;  1PY1 A;  4XKB A;  4G11 A;  4KVO A;  5FZR A;  1DCQ A;  3FU0 A;  3V2O A;  4U0S A;  5FTP A;  5BUZ A;  3ZXP A;  5EYL A;  5HQ8 A;  1JCS A;  5AAR A;  3DPY A;  3FUL A;  3D9N A;  2L6B A;  4GAA A;  1Y6I A;  4FUL A;  5A7D B;  4CCA A;  3UUX A;  4P29 A;  3MKQ B;  3S7B A;  2NYJ A;  3FTW A;  3Q9N C;  1PAQ A;  4DX6 D;  3GZ2 A;  5JJ7 A;  1SA4 A;  3LY9 A;  1IQU A;  3RKV A;  4FP7 A;  5T8I A;  2DCP A;  3FEX A;  3Q47 B;  4JL0 A;  4U07 A;  1FVH A;  1YMP A;  3B7B A;  1WDY A;  3HXD A;  5D0O D;  3UM1 A;  4BX9 A;  1RZ4 A;  2JLB A;  2X3M A;  3CVX A;  2P9N G;  3ENE A;  3DBS A;  5G04 J;  4U8Y D;  4A3V A;  2J08 A;  4CGV A;  4WWN A;  4MKT A;  5FT9 A;  3K9I A;  4TXR A;  3R9A B;  3Q78 A;  5FZQ A;  4F6R D;  3QNK A;  5AEN A;  4CRW A;  5AJD A;  2LO6 A;  1UW4 B;  2J8S D;  3LPZ A;  3TWW A;  4G1T A;  5DBK A;  1QNF A;  3TWV A;  2L9B A;  4GYW A;  2WXK A;  4LSZ E;  2WXO A;  2IEJ A;  4CEM A;  4PH4 B;  4KT6 B;  5AAO A;  3ASH A;  1JCQ A;  2J07 A;  4J8E A;  4Q69 A;  4UQY A;  5ANL A;  3EIJ A;  3V79 K;  5LOZ A;  3QB2 A;  2QC9 A;  3JUE A;  2FO1 E;  4CYM D;  4HB5 A;  3ZYQ A;  1DC2 A;  4DX2 A;  4K5A B;  3U3W A;  4BTB A;  2R2L A;  4U96 D;  3ONK A;  1ZB1 A;  4FHJ A;  4GTS A;  3ABK E;  4APO A;  2AW6 A;  4U95 D;  2VJ8 A;  3SD5 A;  2BKK B;  2WXR A;  4LNG A;  3LXU X;  4KXK B;  3GZ1 A;  2HR2 A;  5CER B;  1YCS B;  4O1P A;  4XKC A;  1TYQ G;  4L23 A;  3RO3 A;  1OWO A;  3S7F A;  2BUG A;  2QFC A;  3JQ1 A;  3L6A A;  3CV0 A;  4B8C B;  1H6O A;  4I43 A;  3UT7 A;  2WPV A;  3BUA A;  3JCK C;  3UQ3 A;  4XX5 A;  5ITZ F;  2VGX B;  3LKU A;  3ZYM A;  4L1B A;  5LFA A;  3AS8 A;  3F6Q A;  3O48 A;  5AQA A;  2GRM A;  2JAB A;  2HM8 A;  1Z3X A;  2P9U G;  3N71 A;  2ETB A;  5D2M C;  5BW8 C;  1NI1 A;  3CKB A;  3FWV A;  1BLX B;  4L7T A;  1Y8M A;  2A4Z A;  4PUC A;  4OVU A;  4TXQ A;  5J08 A;  2GRQ B;  3HRA A;  4UQZ A;  4N3C A;  1N52 A;  4Z68 A;  1V54 E;  3T5V A;  2J49 A;  1D8D A;  1AP7 A;  3C72 A;  2R05 A;  3ABL E;  4DX1 A;  2WXF A;  3UM3 A;  2JEK A;  1HXI A;  3CVW A;  4JA9 A;  2R17 C;  3WXX A;  1E8X A;  3J5P A;  2IO3 C;  1OWM A;  4HVB A;  3AG2 E;  3C3Q A;  2BKG A;  1LD8 A;  4MLP A;  2XS8 A;  1BI7 B;  3E33 A;  2V4L A;  3BG1 B;  3SNX A;  2NC9 A;  4BET A;  4B93 B;  4MRU A;  2PNN A;  3ZU7 B;  2P9L G;  5BV0 A;  2HO1 A;  2ZGD A;  4B0Z A;  3Q7F A;  3KD7 A;  1BI8 B;  2P9P G;  5FJY A;  4H7Y A;  3ZHE A;  2YNQ A;  3FTZ A;  4LNB A;  3ML9 A;  3TG5 A;  4ILI A;  4GTM A;  3NBN B;  1SA5 A;  3UTM A;  1K1B A;  3ZPJ A;  4CT0 A;  4XI0 A;  3EDT B;  1ZU2 A;  2V0P A;  4U0U A;  1HG2 A;  3CSF A;  3T8K A;  4RG9 A;  4GA1 A;  5AQ9 A;  1UG3 A;  2H6I A;  2PL2 A;  3NOC D;  3PS6 A;  2XQ0 A;  2FO7 A;  2X6J A;  5A6C A;  2YHE A;  1LF8 A;  3HDX A;  3D9M A;  5CCL A;  2LSV A;  3C3O A;  3JXI A;  4JPS A;  3TWQ A;  2OCC E;  3J5Q B;  3ZYK A;  4JA7 A;  2LUH A;  1WG0 A;  2EIK E;  1S0P A;  4WWO A;  3PZ1 A;  5G05 J;  2C0L A;  2YQ8 A;  1SQM A;  1N4P A;  3DSW A;  5ARG A;  3W9G A;  3IXE A;  4XEI G;  4GYO A;  4UWK A;  3G2W A;  2Y4T A;  4HRL A;  2XPY A;  4EBA G;  2Q7F A;  4UWL A;  4I6J A;  5KCM A;  1WM5 A;  4FC8 A;  3Q7A A;  4ME2 A;  3DSX A;  3TG4 A;  2RD0 A;  4A1S A;  2ION A;  3RO2 A;  2P9I G;  1N0R A;  3PNL B;  4AEZ C;  3NZS A;  1KZO A;  3ONL A;  2GRO B;  3SBT B;  2WXJ A;  4FAD A;  4DX5 D;  1HG5 A;  3HXC A;  4HBD A;  3TWX A;  4TUM A;  4NIK A;  2DZN A;  1JUQ A;  2WXN A;  2I6H A;  5FQ7 A;  3D9J A;  3VLF A;  3V30 A;  5JJT A;  5EID A;  5LP0 A;  2AXZ A;  3ASG A;  4J7W A;  5FZS A;  3Q5M A;  1H2V C;  3Q75 A;  3APD A;  2Y1L E;  5CCM A;  1P5Q A;  2RFA A;  1HS6 A;  1UN8 A;  4G8L A;  4J8F A;  4I1M A;  2R5S A;  3LEW A;  3P2B A;  2J9Q A;  2P9K G;  2I2O A;  4M7C A;  3CVY A;  5G04 C;  5ANR A;  3B13 A;  3UI2 A;  4HOS A;  5EIB E;  3HXE A;  1RW2 A;  3MV2 B;  3S7D A;  3CVN A;  2HYZ A;  2XCB A;  4M3O A;  2LSU A;  2VTB B;  3IEG A;  2WXP A;  1MHQ A;  5G55 A;  3FU3 A;  2KZT A;  4N2Q A;  1ELR A;  2HE0 A;  4JHJ A;  1JCR A;  1X5B A;  3DEO A;  3PZ3 A;  3TWR A;  4WNE A;  4APF A;  4E6H A;  3G2S A;  1ELK A;  1K1A A;  1MX4 A;  2KCV A;  1H0A A;  5T4Y A;  2H6H A;  3FUM A;  5AJL A;  3LJN A;  1H2T C;  3U4T A;  2KM4 A;  2VSN A;  3D9H A;  5BPP A;  5B1A E;  4EBA A;  3AG1 E;  2NSZ A;  4FLB A;  1TNZ A;  3L08 A;  3T8M A;  2AWI A;  4ACK A;  4GZ3 A;  1MX2 A;  3LY8 A;  3B7T A;  1IHB A;  3E32 A;  3FTV A;  4BT8 A;  4HLL A;  2H6G A;  3MKQ A;  1MQS A;  3FY4 A;  4FHK A;  4DI4 A;  3AG4 E;  3E4B A;  1L5J A;  5BT1 A;  3FUF A;  4UQX A;  2OOE A;  3SFZ A;  3LDZ A;  1BD8 A;  4UWH A;  2DWZ A;  3FP3 A;  4GZ5 A;  4FLH A;  3CHR A;  3DST A;  5EX0 A;  1E96 B;  4XZ4 A;  1HH8 A;  4J6I A;  4CDN A;  1QZ2 A;  3DEP A;  4Q94 A;  3TGO A;  3GZS A;  4KZ0 A;  1IYG A;  1OWP A;  3CHP A;  4K5C A;  3CST A;  4F53 A;  4W9R A;  4JEU A;  1FVF A;  4G25 A;  3FUN A;  1SVX A;  2WQH A;  4NRH B;  3Q49 B;  3NOG D;  2PM7 A;  4BX8 A;  1H6K A;  3JQ0 A;  2ZXW E;  3UT4 A;  5CED B;  4GZC A;  1D8E A;  3EHM A;  3TWU A;  5ENS D;  2WXQ A;  2CFU A;  1ELW A;  3AS4 A;  1HZ4 A;  2F37 A;  2QYU A;  5JJ6 A;  2Y69 E;  1N11 A;  2P58 C;  2WMN A;  3FH5 A;  2X6F A;  4ANW A;  3NF1 A;  4K5B A;  5EYP F;  4KMO A;  4YDW A;  2WQ7 A;  3PDN A;  2FF4 A;  4J0U A;  2P9S G;  2EIJ E;  4N5C A;  2J4B A;  4WAF A;  5EN5 D;  3QWP A;  3HG0 D;  3GYZ A;  4AY5 A;  1O1T A;  3G2T A;  1ZBP A;  4A3T A;  3TL5 A;  1O5M A;  1MX6 A;  3NB2 A;  1DVP A;  4JW1 A;  2X6K A;  3ZW3 A;  3CK7 A;  1JWG A;  4U63 A;  3PH0 C;  3OXL A;  3Q9U C;  3L9T A;  1TJC A;  1OWN A;  4NQ0 A;  3DSV A;  1E7V A;  1H2U A;  3SQV A;  4AM9 A;  3IV0 A;  2OND A;  1KZP A;  4XI9 A;  4FA6 A;  3HVE A;  2FUL A;  4EHM A;  3PUK A;  2DIW A;  4CDR A;  2KCL A;  4HOT A;  5J90 A;  2ZU6 B;  3CEQ A;  1Z5S C;  4LNU D;  2CHX A;  2I1K A;  2VGX A;  4G24 A;  4EZK A;  2XEE A;  3EU9 A;  4GTV A;  3RSE G;  2BED A;  3SFX A;  2UY1 A;  4JD2 G;  1TNO A;  3QKY A;  3UM0 A;  2L0T B;  2VSX E;  4EEC A;  4F1P A;  3ZN3 A;  1UN9 A;  2AJA A;  2I9C A;  2BF0 X;  3HVE B;  5FQ6 A;  4ANU A;  3ASD A;  5JHA A;  3ESK A;  3S2A A;  1A17 A;  3U66 A;  1N54 A;  2IU1 A;  2WMO A;  1UJK A;  4HOU A;  5ENO D;  3VLD A;  3HYM B;  1MYO A;  3UKR G;  2UY1 B;  5EKQ D;  2LNI A;  4N3B A;  3PE4 A;  4ACL A;  1S63 A;  2XGS A;  5E75 A;  2EQX A;  5HKP A;  4B94 A;  5G05 C;  2ILR A;  3LY7 A;  2DBA A;  2MOW A;  3D9P A;  3R7R A;  4YDO A;  3ZYL A;  1QBQ A;  2ETC A;  5DIZ A;  3UM2 A;  2VGY A;  3ZKJ A;  3MCX A;  4HRN A;  4DJA A;  1HU3 A;  4H7X A;  4OVV A;  1JWF A;  3RRN B;  4AP2 A;  4BEP A;  2V8S E;  4UI9 J;  4F1S A;  3FUJ A;  2RG8 A;  1JPL A;  3B7U X;  3UIP C;  4HI9 A;  1Q2Z A;  1OY3 D;  3SFY A;  3RK6 A;  3CVV A;  3EU5 A;  3D9I A;  3EUV A;  4YVO A;  3RU0 A;  1N95 A;  3HXF A;  2RKK A;  4BES A;  4WNG A;  2DVW A;  3FUD A;  5FWQ A;  3TXN A;  4BWR A;  3ASN E;  4KVM A;  3S7J A;  3O4Z A;  2J4D A;  4BY6 A;  3PZ2 A;  1FPP A;  2WQ6 A;  4DLQ A;  3UPV A;  4TRQ A;  4I6G A;  4J8D A;  3MGB A;  3QDN A;  4RLY A;  3CVP A;  3KSL A;  3ZGQ A;  3PUJ A;  4D10 C;  2RFM A;  5M72 A;  1N4S A;  3ZFW A;  3C3R A;  3FU6 A;  3ISM C;  4C9B B;  3SGH A;  4WWP A;  1NA0 A;  4GZ6 A;  1VDY A;  1HE8 A;  1IXV A;  4DK5 A;  3CQC B;  1OCZ E;  2XGO A;  3UKU G;  5G2N A;  4R7L A;  2E2E A;  3ABM E;  2ETA A;  3ZVV A;  2FEZ A;  2CG2 A;  3FUK A;  4PS3 A;  4TV3 A;  3UIN C;  3ZRH A;  3MYV A;  3SZ7 A;  4HFG A;  5BXO A;  3UX4 A;  2XGM A;  2A5U A;  3ASO E;  4JZY A;  3MX3 A;  2CG3 A;  4YVQ C;  3EJN A;  1XGW A;  4I9E A;  4GMJ A;  4GYY A;  5CMW A;  5AYW D;  5HS0 A;  1HFA A;  1KT1 A;  3KSQ A;  4G8K A;  5JMN D;  3OXG A;  3FFL A;  1YA0 A;  4L9P A;  2PM6 A;  3L22 A;  3CIA A;  1DNP A;  1FCH A;  4I17 A;  4J8S A;  2XRZ A;  2E0I A;  4Y6C A;  3HXB A;  4GMR A;  4QFV A;  1KLX A;  3SI5 A;  3T5X A;  1HX8 A;  1LTX A;  1H19 A;  3AU4 A;  5EX3 A;  5D0Q D;  1NFI E;  1N4R A;  3B7S A;  4U8V D;  3VLE A;  2WM9 A;  4JHK A;  3CKC A;  5CBO A;  5KJL A;  2ZGG A;  2Y3A A;  3LVQ E;  3UT8 A;  1N9A A;  4RVB A;  5CRU A;  2VTB A;  4A63 B;  3DXM G;  3FHE A;  2QYJ A;  3FDH A;  2C2L A;  4O6F A;  1QQE A;  4AVX A;  4XE0 A;  5KJM A;  3MA5 A;  2F8Y A;  2V5Q C;  3L54 A;  2GRR B;  2IOS A;  4G2V A;  4UWG A;  4GA0 A;  3SHF A;  3C5R A;  4L2L A;  2WXM A;  4A55 A;  4ZHB A;  3AAA C;  4I2W A;  4AXH A;  4KZC A;  1WY6 A;  2XEV A;  1TJF A;  2YIN A;  1NP7 A;  3BG0 B;  4I1A A;  4LER A;  4JB8 P;  4WUY A;  2EIL E;  4PS8 A;  1E8W A;  4YDY A;  2AVP A;  5HRY A;  2R02 A;  3P1U A;  3JYS A;  1Z3Y A;  5AQ7 A;  1SZ9 A;  5T3R A;  3MV3 B;  3MJW A;  4ABN A;  5BV1 A;  1OCR E;  3VTY A;  1HF8 A;  3T9K A;  4U8H A;  2R03 A;  4X8Q A;  5JA4 D;  1TNY A;  4ATG A;  3ULY A;  3RAU A;  2BTD A;  2X38 A;  4N39 A;  5E76 A;  1FT1 A;  3AG3 E;  4O60 A;  3MEK A;  5ENP D;  1U3C A;  2DZO A;  3B95 A;  3I3N A;  5CHE E;  3FUH A;  3TXM A;  4MBG A;  4PS7 A;  4BSZ B;  2KAT A;  2OEW A;  2IJG X;  2V4H C;  3FEY A;  3EHR A;  4K03 A;  4URK A;  2IQC A;  4U04 A;  1IHG A;  3OXF A;  4GML A;  2UWJ G;  3ESL A;  3JXJ A;  4K0R A;  4DPR A;  4IN3 B;  4LUN U;  4MS6 A;  4RG6 A;  1OUV A;  4GTT A;  3EIQ C;  3FH8 A;  3CR3 A;  1W3B A;  2F0Y A;  4YDE A;  2GRP B;  3SO8 A;  1MJ0 A;  4EQF A;  3PRZ A;  2DYS E;  2KXP C;  4TXP A;  4QQI A;  3CGH A;  1KT0 A;  2DYR E;  4BT9 A;  5EIL A;  3W9F A;  3HHM A;  1OWL A;  4AOF A;  3QAR A;  2XPI A;  2MYO A;  2GRN B;  1KPS B;  5AN8 A;  2VSY A;  4V3I A;  1IQR A;  5H7P A;  5LCW C;  3MZL B;  4OAU C;  3ZEF A;  4XIF A;  4I6E A;  3QC1 A;  3IBE A;  1O1R A;  5ENR D;  3UXG A;  1E7U A;  4JC8 A;  2L0I A;  1SW6 A;  3CVL A;  1TN8 A;  5HI7 A;  4N5Q A;  2LAI A;  5ENT D;  2QZA A;  4FJZ A;  5AIJ A;  3LJ3 A;  4DUI A;  4CZ2 D;  3CHM A;  5FQ4 A;  3HIZ A;  4UUC A;  4OYS A;  3PEU B;  4GTQ A;  3QK0 A;  3KAE A;  4ILH B;  1LD7 A;  1TEZ A;  3FTX A;  1EDU A;  2P2C P;  2IO2 C;  1EF1 C;  2EIM E;  4UI9 C;  3DPD A;  1MZC A;  3LS8 A;  3LYA A;  3RRU A;  1TR4 A;  4GB9 A;  2PQR A;  3I4G A;  2FI7 A;  4A1G A;  3ULQ A;  1V55 E;  3CK9 A;  4AIF A;  5AQB A;  1HO8 A;  3ZXS A;  3LCA A;  2L6J A;  4JEH A;  2F8X K;  3D9L A;  4F7A A;  1SZA A;  2VYI A;  4GTP A;  3CK8 A;  4GZD A;  4GCN A;  3FTS A;  4E85 A;  4FU3 A;  5KNH D;  3WG7 E;  4PDX A;  3PEV B;  5CBN A;  3ML8 A;  1G3N B;  4ANX A;  4KBQ A;  4C48 B;  5FIN A;  4G23 A;  3Q15 A;  4ILG A;  2PZI A;  3EHQ A;  4JHR A;  4UWF A;  4ANV A;  2B6C A;  5LX8 A;  3DSS A;  3NZU A;  5KJN A;  3DXK G;  4GPM A;  4DLO A;  2WXI A;  1OT8 A;  2QY7 A;  1K3Z D;  2A5E A;  5ENQ D;  4L2Y A;  4DRX E;  4CT4 A;  3OAW A;  2ZIS A;  4N2S A;  3PVL A;  3CHQ A;  5LCW J;  2B0O E;  2CHW A;  3PNT B;  4DI3 A;  1N4Q A;  3FU5 A;  4HRM B; 
#chains in the Genus database with same CATH homology
 4FP7 A;  3R7Q A;  5C2Y A;  2KC7 A;  2DCP A;  3FEX A;  3Q47 B;  4JL0 A;  5ANR A;  5T8I A;  4U07 A;  3B13 A;  1FVH A;  3FH7 A;  4JVS A;  1HE8 A;  3RIB A;  4HOS A;  4DK5 A;  3CQC B;  5D0O D;  2XGO A;  3MV2 B;  4BX9 A;  5G2N A;  3S7D A;  3CVN A;  2HYZ A;  2XCB A;  4M3O A;  2LSU A;  4R7L A;  2JLB A;  2X3M A;  3CVX A;  2E2E A;  3RJV A;  3FTY A;  4AJW A;  2MRI A;  2V5F A;  3ZVV A;  3ENE A;  2FEZ A;  2VTB B;  2CG2 A;  3FUK A;  3DBS A;  1NA3 A;  5G04 J;  3IEG A;  4UI9 K;  4A3V A;  1E90 A;  2J08 A;  2WXP A;  2R59 A;  4PS3 A;  4TV3 A;  4AY6 A;  4CGV A;  4IRU A;  4WWN A;  1MHQ A;  4MKT A;  3FU3 A;  5FT9 A;  5G55 A;  2KZT A;  3PE3 A;  3ZRH A;  1ELR A;  4N2Q A;  3K9I A;  4JHJ A;  3MYV A;  3R9A B;  1X5B A;  4HFG A;  3SZ7 A;  5FZQ A;  3QNK A;  3UX4 A;  2XGM A;  4WNE A;  4APF A;  5AEN A;  4E6H A;  2A5U A;  4JZY A;  4CRW A;  3G2S A;  1ELK A;  5AJD A;  2LO6 A;  3MX3 A;  2C0M A;  2KCV A;  1H0A A;  4WNF A;  1UW4 B;  5T4Y A;  3TJP A;  3KEZ A;  3LPZ A;  4G1T A;  5DBK A;  2CG3 A;  4YVQ C;  1QNF A;  3FUM A;  3EJN A;  1XGW A;  4I9E A;  3G2U A;  4GMJ A;  5AJL A;  4GYY A;  1H2T C;  5CMW A;  5AYW D;  3U4T A;  2L9B A;  3B7R L;  2KM4 A;  4FJY A;  2PQN A;  1HFA A;  4GYW A;  1GW6 A;  4EZJ A;  2VSN A;  5BPP A;  2WXK A;  1KT1 A;  4EBA A;  2NSZ A;  2WXO A;  4FLB A;  3OXG A;  3L08 A;  3FFL A;  3T8M A;  2AWI A;  1YA0 A;  4HOR A;  2PM6 A;  3CQG B;  4CEM A;  3L22 A;  4PH4 B;  5CMY A;  3U9W A;  3CIA A;  1DNP A;  4KT6 B;  4ACK A;  3ASH A;  2J07 A;  1FCH A;  3QWW A;  4GZ3 A;  4I17 A;  4J8E A;  4J8S A;  4NUR A;  3LY8 A;  2XRZ A;  3B7T A;  4Q69 A;  4UQY A;  1U3D A;  2E0I A;  3CVU A;  5ANL A;  4I9C A;  4Y6C A;  3FTV A;  4BT8 A;  3EIJ A;  1PC2 A;  3QB2 A;  5LOZ A;  3MKQ A;  1MQS A;  3FY4 A;  4QFV A;  1KLX A;  4LEU A;  3SI5 A;  4FHK A;  3T5X A;  4DI4 A;  1HX8 A;  4Y6W A;  2GRL A;  1H19 A;  3AU4 A;  2XHE A;  3NQP A;  5D0Q D;  5EX3 A;  3ZYQ A;  3E4B A;  1L5J A;  3D9O A;  5BT1 A;  4EPZ A;  3MKR A;  4NAC A;  3FUF A;  3B7S A;  4JXT A;  4UQX A;  3C98 A;  3U3W A;  2OOE A;  4I1O B;  4BTB A;  3VLE A;  2WM9 A;  3SFZ A;  3ONK A;  4JHK A;  3LDZ A;  3PZD A;  4UWH A;  4FHJ A;  3CKC A;  3FP3 A;  2GW1 A;  4GZ5 A;  4FLH A;  5KJL A;  2Y3A A;  3CHR A;  3LVQ E;  4APO A;  3UT8 A;  3Q4A B;  5EX0 A;  2AW6 A;  1E96 B;  4XZ4 A;  2VJ8 A;  4RVB A;  3SD5 A;  1HH8 A;  4HS2 A;  4J6I A;  1QZ2 A;  2WXR A;  4CDN A;  2VTB A;  3LXU X;  4KXK B;  3FHE A;  3GZ1 A;  3FUE A;  2HR2 A;  4Q94 A;  3TGO A;  3FDH A;  2C2L A;  2M63 A;  3GZS A;  3QJZ A;  4KZ0 A;  4O6F A;  2CFZ A;  1QQE A;  2IF4 A;  4AVX A;  4XKC A;  3GW4 A;  1IYG A;  4L23 A;  1OWP A;  3RO3 A;  3CHP A;  4XE0 A;  1OWO A;  3CST A;  3S7F A;  4F53 A;  2BUG A;  4W9R A;  2QFC A;  3JQ1 A;  5KJM A;  3L6A A;  3MA5 A;  4JEU A;  3CV0 A;  4CDM A;  1FVF A;  4IUL A;  2X6I A;  4B8C B;  4G25 A;  2WVI A;  3FUN A;  3L54 A;  2WQH A;  4NRH B;  4BFR A;  3Q49 B;  2IOS A;  4I43 A;  3UT7 A;  2PM7 A;  4G2V A;  4UWG A;  2WPV A;  3SF4 A;  3G2V A;  3JCK C;  4GA0 A;  4LRZ A;  3UQ3 A;  4XX5 A;  3SHF A;  2KCK A;  4BX8 A;  4L2L A;  2Y4U A;  2WXM A;  1H6K A;  3JQ0 A;  3UT4 A;  4GZC A;  2VGX B;  3EHM A;  4EZL A;  4A55 A;  2WXQ A;  3LKU A;  4I2W A;  2CFU A;  3APC A;  4AXH A;  4KZC A;  1WY6 A;  2XEV A;  1TJF A;  1ELW A;  3AS4 A;  1HZ4 A;  2YIN A;  1NP7 A;  3KS2 A;  5JJ6 A;  3ZYM A;  4WND A;  3JUI A;  3D3M A;  3BG0 B;  4I1A A;  4LER A;  4L1B A;  2P58 C;  4WUY A;  2WMN A;  4PS8 A;  5LFA A;  3AS8 A;  3FH5 A;  2I1J A;  1E8W A;  3O48 A;  2GRM A;  2X6F A;  4ANW A;  3NF1 A;  2HM8 A;  1Z3X A;  1EPU A;  4C0E A;  2AVP A;  3N71 A;  3ZHE B;  3VTX A;  5BW8 C;  3P1U A;  3EHN A;  2VSO E;  3JYS A;  4KMO A;  3CKB A;  3FWV A;  2WQ7 A;  1Z3Y A;  3PDN A;  4L7T A;  2FF4 A;  1Y8M A;  1SZ9 A;  2A4Z A;  4J0U A;  4PUC A;  4OVU A;  5T3R A;  3MV3 B;  3MJW A;  4ABN A;  5BV1 A;  4N5C A;  2J4B A;  4WAF A;  2IOL A;  5J08 A;  4RSY A;  2AXV A;  3QWP A;  3VTY A;  2WXL A;  4AY5 A;  3GYZ A;  4UQZ A;  1E8Z A;  3G2T A;  1HF8 A;  1ZBP A;  4A3T A;  4U8H A;  4N3C A;  1N52 A;  3FUI A;  4U0Z A;  3TL5 A;  2WXG A;  4ATG A;  4GU5 A;  2BTD A;  2X38 A;  4N39 A;  3T5V A;  5E76 A;  1DVP A;  1WAO 1;  2J49 A;  4JW1 A;  3MEK A;  2X6K A;  1U3C A;  2GGF A;  3ZW3 A;  3I3N A;  2VQ2 A;  3LVR E;  5CHE E;  3CK7 A;  5JHB A;  3FUH A;  3TXM A;  2WXF A;  4PS7 A;  4Q96 A;  1JWG A;  4U63 A;  2JEK A;  2WXH A;  3PH0 C;  1E8Y A;  1HXI A;  2KAT A;  3OXL A;  3CVW A;  2IJG X;  3FEY A;  4JA9 A;  1TJC A;  2R17 C;  1E8X A;  3WXX A;  1OWN A;  4NQ0 A;  4CGW A;  1E7V A;  2XPZ A;  1H2U A;  1OWM A;  4AM9 A;  3PRE A;  4HLE A;  4K03 A;  2OV8 A;  2NXP A;  4HVB A;  3IV0 A;  2OND A;  4URK A;  2IQC A;  4U04 A;  4XI9 A;  4FA6 A;  1IHG A;  3HVE A;  3OXF A;  2FUL A;  4GML A;  2UWJ G;  3ESL A;  4K0R A;  4DPR A;  4HOQ A;  4IN3 B;  4LUN U;  4MLP A;  4MS6 A;  2X6H A;  2DIW A;  3PUK A;  4I2Z A;  4CDR A;  4RG6 A;  2KCL A;  4C0M A;  4HOT A;  1OUV A;  3IKO B;  4GCO A;  2ZU6 B;  5J90 A;  3CEQ A;  2V4L A;  3BG1 B;  3EIQ C;  3SNX A;  3FH8 A;  2CHX A;  2CHZ A;  2I1K A;  2VGX A;  4G24 A;  3CR3 A;  4KYO B;  1W3B A;  2NC9 A;  4EZK A;  5C1D A;  3L17 A;  2IFU A;  4MRU A;  2FBN A;  4EQF A;  3PRZ A;  3I4R B;  2UY1 A;  5BV0 A;  5EDS A;  2HO1 A;  3CGH A;  4B0Z A;  1KT0 A;  4BT9 A;  3KD7 A;  3I5P A;  3QKY A;  2XCC A;  3ASF A;  2L0T B;  3HHM A;  5FJY A;  2VSX E;  1OWL A;  4H7Y A;  4AOF A;  3QAR A;  2XPI A;  4EEC A;  3ZHE A;  2YNQ A;  3FTZ A;  3ML9 A;  3TG5 A;  4ILI A;  3ZN3 A;  1UN9 A;  2I9C A;  2BF0 X;  2VSY A;  3HVE B;  5FQ6 A;  4BTA A;  2LAH A;  3D9K A;  4V3I A;  3IHY A;  2WB2 A;  1Z6T A;  3ZPJ A;  1IQR A;  4AV7 A;  5BNW A;  4CT0 A;  4XI0 A;  4ANU A;  3EDT B;  3MZL B;  3ZEF A;  5LCW C;  4LCT A;  3ASD A;  1ZU2 A;  4XIF A;  2V0P A;  5JHA A;  3ESK A;  4I6E A;  3QC1 A;  3IBE A;  3S2A A;  4U0U A;  3AU5 A;  1A17 A;  1HG2 A;  2AXU A;  3CSF A;  3QAQ A;  3U66 A;  4RG9 A;  1N54 A;  2IU1 A;  1E7U A;  4GA1 A;  3ZIM A;  4JC8 A;  4HXI A;  1XNF A;  4B8A A;  2L0I A;  1UG3 A;  3CVL A;  5HI7 A;  2WMO A;  1UJK A;  2LAI A;  3BEE A;  4HOU A;  3VLD A;  4TUU A;  1NZN A;  2OVB A;  3HYM B;  2PL2 A;  2UY1 B;  5EKQ D;  4FJZ A;  2LNI A;  4N3B A;  5AIJ A;  4IYP A;  3PE4 A;  3PS6 A;  4ACL A;  2XQ0 A;  2XGS A;  3QOU A;  4GA2 A;  2FO7 A;  3LJ3 A;  2X6J A;  5E75 A;  2EQX A;  5A6C A;  3CHM A;  2YHE A;  1LF8 A;  5A23 A;  4B94 A;  3HDX A;  3D9M A;  5G05 C;  2ILR A;  3LY7 A;  5CCL A;  2DBA A;  2LSV A;  4F3V A;  5FQ4 A;  4B89 A;  2MOW A;  3HIZ A;  4JPS A;  4OYS A;  3D9P A;  2J09 A;  3R7R A;  3PEU B;  3ZYK A;  4JA7 A;  2MHK A;  3QK0 A;  3ZYL A;  3KAE A;  4ILH B;  1TEZ A;  3FTX A;  1EDU A;  5DIZ A;  1S0P A;  2VGY A;  1EF1 C;  4UI9 C;  4WWO A;  3MCX A;  3L13 A;  3DPD A;  5G05 J;  4YND A;  2C0L A;  1BPO A;  2YQ8 A;  4DJA A;  1SQM A;  1HU3 A;  3LS8 A;  4G26 A;  4H7X A;  3TAX A;  5ARG A;  4OVV A;  3LYA A;  1JWF A;  2OVF A;  3RRN B;  3RRU A;  4AP2 A;  4GB9 A;  4BSX A;  4GYO A;  2V8S E;  2PQR A;  3I4G A;  4UI9 J;  4UWK A;  3UMV A;  2FI7 A;  3G2W A;  3FUJ A;  2RG8 A;  4A1G A;  1JPL A;  4F1S A;  3ULQ A;  2XRY A;  2Y4T A;  2XPY A;  3CK9 A;  4AIF A;  4EBA G;  1UJJ A;  1HO8 A;  3ZXS A;  2Q7F A;  4UWL A;  4GPK A;  4I6J A;  3LCA A;  3B7U X;  5KCM A;  1WM5 A;  2L6J A;  4FC8 A;  4JEH A;  3CHS A;  4ME2 A;  3AS5 A;  1EYH A;  5FQ8 A;  1B89 A;  3TG4 A;  3RK6 A;  3CVV A;  3CHO A;  2RD0 A;  4A1S A;  1INZ A;  2ION A;  3D9L A;  3RO2 A;  3SBS A;  4F7A A;  3PNL B;  3IHV A;  3D9I A;  5KJK A;  1SZA A;  3L16 A;  4AEZ C;  2VYI A;  4GZ6 A;  4YVO A;  3CK8 A;  4GZD A;  5ENN A;  3RU0 A;  2KZT B;  3NZS A;  3U64 A;  4GCN A;  3RRM B;  3FTS A;  4WNG A;  3APF A;  3CVQ A;  3ONL A;  3FUD A;  3SBT B;  4N3A A;  3URZ A;  4E85 A;  2WXJ A;  4FU3 A;  5FWQ A;  3TXN A;  4FAD A;  4BWR A;  3QWV A;  4KVM A;  1HG5 A;  2YHC A;  4PDX A;  3S7J A;  3PEV B;  3FTU A;  3O4Z A;  3OTN A;  2J4D A;  4BY6 A;  3ML8 A;  2WQ6 A;  4DLQ A;  3UPV A;  4ANX A;  5ARF A;  3CLJ A;  4KBQ A;  4TRQ A;  1JUQ A;  2WXN A;  2I6H A;  1PY1 A;  4I6G A;  5FQ7 A;  3D9J A;  4XKB A;  4J8D A;  3MGB A;  3VLF A;  3QDN A;  4G23 A;  4G11 A;  3Q15 A;  3CVP A;  4KVO A;  5FZR A;  4ILG A;  2PZI A;  3ZGQ A;  3FU0 A;  3PUJ A;  4U0S A;  5JJT A;  5FTP A;  4D10 C;  5BUZ A;  4JHR A;  4UWF A;  4ANV A;  5LP0 A;  5LX8 A;  3NZU A;  5HQ8 A;  5KJN A;  2AXZ A;  3ASG A;  4DLO A;  5M72 A;  2WXI A;  3FUL A;  2QY7 A;  3D9N A;  5FZS A;  3ZFW A;  3FU6 A;  4GAA A;  1Y6I A;  1NA0 A;  3Q5M A;  4L2Y A;  4FUL A;  5A7D B;  1H2V C;  4CCA A;  3UUX A;  4P29 A;  3APD A;  4CT4 A;  3MKQ B;  5CCM A;  1P5Q A;  3S7B A;  3OAW A;  3FTW A;  4C9B B;  1HS6 A;  1UN8 A;  1PAQ A;  4I1M A;  4J8F A;  2R5S A;  3GZ2 A;  5JJ7 A;  4N2S A;  3LEW A;  3LY9 A;  3PVL A;  3CHQ A;  3SGH A;  4WWP A;  5LCW J;  3P2B A;  2J9Q A;  2I2O A;  2CHW A;  3CVY A;  3PNT B;  5G04 C;  1IQU A;  4DI3 A;  3FU5 A;  3RKV A;  1VDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...