2NXPA

Structure of ntd2 domain of the human taf5 subunit of tfiid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
149
structure length
149
Chain Sequence
QPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 5
publication title Structural analysis and dimerization potential of the human TAF5 subunit of TFIID.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 45
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nxpA00
2J49A 2NXPA 2J4BA
chains in the Genus database with same CATH superfamily
2XENA 1N11A 2GRPB 5DIZA 3RK6A 3QC1A 3SZ7A 4DX2A 4FC8A 1DNPA 2IU1A 4XI0A 5ARGA 3K9IA 5AARA 2KZTB 4MLPA 3TWQA 1NA3A 3E4BA 1LTXA 2DZOA 4HB5A 3FUDA 4RQIA 1OWOA 4A1GA 3B7TA 2WXMA 3D3MA 3JYSA 1SZAA 2HE0A 4YNDA 5AQBA 2QYJA 2CHXA 4UQXA 2DCPA 3N71A 5HS0A 4WAFA 5M72A 4I1OB 4DLQA 2C0MA 4YDYA 5CMYA 4AJWA 4XIFA 3B7RL 4IYPA 4WWOA 4UWKA 4O1OA 4KZ0A 4KXKB 3IXEA 4U8YD 3O4ZA 5BXOA 3SBTB 3KSLA 2ZGGA 5FZSA 1BU9A 1Y8MA 3FH7A 2Y1LE 3EDTB 3L82A 3L16A 3ZKJA 4WNFA 1BI7B 5BNWA 4U04A 3VLDA 5ENSD 4JB8P 4O60A 3LDZA 3OTNA 1NZNA 3KEZA 2WMNA 3PE3A 3DEPA 3MCXA 2OCCE 4I2WA 3MV3B 3DPYA 3EHNA 4WWPA 4ZHBA 3ESLA 3VLEA 1QQEA 3CSTA 4LSZE 3B95A 4GAAA 3OXFA 2XRYA 5FWQA 2QZAA 5BT1A 4LNUD 4AV7A 4H7XA 2OOEA 1HH8A 2UY1A 3B7UX 2KZTA 3KS2A 2XS1A 3RRMB 4LEUA 1FVFA 1FVHA 4GTTA 4B89A 2PM7A 2WVIA 4EZLA 3Q7FA 4HNAD 3QDNA 4UWHA 1UG3A 2DIWA 5JMND 3G2UA 4I9EA 2JLBA 1JUQA 2V4HC 3AAAC 3JQ0A 2LUHA 1O1TA 4GPKA 3ZW3A 3TWUA 3CIAA 4K5BA 3DEOA 3PS6A 2LAHA 5FTPA 4APFA 4C0EA 5BV1A 3AS4A 4GYYA 3NOGD 4NACA 2HR2A 3ML8A 2BKKB 2WXRA 5G04C 3X2QE 3AG3E 2DWZA 4F1PA 3TAXA 3ZEFA 1O1SA 3LPZA 4IRUA 3U66A 2RKKA 3EHQA 3PRZA 3TG4A 2EQXA 1H0AA 2Y4UA 3JQ1A 3QWVA 3S2AA 1H6KA 5ANRA 5H7PA 3NB2A 1S63A 3UM2A 2IO2C 4GA2A 4LG6A 3FFLA 5EX0A 3TG5A 5FT9A 3F6QA 3Q78A 1KPSB 5JJ7A 4FLBA 5AQAA 4HS2A 3E34A 4EHMA 2WXGA 2AVPA 2NC9A 1TNBA 5BPPA 3APCA 3NAWA 1EF1C 1H2TC 3JCKC 3SFYA 3Q47B 2ILRA 4ZFHA 3T5XA 3WXXA 4J8YA 5B3SE 4GB9A 4DJAA 2V5FA 2CFZA 5CERB 4G25A 4EQFA 1HXIA 4EZKA 4KT6B 1MJ0A 3RSEG 4GPMA 2QC9A 3E37A 4MRUA 4Z68A 3Q7AA 1SW6A 1WAO1 1PAQA 4HQDA 1MX4A 4V3IA 4BFRA 3ULEG 5G55A 3HRAA 2ONDA 2FEZA 3FU0A 2H6HA 3ABME 2IOLA 4MS6A 3G2TA 1DCQA 2X3MA 4A55A 1S64A 4OVUA 2J4DA 3NZUA 3FY4A 2DBAA 2XHEA 2IO3C 3IV0A 3R9MA 2EILE 3AS5A 2CFUA 4B94A 1VDYA 4PS3A 4DLOA 1E8WA 2C2LA 5ENPD 3DWLG 1EYHA 2X6IA 3RU0A 1E8YA 3JXJA 1BLXB 1IYGA 4GZCA 4L1BA 1RZ4A 4JHKA 2V8SE 2XRZA 1XGWA 3LJNA 3ZHEA 4CCAA 1JWGA 3PZ2A 4D10C 2J8SD 2Q7FA 3HDXA 3CVYA 2WXJA 4IULA 4RVBA 1YA0A 1OWNA 2BF0X 3FWVA 3ISMC 2L0IA 3RAUA 3APDA 3FUHA 4F3VA 3NF1A 2P58C 2WPVA 3W9GA 4CGVA 2X6JA 2X6HA 5CEAA 4L2LA 2OVFA 2NSZA 2VGXB 4NRHB 1D9SA 1N4RA 1MZCA 5AIJA 1MX2A 4FU3A 3NBNB 3V2XA 3CKCA 3T9KA 2EINE 4IN3B 1SQMA 4ME2A 4HORA 4KYOB 3S7JA 3R7QA 4EZJA 3C5RA 3D9OA 4H7YA 5IY5E 2X6KA 1JCSA 3D9PA 2A5UA 2H6GA 2IFUA 3CSFA 1SA4A 1FT1A 3J5PA 4NQ0A 2VYIA 4YVQC 3L6AA 5CHEE 1IQUA 4JD2G 3FTVA 2WM9A 2WMOA 4LUNU 2KCLA 3LCAA 3CVPA 3BG0B 1ELKA 3SHFA 2JABA 1GW6A 1TNUA 3P1UA 3UIOC 2KM4A 3I4GA 1IQRA 3NQPA 3ZRHA 3MZLB 3EJNA 3KD7A 2Y0BG 3IEGA 4L9PA 4HOSA 3RJVA 5T8IA 3BQOA 3AS8A 3CHMA 1N54A 2HYZA 4HRLA 5CCLA 3TL5A 3DSWA 4I9CA 3V2OA 4J8EA 5LCWC 3PREA 1U3CA 3QJZA 4J6IA 1O5MA 2Y69E 2FULA 4GTPA 4XZ4A 2IOSA 4YDWA 3ASDA 3J5QB 3CEQA 3CHOA 3GZ2A 2IJGX 4APOA 4E6HA 2DVWA 1N95A 4N3BA 5EILA 3KAEA 1Z3YA 3CR3A 3UUXA 2X6FA 1LD8A 3IBEA 3HVEA 3Q49B 4BEPA 4XX5A 2H6FA 1QZ2A 3FTZA 4JEHA 5EIBE 4HRMB 4A63B 4L7TA 3LKUA 3Q75A 4O6FA 2V4LA 4N3AA 4RG6A 2EIJE 3FUFA 2VGXA 3L9TA 2AJAA 2IQCA 3S7FA 3V31A 3CVNA 3D9HA 4Q96A 2UY1B 2J9QA 5CRVA 4B8AA 3VLFA 4OAVB 2L0TB 5BV0A 2YHCA 4FHKA 4DX7D 2XPZA 5ANLA 1RW2A 1O1RA 3PNLB 2LNIA 1IHGA 3HXEA 4HBDA 1IHBA 3PH0C 2GRLA 3MKQB 4DPRA 4LNGA 1SA5A 4LNBA 2MOWA 5BUZA 2XEEA 4R7LA 3C98A 3Q9NC 3L13A 3SNXA 3I5PA 3ONLA 2QYUA 2V0PA 2CG2A 3FEXA 2XGSA 4F53A 2WXLA 2M63A 2P2CP 2VQ2A 4GYOA 2F37A 2KCVA 4AEZC 4JXTA 3Q9UC 5CECB 2YNQA 3UM0A 4I2ZA 1S0PA 1ELRA 2GGFA 2LXLA 3C3RA 1OT8A 4F1SA 1UW4B 4AOFA 2FO1E 2OEWA 1WG0A 3VTYA 4U07A 1YMPA 3OXGA 4K5AB 1FPPA 3E32A 4N2SA 3PVLA 4ACKA 4A3TA 5FQ6A 4U8VD 2WXNA 4KZCA 1WM5A 2ETBA 3QAQA 2L9BA 4AVXA 4Q69A 5ENTD 4M3OA 3G2WA 4O1PA 1HF8A 4TXPA 3ZVVA 3FDHA 3ZYLA 4BTAA 4UQYA 4JZYA 2FO7A 4CDNA 5CCMA 3FTUA 4BSZB 4L23A 4DX5D 5C2YA 3ASGA 4N2QA 5D0QD 2J4BA 5JHBA 3QB2A 2BEDA 3I4RB 3QK0A 5ENQD 4CEMA 2PM6A 3U4TA 4HI8A 4A1SA 5AJDA 5ITZF 4BESA 3PEVB 4N5CA 2VGEA 4B93B 3FUEA 3GW4A 5CBOA 3MKQA 3APFA 1N9AA 4N39A 3PUKA 3G2SA 2IONA 3ZFWA 2KBXA 1Q2ZA 2VTBB 2XEHA 3PZ4A 3PEUB 4ABNA 4CZ2D 5AN8A 1P5QA 3D9KA 3TWSA 3TJPA 3FTYA 3GZSA 5KNGA 3RO3A 4UWLA 2PNNA 3KSQA 5AENA 4FHJA 1H2UA 4UI9J 2VGYA 4U95D 4TUUA 1W3BA 4OAUC 4G1TA 4URKA 4OYSA 1HZ4A 3CKBA 4U0ZA 2L6JA 3LY7A 2XGMA 3MKRA 4BTBA 4J0UA 4B8CB 1IXVA 3FUIA 1HFAA 4NURA 3TXMA 3SFXA 1OWMA 4U8HA 3ABLE 2LAIA 3ZHEB 3VTXA 4ACLA 3GYZA 1N0RA 3Q73A 1K1BA 3ZGQA 1PC2A 4PUCA 4X8QA 4HLEA 2RG8A 3MJWA 4CT0A 2H6IA 1BI8B 3D9MA 1WY6A 4LERA 2OV8A 2BKGA 2P9PG 3L22A 2ZIRA 2J49A 2Y4TA 4HI9A 1LF8A 3AG4E 3CV0A 4JPSA 3DBSA 3DPDA 1HG5A 3RRNB 3FEYA 2OEVA 3ENEA 1N4PA 4P29A 1SVXA 5B1BE 1G3NB 4WNDA 3LJ3A 3LY9A 3ZU7B 1H6OA 5JJ6A 5A23A 1HS6A 2RFAA 1BD8A 2GRRB 2KXPC 3UPVA 1WDYA 5DBKA 1UJKA 2MYOA 5KJMA 3FUJA 3CK9A 4LCTA 4HVBA 2VTBA 1K1AA 5AQ9A 3ZYKA 1FCHA 5HRYA 5A7DB 2XQ0A 4UWFA 3D9LA 1U2VG 3HYMB 3PZDA 4GU5A 2X38A 5EKQD 2L6BA 1KZPA 3SFZA 1NL4A 1D8EA 4G23A 3FH8A 1OCZE 4ILHB 5CRUA 2RFMA 1OUVA 1TNYA 1K3ZD 4G11A 5FJYA 3RIBA 3UI2A 3S7DA 3CK7A 4JHRA 5C1DA 1TYQG 1D8DA 4ANVA 2AWIA 5KNHD 4KVOA 5FINA 5EYLA 4Q94A 3ZIMA 3FUKA 2F0YA 4AP2A 1XNFA 2P9UG 2B0OE 4HOTA 2WQ6A 2F8XK 1DC2A 3L54A 4I1MA 4MKTA 1N94A 4G8KA 3SI5A 4DX1A 4AY5A 3PE4A 1H19A 2YHEA 3HVEB 1TN8A 3U64A 3UINC 2FBNA 4I1AA 4ATGA 1UJJA 2JEKA 2YQ8A 3DSTA 4JEUA 1TNZA 3SGHA 1HE8A 4JC8A 3OAWA 3FTSA 3C3OA 3IHVA 3PUJA 3B13A 1K8KG 4N3CA 3AG2E 5FIOA 1Y6IA 1JCRA 5D66A 1IKND 2I6HA 4TUMA 3UT8A 2YINA 2ZXWE 2A5EA 3FU6A 2PL2A 4GZDA 4J7WA 1UOHA 1OCCE 5ENRD 3DXKG 1TN7A 3TWTA 2AXZA 4CT4A 3WG7E 4MBGA 4AXHA 3T5VA 4TV3A 1N4SA 3CGHA 4UUCA 2R17C 2P9SG 3CVQA 3FU5A 4HXIA 2DZNA 3CK8A 3CVWA 3SD5A 2GRQB 5EYPF 4ATZD 4DX6D 2R5SA 2P9KG 1OCOE 1NFIE 3QNKA 4GZ6A 2VSOE 3TWWA 3UT7A 5LFAA 2KATA 1TEZA 5JA4D 5FQ4A 1DCEA 3DRAA 2WQ7A 3HG0D 1HO8A 1QNFA 4BETA 1OXJA 3ZN3A 4J8DA 3JXIA 4JA9A 2ETCA 5EDSA 4TXQA 1TNOA 3UQ3A 1A5EA 2E2EA 2AXUA 3D9IA 4YDOA 1SZ9A 4J8FA 2Y3AA 2XS8A 3MX3A 3T8KA 5J08A 2WXKA 3LVQE 3Q15A 4YVOA 3QOUA 3UKRG 3LYAA 1TR4A 3TXNA 5EN5D 1NI1A 1MQSA 4FP7A 1UN8A 3UXGA 3AG1E 4WWNA 1OWLA 5CMWA 2KCKA 4G26A 4CYMD 4K03A 2I1KA 4JHJA 2HM8A 3ZXSA 1ELWA 3ZYQA 3B7BA 5E75A 2IF4A 1JWFA 1E8XA 3LS8A 1BPOA 4JW1A 3CHRA 4TXRA 3FH5A 4G2VA 4DUIA 3BEEA 1EDUA 4C9BB 4CRWA 2P9LG 2J08A 2VSNA 4F7AA 4OVVA 3ZYMA 3V79K 4N5QA 1KT1A 4JVSA 3CVXA 2J09A 5FQ7A 4CDMA 1Z6TA 2XGOA 4DI4A 4HFGA 1TN6A 5J90A 1OWPA 2WXHA 2R2LA 2WQHA 2XZTG 3UTMA 1L5JA 4GCOA 3S7BA 3LVRE 3AU5A 1S70B 4GTVA 4UI9K 3Q79A 3ULYA 2WXQA 4F6RD 1TJCA 2GRMA 2KC7A 4QQIA 4UWGA 5HKPA 2R03A 1Z5SC 3D9JA 1N0QA 1E7VA 5D2MC 4I6JA 4BY6A 5G04J 3DSXA 3HXCA 2J07A 2WXPA 4AM9A 2XCBA 1MX6A 2EIME 1N4QA 4BX9A 3E30A 5A6CA 4GTSA 2FI7A 2XPIA 1X5BA 4CDRA 4Y6WA 4JA7A 4GCNA 3ONKA 4I17A 3EUVA 4GZ3A 1B89A 3ZXPA 4M7CA 2VJ8A 3EIQC 4FLHA 3FP3A 3BUAA 2LXMA 5AQ7A 2P9NG 3SF4A 4G8LA 1U3DA 4BT9A 3LEWA 4BT8A 3D9NA 2R02A 4GTRA 2QY7A 4U0SA 4FJYA 4PH4B 1AWCB 2GRNB 3CHPA 3ZNGA 1V54E 1QYMA 3C3QA 1DVPA 5AJLA 2I1JA 1FT2A 4KBQA 1H2VC 4GA1A 4A3VA 2R05A 4GMJA 5LP0A 5JJTA 1QBQA 2GROB 3HXFA 3RRUA 5EX3A 4XE0A 3GZ1A 1OY3D 5LX8A 3MV2B 3UM3A 4I6EA 5B1AE 3CVVA 1JCQA 2V5QC 3EHMA 1X81A 3CVLA 3EIJA 2CHWA 3PZ1A 3TWXA 3NOCD 1KLXA 3RKVA 5HQ8A 5FZRA 2AXVA 4DI3A 4U0UA 1N52A 3OXLA 2XZDG 5D0OD 5FQ8A 4XKCA 3EU9A 3PZ3A 5BW8C 3PDNA 3BG1B 4ILGA 1ZU2A 4XKBA 3EU5A 5T4YA 3CHSA 3ASOE 3CLJA 4GMLA 1ZBPA 3ESKA 4FADA 4PS8A 5ENNA 5G05J 3CHQA 5KBAA 3L08A 3IHYA 2F8YA 3HXDA 3JUIA 3UT4A 3Q4AB 2I2OA 5FZQA 1JPLA 4GTQA 3ASNE 3QARA 3RO2A 1E90A 3CQCB 3W9FA 2ZISA 4K0RA 4U63A 3I3NA 3V30A 4CGWA 4AIFA 2ZGDA 2E0IA 2B6CA 5EIDA 4E85A 3TWVA 3MYVA 2AW6A 4C48B 4BSXA 4GZ5A 2P9IG 2LO6A 2XPYA 5KJNA 4KVMA 4BERA 1EPUA 4HRNA 4XI9A 1YCSB 2VSYA 3QKYA 2VSXE 3UMVA 4JL0A 2BTDA 2XCCA 4HOUA 3FUMA 5T3RA 3P2BA 1V55E 4Y6CA 3UX4A 1NA0A 5CEDB 3HIZA 5KWDA 1OCRE 3R7RA 1LD7A 3NZSA 2R59A 2WXIA 2CHZA 3FTWA 4FJZA 2HO1A 2A4ZA 3FU3A 4BX8A 3IKOB 3HXBA 4J8SA 3DSVA 3ML9A 3FULA 3FHEA 5E76A 3CVUA 2IY0C 4GYWA 2UWJG 2RD0A 1TJFA 2QFCA 5LCWJ 3R9AB 1ZB1A 3UIPC 2MRIA 3SBSA 3B7SA 2ETAA 4U96D 4EBAA 5HI7A 2I9CA 2WXOA 4UI9C 4WUYA 4I43A 3U3WA 3SQVA 3DSUA 2OVBA 2WB2A 1HX8A 3ABKE 5KJKA 5CBNA 5G2NA 4RSYA 3LXUX 4BWRA 3ASFA 2WXFA 3SY2A 2NXPA 4ANXA 4GTMA 5G05C 1Z3XA 3CQGB 3JUEA 2PQRA 4W9RA 3UM1A 3E33A 2ZU6B 1E7UA 2DYRE 2LSUA 3URZA 3QWPA 3T8MA 2GW1A 4EECA 4G24A 2CG3A 4FULA 4GTOA 4GA0A 3MA5A 3TGOA 5LOZA 3FTXA 2MHKA 1HU3A 4ANWA 4NIKA 4LRZA 2LSVA 3EHRA 1YYHA 1H6PA 4K5CA 3MEKA 4DRXE 1INZA 4ANUA 1MHQA 1KZOA 4AY6A 5AAOA 1MYOA 5KJLA 1KT0A 4WNEA 3PNTB 4PS7A 3QWWA 4XEIG 1PY1A 3O48A 4L2YA 3MGBA 1E8ZA 2NYJA 4PDXA 2DYSE 4C0MA 4RG9A 3AJIA 3BU8A 2EIKE 3UKUG 3ZUVB 4EPZA 4UQZA 3DXMG 2IEJA 4ILIA 3ZPJA 5ARFA 3AU4A 4HOQA 1NP7A 3LY8A 4KMOA 3ASHA 3HHMA 4TRQA 4U7EB 3SO8A 5JHAA 4DK5A 2PZIA 2BUGA 5ENOD 3G2VA 3L17A 4FA6A 3TWRA 4GMRA 3DSSA 3KEAA 4QFVA 3U9WA 4YDEA 3C72A 4I6GA 1HG2A 1E96B 5KCMA 4WNGA 2PQNA 2C0LA 3ULQA 4EBAG 1A17A 3Q5MA 5BXUA 4HLLA 1UN9A 4RLYA 2FF4A 3FUNA 4B0ZA 2XEVA 1AP7A 5AYWD
chains in the Genus database with same CATH topology
3CHPA 2VGXB 4NRHB 5DIZA 3RK6A 3QC1A 3SZ7A 1DVPA 3DBSA 5AJLA 3DPDA 4FC8A 1HG5A 3RRNB 5AIJA 1DNPA 2I1JA 4KBQA 3FEYA 1H2VC 4FU3A 2IU1A 4GA1A 4XI0A 5ARGA 3ENEA 4A3VA 3K9IA 3CKCA 2KZTB 4GMJA 5LP0A 4P29A 5FZRA 4IN3B 1SQMA 4ME2A 4MLPA 4HORA 5JJTA 4KYOB 3S7JA 3R7QA 4WNDA 3LJ3A 3LY9A 1NA3A 3RRUA 4EZJA 3D9OA 4H7YA 5EX3A 3E4BA 2X6KA 4XE0A 5JJ6A 3GZ1A 3D9PA 5A23A 1HS6A 5LX8A 2A5UA 3FUDA 2IFUA 3MV2B 1OWOA 3CSFA 4A1GA 4I6EA 3B7TA 2WXMA 4NQ0A 2VYIA 4YVQC 3CVVA 3UPVA 5DBKA 1UJKA 3D3MA 3JYSA 3L6AA 1SZAA 5CHEE 1IQUA 4YNDA 3EHMA 2CHXA 4UQXA 3FUJA 5KJMA 3CK9A 3FTVA 4LCTA 4HVBA 3CVLA 2DCPA 2WM9A 2WMOA 3EIJA 2VTBA 4LUNU 2CHWA 2KCLA 3LCAA 3ZYKA 3CVPA 1FCHA 3BG0B 3N71A 1KLXA 1ELKA 3SHFA 1GW6A 5A7DB 4WAFA 2XQ0A 4UWFA 4I1OB 5M72A 3RKVA 3D9LA 5HQ8A 2AXVA 3HYMB 3P1UA 3PZDA 2KM4A 3I4GA 1IQRA 2X38A 3NQPA 4GU5A 3MZLB 5EKQD 3EJNA 4U0UA 3ZRHA 1N52A 4DI3A 3KD7A 4DLQA 2C0MA 5CMYA 3IEGA 3SFZA 3OXLA 4HOSA 4G23A 3RJVA 5T8IA 3FH8A 5D0OD 5FQ8A 4AJWA 4ILHB 4XIFA 4XKCA 5BW8C 3PDNA 3AS8A 3CHMA 3BG1B 1OUVA 4ILGA 1ZU2A 4G11A 1N54A 5FJYA 2HYZA 4XKBA 3RIBA 5T4YA 3B7RL 5CCLA 4IYPA 3S7DA 3TL5A 4I9CA 3CHSA 3CK7A 4J8EA 4UWKA 4JHRA 4WWOA 5C1DA 4KZ0A 5LCWC 4ANVA 2AWIA 3CLJA 4GMLA 3PREA 1ZBPA 4KVOA 1U3CA 3QJZA 4KXKB 4Q94A 3ESKA 3ZIMA 3O4ZA 3FUKA 4J6IA 3SBTB 4AP2A 1XNFA 4FADA 2FULA 4PS8A 4XZ4A 5FZSA 2IOSA 5ENNA 5G05J 3CHQA 3ASDA 4HOTA 2WQ6A 3CEQA 3CHOA 1Y8MA 3FH7A 3L08A 3IHYA 3GZ2A 3EDTB 3L54A 3JUIA 3L16A 4I1MA 3UT4A 3Q4AB 2IJGX 4APOA 4MKTA 2I2OA 4E6HA 5FZQA 1JPLA 4WNFA 3SI5A 5BNWA 4U04A 3VLDA 4AY5A 3PE4A 4N3BA 3QARA 3KAEA 3RO2A 1E90A 3CQCB 1H19A 2YHEA 1Z3YA 3LDZA 3CR3A 3OTNA 1NZNA 3HVEB 3KEZA 2X6FA 3UUXA 4K0RA 3U64A 4U63A 3I3NA 3IBEA 3HVEA 2FBNA 2WMNA 3Q49B 4AIFA 4CGWA 4I1AA 4ATGA 1UJJA 2JEKA 3PE3A 3MCXA 4XX5A 2YQ8A 4JEUA 3SGHA 2E0IA 1QZ2A 3FTZA 1HE8A 4I2WA 4E85A 3MV3B 4JEHA 3OAWA 3EHNA 4JC8A 4WWPA 3MYVA 3FTSA 2AW6A 3IHVA 3PUJA 4L7TA 3LKUA 4O6FA 2V4LA 3ESLA 4N3AA 3VLEA 4BSXA 1QQEA 3B13A 3CSTA 4N3CA 4RG6A 4GZ5A 4GAAA 3FUFA 1Y6IA 2VGXA 3OXFA 2LO6A 2XRYA 5FWQA 2IQCA 3S7FA 3CVNA 2XPYA 5BT1A 2I6HA 5KJNA 4KVMA 1EPUA 3UT8A 2YINA 4H7XA 4Q96A 4AV7A 2UY1B 2J9QA 2OOEA 1HH8A 4B8AA 3VLFA 3FU6A 2PL2A 2UY1A 2KZTA 3B7UX 4GZDA 2L0TB 3KS2A 5BV0A 3RRMB 2YHCA 4FHKA 4LEUA 2XPZA 1FVFA 5ANLA 1FVHA 2AXZA 4CT4A 4XI9A 3PNLB 4B89A 2PM7A 2LNIA 2VSYA 2WVIA 4EZLA 4AXHA 3QKYA 2VSXE 3T5VA 4TV3A 1IHGA 3UMVA 3CGHA 4JL0A 3QDNA 4UWHA 2R17C 2BTDA 1UG3A 2DIWA 2XCCA 4HOUA 3CVQA 3G2UA 3FUMA 5T3RA 3FU5A 4I9EA 3P2BA 2JLBA 1JUQA 3PH0C 4HXIA 2GRLA 3MKQB 4DPRA 3CK8A 3CVWA 4Y6CA 3SD5A 3UX4A 3JQ0A 2R5SA 1NA0A 2MOWA 3HIZA 5BUZA 4R7LA 4GPKA 3C98A 3R7RA 3ZW3A 3QNKA 4GZ6A 2VSOE 3CIAA 3NZSA 3L13A 3UT7A 3SNXA 3I5PA 2R59A 5LFAA 3PS6A 2LAHA 2WXIA 3ONLA 2KATA 5FTPA 2CHZA 3FTWA 1TEZA 4APFA 4C0EA 5BV1A 4FJZA 5FQ4A 2HO1A 2A4ZA 3FU3A 2V0PA 3AS4A 4GYYA 2CG2A 4BX8A 3IKOB 4NACA 3FEXA 4J8SA 2XGSA 2HR2A 4F53A 3ML8A 2WQ7A 3ML9A 1HO8A 1QNFA 2WXLA 3FULA 2M63A 2WXRA 2VQ2A 4GYOA 3FHEA 4J8DA 5G04C 3ZN3A 5E76A 4JA9A 3CVUA 2KCVA 4AEZC 4JXTA 4GYWA 5EDSA 3TAXA 3UQ3A 2UWJG 3ZEFA 2RD0A 1TJFA 2E2EA 2QFCA 2YNQA 5LCWJ 3R9AB 2AXUA 2MRIA 1S0PA 3LPZA 1ELRA 4I2ZA 3SBSA 3D9IA 3B7SA 4IRUA 3U66A 1SZ9A 4J8FA 2GGFA 2Y3AA 4EBAA 3PRZA 5HI7A 3TG4A 2EQXA 2I9CA 1H0AA 2Y4UA 2WXOA 3JQ1A 3MX3A 3QWVA 4UI9C 3S2AA 5J08A 4WUYA 1H6KA 4I43A 3U3WA 2WXKA 5ANRA 3LVQE 3Q15A 2OVBA 4YVOA 3QOUA 2WB2A 1HX8A 4F1SA 4GA2A 1UW4B 5KJKA 3FFLA 5EX0A 4AOFA 3LYAA 3TG5A 3TXNA 5FT9A 1MQSA 4FP7A 5G2NA 1UN8A 4RSYA 3LXUX 3VTYA 4WWNA 3ASFA 4BWRA 5JJ7A 1OWLA 4FLBA 4U07A 2WXFA 4HS2A 2NXPA 3OXGA 4ANXA 5CMWA 2KCKA 4G26A 5G05C 1Z3XA 4K03A 2I1KA 3CQGB 4JHJA 2WXGA 2HM8A 2AVPA 2PQRA 4N2SA 3PVLA 2NC9A 3ZXSA 4W9RA 4ACKA 1ELWA 4A3TA 5BPPA 5FQ6A 3ZYQA 2ZU6B 1E7UA 2WXNA 5E75A 2IF4A 3APCA 1JWFA 2LSUA 1EF1C 4KZCA 3URZA 3QWPA 3T8MA 1E8XA 1WM5A 3QAQA 1H2TC 3JCKC 3LS8A 3Q47B 2L9BA 2ILRA 2GW1A 4AVXA 4Q69A 4M3OA 3G2WA 1BPOA 1HF8A 3ZVVA 3T5XA 3WXXA 4EECA 3FDHA 4G24A 4JW1A 3CHRA 3ZYLA 3FH5A 4BTAA 2CG3A 4UQYA 4G2VA 4FULA 3BEEA 4GB9A 4JZYA 2FO7A 1EDUA 4GA0A 4C9BB 4CDNA 5CCMA 3FTUA 4DJAA 3MA5A 4CRWA 2J08A 2V5FA 2VSNA 2CFZA 4F7AA 4OVVA 3ZYMA 3TGOA 4L23A 5LOZA 1KT1A 5C2YA 3ASGA 4N2QA 4JVSA 3CVXA 2J09A 5D0QD 4G25A 4EQFA 2J4BA 5JHBA 1HXIA 3FTXA 2MHKA 1HU3A 4EZKA 3QB2A 5FQ7A 4ANWA 1Z6TA 4CDMA 2XGOA 4DI4A 4HFGA 4KT6B 3I4RB 3QK0A 5J90A 4LRZA 4CEMA 2PM6A 3U4TA 4MRUA 1OWPA 2WXHA 4A1SA 5AJDA 2LSVA 2WQHA 1WAO1 3PEVB 1PAQA 4N5CA 4V3IA 1L5JA 4BFRA 3FUEA 3MEKA 4GCOA 5G55A 3GW4A 3LVRE 3S7BA 1INZA 3AU5A 4ANUA 3MKQA 2ONDA 3APFA 4UI9K 2FEZA 1MHQA 3FU0A 4AY6A 4N39A 2WXQA 3PUKA 1TJCA 2IOLA 3G2SA 4MS6A 2IONA 3G2TA 2GRMA 2KC7A 2X3MA 3ZFWA 5KJLA 4A55A 1KT0A 4WNEA 4UWGA 3D9JA 3PNTB 4PS7A 3QWWA 4OVUA 1E7VA 2J4DA 2VTBB 4I6JA 3NZUA 3FY4A 4BY6A 3PEUB 1PY1A 4ABNA 3O48A 4L2YA 3MGBA 1E8ZA 5G04J 2DBAA 4PDXA 2XHEA 2J07A 1P5QA 2WXPA 4AM9A 2XCBA 4RG9A 4C0MA 3D9KA 3IV0A 3TJPA 4BX9A 3FTYA 3AS5A 2CFUA 4B94A 1VDYA 3GZSA 4PS3A 4DLOA 1E8WA 3RO3A 4EPZA 5A6CA 4UWLA 2FI7A 4UQZA 2C2LA 5AENA 2XPIA 1EYHA 1X5BA 4FHJA 4ILIA 4CDRA 1H2UA 4Y6WA 4JA7A 2X6IA 4UI9J 2VGYA 4TUUA 3RU0A 3ZPJA 1W3BA 5ARFA 3AU4A 1E8YA 4G1TA 4OYSA 4URKA 1HZ4A 3CKBA 4GCNA 2L6JA 4HOQA 4U0ZA 1IYGA 3ONKA 4I17A 3LY7A 2XGMA 4GZ3A 1NP7A 1B89A 3LY8A 4KMOA 3MKRA 4BTBA 4J0UA 4B8CB 4GZCA 3ASHA 3FUIA 3HHMA 2VJ8A 4TRQA 1HFAA 4NURA 4L1BA 3TXMA 5JHAA 3EIQC 1OWMA 4JHKA 4DK5A 2V8SE 4FLHA 3FP3A 2XRZA 2PZIA 2BUGA 4U8HA 1XGWA 3G2VA 2LAIA 3L17A 3VTXA 3ZHEB 3SF4A 4ACLA 3GYZA 4FA6A 3ZHEA 4CCAA 1U3DA 3ZGQA 4BT9A 3LEWA 1PC2A 4PUCA 4BT8A 3D9NA 1JWGA 4D10C 2Q7FA 4HLEA 2RG8A 3HDXA 3MJWA 4CT0A 3CVYA 2WXJA 4IULA 4RVBA 1YA0A 1OWNA 2BF0X 2QY7A 3FWVA 4QFVA 3D9MA 3U9WA 4U0SA 1WY6A 2L0IA 4LERA 4FJYA 4I6GA 3APDA 1HG2A 2OV8A 1E96B 3FUHA 3NF1A 5KCMA 2P58C 4WNGA 4F3VA 2PQNA 2C0LA 2WPVA 3ULQA 4EBAG 3L22A 4CGVA 2X6JA 2J49A 2Y4TA 1A17A 3Q5MA 1LF8A 2X6HA 4PH4B 1UN9A 3CV0A 2FF4A 3FUNA 4L2LA 4JPSA 4B0ZA 2XEVA 2OVFA 2NSZA 5AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J49 A;  2NXP A;  2J4B A; 
#chains in the Genus database with same CATH topology
 2XEN A;  1N11 A;  2GRP B;  5DIZ A;  3RK6 A;  3QC1 A;  3SZ7 A;  4DX2 A;  4FC8 A;  1DNP A;  2IU1 A;  4XI0 A;  5ARG A;  3K9I A;  5AAR A;  2KZT B;  4MLP A;  3TWQ A;  1NA3 A;  3E4B A;  1LTX A;  2DZO A;  4HB5 A;  3FUD A;  4RQI A;  1OWO A;  4A1G A;  3B7T A;  2WXM A;  3D3M A;  3JYS A;  1SZA A;  2HE0 A;  4YND A;  5AQB A;  2QYJ A;  2CHX A;  4UQX A;  2DCP A;  3N71 A;  5HS0 A;  4WAF A;  5M72 A;  4I1O B;  4DLQ A;  2C0M A;  4YDY A;  5CMY A;  4AJW A;  4XIF A;  3B7R L;  4IYP A;  4WWO A;  4UWK A;  4O1O A;  4KZ0 A;  4KXK B;  3IXE A;  4U8Y D;  3O4Z A;  5BXO A;  3SBT B;  3KSL A;  2ZGG A;  5FZS A;  1BU9 A;  1Y8M A;  3FH7 A;  2Y1L E;  3EDT B;  3L82 A;  3L16 A;  3ZKJ A;  4WNF A;  1BI7 B;  5BNW A;  4U04 A;  3VLD A;  5ENS D;  4JB8 P;  4O60 A;  3LDZ A;  3OTN A;  1NZN A;  3KEZ A;  2WMN A;  3PE3 A;  3DEP A;  3MCX A;  2OCC E;  4I2W A;  3MV3 B;  3DPY A;  3EHN A;  4WWP A;  4ZHB A;  3ESL A;  3VLE A;  1QQE A;  3CST A;  4LSZ E;  3B95 A;  4GAA A;  3OXF A;  2XRY A;  5FWQ A;  2QZA A;  5BT1 A;  4LNU D;  4AV7 A;  4H7X A;  2OOE A;  1HH8 A;  2UY1 A;  3B7U X;  2KZT A;  3KS2 A;  2XS1 A;  3RRM B;  4LEU A;  1FVF A;  1FVH A;  4GTT A;  4B89 A;  2PM7 A;  2WVI A;  4EZL A;  3Q7F A;  4HNA D;  3QDN A;  4UWH A;  1UG3 A;  2DIW A;  5JMN D;  3G2U A;  4I9E A;  2JLB A;  1JUQ A;  2V4H C;  3AAA C;  3JQ0 A;  2LUH A;  1O1T A;  4GPK A;  3ZW3 A;  3TWU A;  3CIA A;  4K5B A;  3DEO A;  3PS6 A;  2LAH A;  5FTP A;  4APF A;  4C0E A;  5BV1 A;  3AS4 A;  4GYY A;  3NOG D;  4NAC A;  2HR2 A;  3ML8 A;  2BKK B;  2WXR A;  5G04 C;  3X2Q E;  3AG3 E;  2DWZ A;  4F1P A;  3TAX A;  3ZEF A;  1O1S A;  3LPZ A;  4IRU A;  3U66 A;  2RKK A;  3EHQ A;  3PRZ A;  3TG4 A;  2EQX A;  1H0A A;  2Y4U A;  3JQ1 A;  3QWV A;  3S2A A;  1H6K A;  5ANR A;  5H7P A;  3NB2 A;  1S63 A;  3UM2 A;  2IO2 C;  4GA2 A;  4LG6 A;  3FFL A;  5EX0 A;  3TG5 A;  5FT9 A;  3F6Q A;  3Q78 A;  1KPS B;  5JJ7 A;  4FLB A;  5AQA A;  4HS2 A;  3E34 A;  4EHM A;  2WXG A;  2AVP A;  2NC9 A;  1TNB A;  5BPP A;  3APC A;  3NAW A;  1EF1 C;  1H2T C;  3JCK C;  3SFY A;  3Q47 B;  2ILR A;  4ZFH A;  3T5X A;  3WXX A;  4J8Y A;  5B3S E;  4GB9 A;  4DJA A;  2V5F A;  2CFZ A;  5CER B;  4G25 A;  4EQF A;  1HXI A;  4EZK A;  4KT6 B;  1MJ0 A;  3RSE G;  4GPM A;  2QC9 A;  3E37 A;  4MRU A;  4Z68 A;  3Q7A A;  1SW6 A;  1WAO 1;  1PAQ A;  4HQD A;  1MX4 A;  4V3I A;  4BFR A;  3ULE G;  5G55 A;  3HRA A;  2OND A;  2FEZ A;  3FU0 A;  2H6H A;  3ABM E;  2IOL A;  4MS6 A;  3G2T A;  1DCQ A;  2X3M A;  4A55 A;  1S64 A;  4OVU A;  2J4D A;  3NZU A;  3FY4 A;  2DBA A;  2XHE A;  2IO3 C;  3IV0 A;  3R9M A;  2EIL E;  3AS5 A;  2CFU A;  4B94 A;  1VDY A;  4PS3 A;  4DLO A;  1E8W A;  2C2L A;  5ENP D;  3DWL G;  1EYH A;  2X6I A;  3RU0 A;  1E8Y A;  3JXJ A;  1BLX B;  1IYG A;  4GZC A;  4L1B A;  1RZ4 A;  4JHK A;  2V8S E;  2XRZ A;  1XGW A;  3LJN A;  3ZHE A;  4CCA A;  1JWG A;  3PZ2 A;  4D10 C;  2J8S D;  2Q7F A;  3HDX A;  3CVY A;  2WXJ A;  4IUL A;  4RVB A;  1YA0 A;  1OWN A;  2BF0 X;  3FWV A;  3ISM C;  2L0I A;  3RAU A;  3APD A;  3FUH A;  4F3V A;  3NF1 A;  2P58 C;  2WPV A;  3W9G A;  4CGV A;  2X6J A;  2X6H A;  5CEA A;  4L2L A;  2OVF A;  2NSZ A;  2VGX B;  4NRH B;  1D9S A;  1N4R A;  1MZC A;  5AIJ A;  1MX2 A;  4FU3 A;  3NBN B;  3V2X A;  3CKC A;  3T9K A;  2EIN E;  4IN3 B;  1SQM A;  4ME2 A;  4HOR A;  4KYO B;  3S7J A;  3R7Q A;  4EZJ A;  3C5R A;  3D9O A;  4H7Y A;  5IY5 E;  2X6K A;  1JCS A;  3D9P A;  2A5U A;  2H6G A;  2IFU A;  3CSF A;  1SA4 A;  1FT1 A;  3J5P A;  4NQ0 A;  2VYI A;  4YVQ C;  3L6A A;  5CHE E;  1IQU A;  4JD2 G;  3FTV A;  2WM9 A;  2WMO A;  4LUN U;  2KCL A;  3LCA A;  3CVP A;  3BG0 B;  1ELK A;  3SHF A;  2JAB A;  1GW6 A;  1TNU A;  3P1U A;  3UIO C;  2KM4 A;  3I4G A;  1IQR A;  3NQP A;  3ZRH A;  3MZL B;  3EJN A;  3KD7 A;  2Y0B G;  3IEG A;  4L9P A;  4HOS A;  3RJV A;  5T8I A;  3BQO A;  3AS8 A;  3CHM A;  1N54 A;  2HYZ A;  4HRL A;  5CCL A;  3TL5 A;  3DSW A;  4I9C A;  3V2O A;  4J8E A;  5LCW C;  3PRE A;  1U3C A;  3QJZ A;  4J6I A;  1O5M A;  2Y69 E;  2FUL A;  4GTP A;  4XZ4 A;  2IOS A;  4YDW A;  3ASD A;  3J5Q B;  3CEQ A;  3CHO A;  3GZ2 A;  2IJG X;  4APO A;  4E6H A;  2DVW A;  1N95 A;  4N3B A;  5EIL A;  3KAE A;  1Z3Y A;  3CR3 A;  3UUX A;  2X6F A;  1LD8 A;  3IBE A;  3HVE A;  3Q49 B;  4BEP A;  4XX5 A;  2H6F A;  1QZ2 A;  3FTZ A;  4JEH A;  5EIB E;  4HRM B;  4A63 B;  4L7T A;  3LKU A;  3Q75 A;  4O6F A;  2V4L A;  4N3A A;  4RG6 A;  2EIJ E;  3FUF A;  2VGX A;  3L9T A;  2AJA A;  2IQC A;  3S7F A;  3V31 A;  3CVN A;  3D9H A;  4Q96 A;  2UY1 B;  2J9Q A;  5CRV A;  4B8A A;  3VLF A;  4OAV B;  2L0T B;  5BV0 A;  2YHC A;  4FHK A;  4DX7 D;  2XPZ A;  5ANL A;  1RW2 A;  1O1R A;  3PNL B;  2LNI A;  1IHG A;  3HXE A;  4HBD A;  1IHB A;  3PH0 C;  2GRL A;  3MKQ B;  4DPR A;  4LNG A;  1SA5 A;  4LNB A;  2MOW A;  5BUZ A;  2XEE A;  4R7L A;  3C98 A;  3Q9N C;  3L13 A;  3SNX A;  3I5P A;  3ONL A;  2QYU A;  2V0P A;  2CG2 A;  3FEX A;  2XGS A;  4F53 A;  2WXL A;  2M63 A;  2P2C P;  2VQ2 A;  4GYO A;  2F37 A;  2KCV A;  4AEZ C;  4JXT A;  3Q9U C;  5CEC B;  2YNQ A;  3UM0 A;  4I2Z A;  1S0P A;  1ELR A;  2GGF A;  2LXL A;  3C3R A;  1OT8 A;  4F1S A;  1UW4 B;  4AOF A;  2FO1 E;  2OEW A;  1WG0 A;  3VTY A;  4U07 A;  1YMP A;  3OXG A;  4K5A B;  1FPP A;  3E32 A;  4N2S A;  3PVL A;  4ACK A;  4A3T A;  5FQ6 A;  4U8V D;  2WXN A;  4KZC A;  1WM5 A;  2ETB A;  3QAQ A;  2L9B A;  4AVX A;  4Q69 A;  5ENT D;  4M3O A;  3G2W A;  4O1P A;  1HF8 A;  4TXP A;  3ZVV A;  3FDH A;  3ZYL A;  4BTA A;  4UQY A;  4JZY A;  2FO7 A;  4CDN A;  5CCM A;  3FTU A;  4BSZ B;  4L23 A;  4DX5 D;  5C2Y A;  3ASG A;  4N2Q A;  5D0Q D;  2J4B A;  5JHB A;  3QB2 A;  2BED A;  3I4R B;  3QK0 A;  5ENQ D;  4CEM A;  2PM6 A;  3U4T A;  4HI8 A;  4A1S A;  5AJD A;  5ITZ F;  4BES A;  3PEV B;  4N5C A;  2VGE A;  4B93 B;  3FUE A;  3GW4 A;  5CBO A;  3MKQ A;  3APF A;  1N9A A;  4N39 A;  3PUK A;  3G2S A;  2ION A;  3ZFW A;  2KBX A;  1Q2Z A;  2VTB B;  2XEH A;  3PZ4 A;  3PEU B;  4ABN A;  4CZ2 D;  5AN8 A;  1P5Q A;  3D9K A;  3TWS A;  3TJP A;  3FTY A;  3GZS A;  5KNG A;  3RO3 A;  4UWL A;  2PNN A;  3KSQ A;  5AEN A;  4FHJ A;  1H2U A;  4UI9 J;  2VGY A;  4U95 D;  4TUU A;  1W3B A;  4OAU C;  4G1T A;  4URK A;  4OYS A;  1HZ4 A;  3CKB A;  4U0Z A;  2L6J A;  3LY7 A;  2XGM A;  3MKR A;  4BTB A;  4J0U A;  4B8C B;  1IXV A;  3FUI A;  1HFA A;  4NUR A;  3TXM A;  3SFX A;  1OWM A;  4U8H A;  3ABL E;  2LAI A;  3ZHE B;  3VTX A;  4ACL A;  3GYZ A;  1N0R A;  3Q73 A;  1K1B A;  3ZGQ A;  1PC2 A;  4PUC A;  4X8Q A;  4HLE A;  2RG8 A;  3MJW A;  4CT0 A;  2H6I A;  1BI8 B;  3D9M A;  1WY6 A;  4LER A;  2OV8 A;  2BKG A;  2P9P G;  3L22 A;  2ZIR A;  2J49 A;  2Y4T A;  4HI9 A;  1LF8 A;  3AG4 E;  3CV0 A;  4JPS A;  3DBS A;  3DPD A;  1HG5 A;  3RRN B;  3FEY A;  2OEV A;  3ENE A;  1N4P A;  4P29 A;  1SVX A;  5B1B E;  1G3N B;  4WND A;  3LJ3 A;  3LY9 A;  3ZU7 B;  1H6O A;  5JJ6 A;  5A23 A;  1HS6 A;  2RFA A;  1BD8 A;  2GRR B;  2KXP C;  3UPV A;  1WDY A;  5DBK A;  1UJK A;  2MYO A;  5KJM A;  3FUJ A;  3CK9 A;  4LCT A;  4HVB A;  2VTB A;  1K1A A;  5AQ9 A;  3ZYK A;  1FCH A;  5HRY A;  5A7D B;  2XQ0 A;  4UWF A;  3D9L A;  1U2V G;  3HYM B;  3PZD A;  4GU5 A;  2X38 A;  5EKQ D;  2L6B A;  1KZP A;  3SFZ A;  1NL4 A;  1D8E A;  4G23 A;  3FH8 A;  1OCZ E;  4ILH B;  5CRU A;  2RFM A;  1OUV A;  1TNY A;  1K3Z D;  4G11 A;  5FJY A;  3RIB A;  3UI2 A;  3S7D A;  3CK7 A;  4JHR A;  5C1D A;  1TYQ G;  1D8D A;  4ANV A;  2AWI A;  5KNH D;  4KVO A;  5FIN A;  5EYL A;  4Q94 A;  3ZIM A;  3FUK A;  2F0Y A;  4AP2 A;  1XNF A;  2P9U G;  2B0O E;  4HOT A;  2WQ6 A;  2F8X K;  1DC2 A;  3L54 A;  4I1M A;  4MKT A;  1N94 A;  4G8K A;  3SI5 A;  4DX1 A;  4AY5 A;  3PE4 A;  1H19 A;  2YHE A;  3HVE B;  1TN8 A;  3U64 A;  3UIN C;  2FBN A;  4I1A A;  4ATG A;  1UJJ A;  2JEK A;  2YQ8 A;  3DST A;  4JEU A;  1TNZ A;  3SGH A;  1HE8 A;  4JC8 A;  3OAW A;  3FTS A;  3C3O A;  3IHV A;  3PUJ A;  3B13 A;  1K8K G;  4N3C A;  3AG2 E;  5FIO A;  1Y6I A;  1JCR A;  5D66 A;  1IKN D;  2I6H A;  4TUM A;  3UT8 A;  2YIN A;  2ZXW E;  2A5E A;  3FU6 A;  2PL2 A;  4GZD A;  4J7W A;  1UOH A;  1OCC E;  5ENR D;  3DXK G;  1TN7 A;  3TWT A;  2AXZ A;  4CT4 A;  3WG7 E;  4MBG A;  4AXH A;  3T5V A;  4TV3 A;  1N4S A;  3CGH A;  4UUC A;  2R17 C;  2P9S G;  3CVQ A;  3FU5 A;  4HXI A;  2DZN A;  3CK8 A;  3CVW A;  3SD5 A;  2GRQ B;  5EYP F;  4ATZ D;  4DX6 D;  2R5S A;  2P9K G;  1OCO E;  1NFI E;  3QNK A;  4GZ6 A;  2VSO E;  3TWW A;  3UT7 A;  5LFA A;  2KAT A;  1TEZ A;  5JA4 D;  5FQ4 A;  1DCE A;  3DRA A;  2WQ7 A;  3HG0 D;  1HO8 A;  1QNF A;  4BET A;  1OXJ A;  3ZN3 A;  4J8D A;  3JXI A;  4JA9 A;  2ETC A;  5EDS A;  4TXQ A;  1TNO A;  3UQ3 A;  1A5E A;  2E2E A;  2AXU A;  3D9I A;  4YDO A;  1SZ9 A;  4J8F A;  2Y3A A;  2XS8 A;  3MX3 A;  3T8K A;  5J08 A;  2WXK A;  3LVQ E;  3Q15 A;  4YVO A;  3QOU A;  3UKR G;  3LYA A;  1TR4 A;  3TXN A;  5EN5 D;  1NI1 A;  1MQS A;  4FP7 A;  1UN8 A;  3UXG A;  3AG1 E;  4WWN A;  1OWL A;  5CMW A;  2KCK A;  4G26 A;  4CYM D;  4K03 A;  2I1K A;  4JHJ A;  2HM8 A;  3ZXS A;  1ELW A;  3ZYQ A;  3B7B A;  5E75 A;  2IF4 A;  1JWF A;  1E8X A;  3LS8 A;  1BPO A;  4JW1 A;  3CHR A;  4TXR A;  3FH5 A;  4G2V A;  4DUI A;  3BEE A;  1EDU A;  4C9B B;  4CRW A;  2P9L G;  2J08 A;  2VSN A;  4F7A A;  4OVV A;  3ZYM A;  3V79 K;  4N5Q A;  1KT1 A;  4JVS A;  3CVX A;  2J09 A;  5FQ7 A;  4CDM A;  1Z6T A;  2XGO A;  4DI4 A;  4HFG A;  1TN6 A;  5J90 A;  1OWP A;  2WXH A;  2R2L A;  2WQH A;  2XZT G;  3UTM A;  1L5J A;  4GCO A;  3S7B A;  3LVR E;  3AU5 A;  1S70 B;  4GTV A;  4UI9 K;  3Q79 A;  3ULY A;  2WXQ A;  4F6R D;  1TJC A;  2GRM A;  2KC7 A;  4QQI A;  4UWG A;  5HKP A;  2R03 A;  1Z5S C;  3D9J A;  1N0Q A;  1E7V A;  5D2M C;  4I6J A;  4BY6 A;  5G04 J;  3DSX A;  3HXC A;  2J07 A;  2WXP A;  4AM9 A;  2XCB A;  1MX6 A;  2EIM E;  1N4Q A;  4BX9 A;  3E30 A;  5A6C A;  4GTS A;  2FI7 A;  2XPI A;  1X5B A;  4CDR A;  4Y6W A;  4JA7 A;  4GCN A;  3ONK A;  4I17 A;  3EUV A;  4GZ3 A;  1B89 A;  3ZXP A;  4M7C A;  2VJ8 A;  3EIQ C;  4FLH A;  3FP3 A;  3BUA A;  2LXM A;  5AQ7 A;  2P9N G;  3SF4 A;  4G8L A;  1U3D A;  4BT9 A;  3LEW A;  4BT8 A;  3D9N A;  2R02 A;  4GTR A;  2QY7 A;  4U0S A;  4FJY A;  4PH4 B;  1AWC B;  2GRN B;  3CHP A;  3ZNG A;  1V54 E;  1QYM A;  3C3Q A;  1DVP A;  5AJL A;  2I1J A;  1FT2 A;  4KBQ A;  1H2V C;  4GA1 A;  4A3V A;  2R05 A;  4GMJ A;  5LP0 A;  5JJT A;  1QBQ A;  2GRO B;  3HXF A;  3RRU A;  5EX3 A;  4XE0 A;  3GZ1 A;  1OY3 D;  5LX8 A;  3MV2 B;  3UM3 A;  4I6E A;  5B1A E;  3CVV A;  1JCQ A;  2V5Q C;  3EHM A;  1X81 A;  3CVL A;  3EIJ A;  2CHW A;  3PZ1 A;  3TWX A;  3NOC D;  1KLX A;  3RKV A;  5HQ8 A;  5FZR A;  2AXV A;  4DI3 A;  4U0U A;  1N52 A;  3OXL A;  2XZD G;  5D0O D;  5FQ8 A;  4XKC A;  3EU9 A;  3PZ3 A;  5BW8 C;  3PDN A;  3BG1 B;  4ILG A;  1ZU2 A;  4XKB A;  3EU5 A;  5T4Y A;  3CHS A;  3ASO E;  3CLJ A;  4GML A;  1ZBP A;  3ESK A;  4FAD A;  4PS8 A;  5ENN A;  5G05 J;  3CHQ A;  5KBA A;  3L08 A;  3IHY A;  2F8Y A;  3HXD A;  3JUI A;  3UT4 A;  3Q4A B;  2I2O A;  5FZQ A;  1JPL A;  4GTQ A;  3ASN E;  3QAR A;  3RO2 A;  1E90 A;  3CQC B;  3W9F A;  2ZIS A;  4K0R A;  4U63 A;  3I3N A;  3V30 A;  4CGW A;  4AIF A;  2ZGD A;  2E0I A;  2B6C A;  5EID A;  4E85 A;  3TWV A;  3MYV A;  2AW6 A;  4C48 B;  4BSX A;  4GZ5 A;  2P9I G;  2LO6 A;  2XPY A;  5KJN A;  4KVM A;  4BER A;  1EPU A;  4HRN A;  4XI9 A;  1YCS B;  2VSY A;  3QKY A;  2VSX E;  3UMV A;  4JL0 A;  2BTD A;  2XCC A;  4HOU A;  3FUM A;  5T3R A;  3P2B A;  1V55 E;  4Y6C A;  3UX4 A;  1NA0 A;  5CED B;  3HIZ A;  5KWD A;  1OCR E;  3R7R A;  1LD7 A;  3NZS A;  2R59 A;  2WXI A;  2CHZ A;  3FTW A;  4FJZ A;  2HO1 A;  2A4Z A;  3FU3 A;  4BX8 A;  3IKO B;  3HXB A;  4J8S A;  3DSV A;  3ML9 A;  3FUL A;  3FHE A;  5E76 A;  3CVU A;  2IY0 C;  4GYW A;  2UWJ G;  2RD0 A;  1TJF A;  2QFC A;  5LCW J;  3R9A B;  1ZB1 A;  3UIP C;  2MRI A;  3SBS A;  3B7S A;  2ETA A;  4U96 D;  4EBA A;  5HI7 A;  2I9C A;  2WXO A;  4UI9 C;  4WUY A;  4I43 A;  3U3W A;  3SQV A;  3DSU A;  2OVB A;  2WB2 A;  1HX8 A;  3ABK E;  5KJK A;  5CBN A;  5G2N A;  4RSY A;  3LXU X;  4BWR A;  3ASF A;  2WXF A;  3SY2 A;  2NXP A;  4ANX A;  4GTM A;  5G05 C;  1Z3X A;  3CQG B;  3JUE A;  2PQR A;  4W9R A;  3UM1 A;  3E33 A;  2ZU6 B;  1E7U A;  2DYR E;  2LSU A;  3URZ A;  3QWP A;  3T8M A;  2GW1 A;  4EEC A;  4G24 A;  2CG3 A;  4FUL A;  4GTO A;  4GA0 A;  3MA5 A;  3TGO A;  5LOZ A;  3FTX A;  2MHK A;  1HU3 A;  4ANW A;  4NIK A;  4LRZ A;  2LSV A;  3EHR A;  1YYH A;  1H6P A;  4K5C A;  3MEK A;  4DRX E;  1INZ A;  4ANU A;  1MHQ A;  1KZO A;  4AY6 A;  5AAO A;  1MYO A;  5KJL A;  1KT0 A;  4WNE A;  3PNT B;  4PS7 A;  3QWW A;  4XEI G;  1PY1 A;  3O48 A;  4L2Y A;  3MGB A;  1E8Z A;  2NYJ A;  4PDX A;  2DYS E;  4C0M A;  4RG9 A;  3AJI A;  3BU8 A;  2EIK E;  3UKU G;  3ZUV B;  4EPZ A;  4UQZ A;  3DXM G;  2IEJ A;  4ILI A;  3ZPJ A;  5ARF A;  3AU4 A;  4HOQ A;  1NP7 A;  3LY8 A;  4KMO A;  3ASH A;  3HHM A;  4TRQ A;  4U7E B;  3SO8 A;  5JHA A;  4DK5 A;  2PZI A;  2BUG A;  5ENO D;  3G2V A;  3L17 A;  4FA6 A;  3TWR A;  4GMR A;  3DSS A;  3KEA A;  4QFV A;  3U9W A;  4YDE A;  3C72 A;  4I6G A;  1HG2 A;  1E96 B;  5KCM A;  4WNG A;  2PQN A;  2C0L A;  3ULQ A;  4EBA G;  1A17 A;  3Q5M A;  5BXU A;  4HLL A;  1UN9 A;  4RLY A;  2FF4 A;  3FUN A;  4B0Z A;  2XEV A;  1AP7 A;  5AYW D; 
#chains in the Genus database with same CATH homology
 3CHP A;  2VGX B;  4NRH B;  5DIZ A;  3RK6 A;  3QC1 A;  3SZ7 A;  1DVP A;  3DBS A;  5AJL A;  3DPD A;  4FC8 A;  1HG5 A;  3RRN B;  5AIJ A;  1DNP A;  2I1J A;  4KBQ A;  3FEY A;  1H2V C;  4FU3 A;  2IU1 A;  4GA1 A;  4XI0 A;  5ARG A;  3ENE A;  4A3V A;  3K9I A;  3CKC A;  2KZT B;  4GMJ A;  5LP0 A;  4P29 A;  5FZR A;  4IN3 B;  1SQM A;  4ME2 A;  4MLP A;  4HOR A;  5JJT A;  4KYO B;  3S7J A;  3R7Q A;  4WND A;  3LJ3 A;  3LY9 A;  1NA3 A;  3RRU A;  4EZJ A;  3D9O A;  4H7Y A;  5EX3 A;  3E4B A;  2X6K A;  4XE0 A;  5JJ6 A;  3GZ1 A;  3D9P A;  5A23 A;  1HS6 A;  5LX8 A;  2A5U A;  3FUD A;  2IFU A;  3MV2 B;  1OWO A;  3CSF A;  4A1G A;  4I6E A;  3B7T A;  2WXM A;  4NQ0 A;  2VYI A;  4YVQ C;  3CVV A;  3UPV A;  5DBK A;  1UJK A;  3D3M A;  3JYS A;  3L6A A;  1SZA A;  5CHE E;  1IQU A;  4YND A;  3EHM A;  2CHX A;  4UQX A;  3FUJ A;  5KJM A;  3CK9 A;  3FTV A;  4LCT A;  4HVB A;  3CVL A;  2DCP A;  2WM9 A;  2WMO A;  3EIJ A;  2VTB A;  4LUN U;  2CHW A;  2KCL A;  3LCA A;  3ZYK A;  3CVP A;  1FCH A;  3BG0 B;  3N71 A;  1KLX A;  1ELK A;  3SHF A;  1GW6 A;  5A7D B;  4WAF A;  2XQ0 A;  4UWF A;  4I1O B;  5M72 A;  3RKV A;  3D9L A;  5HQ8 A;  2AXV A;  3HYM B;  3P1U A;  3PZD A;  2KM4 A;  3I4G A;  1IQR A;  2X38 A;  3NQP A;  4GU5 A;  3MZL B;  5EKQ D;  3EJN A;  4U0U A;  3ZRH A;  1N52 A;  4DI3 A;  3KD7 A;  4DLQ A;  2C0M A;  5CMY A;  3IEG A;  3SFZ A;  3OXL A;  4HOS A;  4G23 A;  3RJV A;  5T8I A;  3FH8 A;  5D0O D;  5FQ8 A;  4AJW A;  4ILH B;  4XIF A;  4XKC A;  5BW8 C;  3PDN A;  3AS8 A;  3CHM A;  3BG1 B;  1OUV A;  4ILG A;  1ZU2 A;  4G11 A;  1N54 A;  5FJY A;  2HYZ A;  4XKB A;  3RIB A;  5T4Y A;  3B7R L;  5CCL A;  4IYP A;  3S7D A;  3TL5 A;  4I9C A;  3CHS A;  3CK7 A;  4J8E A;  4UWK A;  4JHR A;  4WWO A;  5C1D A;  4KZ0 A;  5LCW C;  4ANV A;  2AWI A;  3CLJ A;  4GML A;  3PRE A;  1ZBP A;  4KVO A;  1U3C A;  3QJZ A;  4KXK B;  4Q94 A;  3ESK A;  3ZIM A;  3O4Z A;  3FUK A;  4J6I A;  3SBT B;  4AP2 A;  1XNF A;  4FAD A;  2FUL A;  4PS8 A;  4XZ4 A;  5FZS A;  2IOS A;  5ENN A;  5G05 J;  3CHQ A;  3ASD A;  4HOT A;  2WQ6 A;  3CEQ A;  3CHO A;  1Y8M A;  3FH7 A;  3L08 A;  3IHY A;  3GZ2 A;  3EDT B;  3L54 A;  3JUI A;  3L16 A;  4I1M A;  3UT4 A;  3Q4A B;  2IJG X;  4APO A;  4MKT A;  2I2O A;  4E6H A;  5FZQ A;  1JPL A;  4WNF A;  3SI5 A;  5BNW A;  4U04 A;  3VLD A;  4AY5 A;  3PE4 A;  4N3B A;  3QAR A;  3KAE A;  3RO2 A;  1E90 A;  3CQC B;  1H19 A;  2YHE A;  1Z3Y A;  3LDZ A;  3CR3 A;  3OTN A;  1NZN A;  3HVE B;  3KEZ A;  2X6F A;  3UUX A;  4K0R A;  3U64 A;  4U63 A;  3I3N A;  3IBE A;  3HVE A;  2FBN A;  2WMN A;  3Q49 B;  4AIF A;  4CGW A;  4I1A A;  4ATG A;  1UJJ A;  2JEK A;  3PE3 A;  3MCX A;  4XX5 A;  2YQ8 A;  4JEU A;  3SGH A;  2E0I A;  1QZ2 A;  3FTZ A;  1HE8 A;  4I2W A;  4E85 A;  3MV3 B;  4JEH A;  3OAW A;  3EHN A;  4JC8 A;  4WWP A;  3MYV A;  3FTS A;  2AW6 A;  3IHV A;  3PUJ A;  4L7T A;  3LKU A;  4O6F A;  2V4L A;  3ESL A;  4N3A A;  3VLE A;  4BSX A;  1QQE A;  3B13 A;  3CST A;  4N3C A;  4RG6 A;  4GZ5 A;  4GAA A;  3FUF A;  1Y6I A;  2VGX A;  3OXF A;  2LO6 A;  2XRY A;  5FWQ A;  2IQC A;  3S7F A;  3CVN A;  2XPY A;  5BT1 A;  2I6H A;  5KJN A;  4KVM A;  1EPU A;  3UT8 A;  2YIN A;  4H7X A;  4Q96 A;  4AV7 A;  2UY1 B;  2J9Q A;  2OOE A;  1HH8 A;  4B8A A;  3VLF A;  3FU6 A;  2PL2 A;  2UY1 A;  2KZT A;  3B7U X;  4GZD A;  2L0T B;  3KS2 A;  5BV0 A;  3RRM B;  2YHC A;  4FHK A;  4LEU A;  2XPZ A;  1FVF A;  5ANL A;  1FVH A;  2AXZ A;  4CT4 A;  4XI9 A;  3PNL B;  4B89 A;  2PM7 A;  2LNI A;  2VSY A;  2WVI A;  4EZL A;  4AXH A;  3QKY A;  2VSX E;  3T5V A;  4TV3 A;  1IHG A;  3UMV A;  3CGH A;  4JL0 A;  3QDN A;  4UWH A;  2R17 C;  2BTD A;  1UG3 A;  2DIW A;  2XCC A;  4HOU A;  3CVQ A;  3G2U A;  3FUM A;  5T3R A;  3FU5 A;  4I9E A;  3P2B A;  2JLB A;  1JUQ A;  3PH0 C;  4HXI A;  2GRL A;  3MKQ B;  4DPR A;  3CK8 A;  3CVW A;  4Y6C A;  3SD5 A;  3UX4 A;  3JQ0 A;  2R5S A;  1NA0 A;  2MOW A;  3HIZ A;  5BUZ A;  4R7L A;  4GPK A;  3C98 A;  3R7R A;  3ZW3 A;  3QNK A;  4GZ6 A;  2VSO E;  3CIA A;  3NZS A;  3L13 A;  3UT7 A;  3SNX A;  3I5P A;  2R59 A;  5LFA A;  3PS6 A;  2LAH A;  2WXI A;  3ONL A;  2KAT A;  5FTP A;  2CHZ A;  3FTW A;  1TEZ A;  4APF A;  4C0E A;  5BV1 A;  4FJZ A;  5FQ4 A;  2HO1 A;  2A4Z A;  3FU3 A;  2V0P A;  3AS4 A;  4GYY A;  2CG2 A;  4BX8 A;  3IKO B;  4NAC A;  3FEX A;  4J8S A;  2XGS A;  2HR2 A;  4F53 A;  3ML8 A;  2WQ7 A;  3ML9 A;  1HO8 A;  1QNF A;  2WXL A;  3FUL A;  2M63 A;  2WXR A;  2VQ2 A;  4GYO A;  3FHE A;  4J8D A;  5G04 C;  3ZN3 A;  5E76 A;  4JA9 A;  3CVU A;  2KCV A;  4AEZ C;  4JXT A;  4GYW A;  5EDS A;  3TAX A;  3UQ3 A;  2UWJ G;  3ZEF A;  2RD0 A;  1TJF A;  2E2E A;  2QFC A;  2YNQ A;  5LCW J;  3R9A B;  2AXU A;  2MRI A;  1S0P A;  3LPZ A;  1ELR A;  4I2Z A;  3SBS A;  3D9I A;  3B7S A;  4IRU A;  3U66 A;  1SZ9 A;  4J8F A;  2GGF A;  2Y3A A;  4EBA A;  3PRZ A;  5HI7 A;  3TG4 A;  2EQX A;  2I9C A;  1H0A A;  2Y4U A;  2WXO A;  3JQ1 A;  3MX3 A;  3QWV A;  4UI9 C;  3S2A A;  5J08 A;  4WUY A;  1H6K A;  4I43 A;  3U3W A;  2WXK A;  5ANR A;  3LVQ E;  3Q15 A;  2OVB A;  4YVO A;  3QOU A;  2WB2 A;  1HX8 A;  4F1S A;  4GA2 A;  1UW4 B;  5KJK A;  3FFL A;  5EX0 A;  4AOF A;  3LYA A;  3TG5 A;  3TXN A;  5FT9 A;  1MQS A;  4FP7 A;  5G2N A;  1UN8 A;  4RSY A;  3LXU X;  3VTY A;  4WWN A;  3ASF A;  4BWR A;  5JJ7 A;  1OWL A;  4FLB A;  4U07 A;  2WXF A;  4HS2 A;  2NXP A;  3OXG A;  4ANX A;  5CMW A;  2KCK A;  4G26 A;  5G05 C;  1Z3X A;  4K03 A;  2I1K A;  3CQG B;  4JHJ A;  2WXG A;  2HM8 A;  2AVP A;  2PQR A;  4N2S A;  3PVL A;  2NC9 A;  3ZXS A;  4W9R A;  4ACK A;  1ELW A;  4A3T A;  5BPP A;  5FQ6 A;  3ZYQ A;  2ZU6 B;  1E7U A;  2WXN A;  5E75 A;  2IF4 A;  3APC A;  1JWF A;  2LSU A;  1EF1 C;  4KZC A;  3URZ A;  3QWP A;  3T8M A;  1E8X A;  1WM5 A;  3QAQ A;  1H2T C;  3JCK C;  3LS8 A;  3Q47 B;  2L9B A;  2ILR A;  2GW1 A;  4AVX A;  4Q69 A;  4M3O A;  3G2W A;  1BPO A;  1HF8 A;  3ZVV A;  3T5X A;  3WXX A;  4EEC A;  3FDH A;  4G24 A;  4JW1 A;  3CHR A;  3ZYL A;  3FH5 A;  4BTA A;  2CG3 A;  4UQY A;  4G2V A;  4FUL A;  3BEE A;  4GB9 A;  4JZY A;  2FO7 A;  1EDU A;  4GA0 A;  4C9B B;  4CDN A;  5CCM A;  3FTU A;  4DJA A;  3MA5 A;  4CRW A;  2J08 A;  2V5F A;  2VSN A;  2CFZ A;  4F7A A;  4OVV A;  3ZYM A;  3TGO A;  4L23 A;  5LOZ A;  1KT1 A;  5C2Y A;  3ASG A;  4N2Q A;  4JVS A;  3CVX A;  2J09 A;  5D0Q D;  4G25 A;  4EQF A;  2J4B A;  5JHB A;  1HXI A;  3FTX A;  2MHK A;  1HU3 A;  4EZK A;  3QB2 A;  5FQ7 A;  4ANW A;  1Z6T A;  4CDM A;  2XGO A;  4DI4 A;  4HFG A;  4KT6 B;  3I4R B;  3QK0 A;  5J90 A;  4LRZ A;  4CEM A;  2PM6 A;  3U4T A;  4MRU A;  1OWP A;  2WXH A;  4A1S A;  5AJD A;  2LSV A;  2WQH A;  1WAO 1;  3PEV B;  1PAQ A;  4N5C A;  4V3I A;  1L5J A;  4BFR A;  3FUE A;  3MEK A;  4GCO A;  5G55 A;  3GW4 A;  3LVR E;  3S7B A;  1INZ A;  3AU5 A;  4ANU A;  3MKQ A;  2OND A;  3APF A;  4UI9 K;  2FEZ A;  1MHQ A;  3FU0 A;  4AY6 A;  4N39 A;  2WXQ A;  3PUK A;  1TJC A;  2IOL A;  3G2S A;  4MS6 A;  2ION A;  3G2T A;  2GRM A;  2KC7 A;  2X3M A;  3ZFW A;  5KJL A;  4A55 A;  1KT0 A;  4WNE A;  4UWG A;  3D9J A;  3PNT B;  4PS7 A;  3QWW A;  4OVU A;  1E7V A;  2J4D A;  2VTB B;  4I6J A;  3NZU A;  3FY4 A;  4BY6 A;  3PEU B;  1PY1 A;  4ABN A;  3O48 A;  4L2Y A;  3MGB A;  1E8Z A;  5G04 J;  2DBA A;  4PDX A;  2XHE A;  2J07 A;  1P5Q A;  2WXP A;  4AM9 A;  2XCB A;  4RG9 A;  4C0M A;  3D9K A;  3IV0 A;  3TJP A;  4BX9 A;  3FTY A;  3AS5 A;  2CFU A;  4B94 A;  1VDY A;  3GZS A;  4PS3 A;  4DLO A;  1E8W A;  3RO3 A;  4EPZ A;  5A6C A;  4UWL A;  2FI7 A;  4UQZ A;  2C2L A;  5AEN A;  2XPI A;  1EYH A;  1X5B A;  4FHJ A;  4ILI A;  4CDR A;  1H2U A;  4Y6W A;  4JA7 A;  2X6I A;  4UI9 J;  2VGY A;  4TUU A;  3RU0 A;  3ZPJ A;  1W3B A;  5ARF A;  3AU4 A;  1E8Y A;  4G1T A;  4OYS A;  4URK A;  1HZ4 A;  3CKB A;  4GCN A;  2L6J A;  4HOQ A;  4U0Z A;  1IYG A;  3ONK A;  4I17 A;  3LY7 A;  2XGM A;  4GZ3 A;  1NP7 A;  1B89 A;  3LY8 A;  4KMO A;  3MKR A;  4BTB A;  4J0U A;  4B8C B;  4GZC A;  3ASH A;  3FUI A;  3HHM A;  2VJ8 A;  4TRQ A;  1HFA A;  4NUR A;  4L1B A;  3TXM A;  5JHA A;  3EIQ C;  1OWM A;  4JHK A;  4DK5 A;  2V8S E;  4FLH A;  3FP3 A;  2XRZ A;  2PZI A;  2BUG A;  4U8H A;  1XGW A;  3G2V A;  2LAI A;  3L17 A;  3VTX A;  3ZHE B;  3SF4 A;  4ACL A;  3GYZ A;  4FA6 A;  3ZHE A;  4CCA A;  1U3D A;  3ZGQ A;  4BT9 A;  3LEW A;  1PC2 A;  4PUC A;  4BT8 A;  3D9N A;  1JWG A;  4D10 C;  2Q7F A;  4HLE A;  2RG8 A;  3HDX A;  3MJW A;  4CT0 A;  3CVY A;  2WXJ A;  4IUL A;  4RVB A;  1YA0 A;  1OWN A;  2BF0 X;  2QY7 A;  3FWV A;  4QFV A;  3D9M A;  3U9W A;  4U0S A;  1WY6 A;  2L0I A;  4LER A;  4FJY A;  4I6G A;  3APD A;  1HG2 A;  2OV8 A;  1E96 B;  3FUH A;  3NF1 A;  5KCM A;  2P58 C;  4WNG A;  4F3V A;  2PQN A;  2C0L A;  2WPV A;  3ULQ A;  4EBA G;  3L22 A;  4CGV A;  2X6J A;  2J49 A;  2Y4T A;  1A17 A;  3Q5M A;  1LF8 A;  2X6H A;  4PH4 B;  1UN9 A;  3CV0 A;  2FF4 A;  3FUN A;  4L2L A;  4JPS A;  4B0Z A;  2XEV A;  2OVF A;  2NSZ A;  5AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...