2NXPA

Structure of ntd2 domain of the human taf5 subunit of tfiid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
149
structure length
149
Chain Sequence
b'QPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 5
publication title Structural analysis and dimerization potential of the human TAF5 subunit of TFIID.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 45
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nxpA00
2J49A 2NXPA 2J4BA
chains in the Genus database with same CATH superfamily
3GW4A 2HO1A 3FEYA 5ARGA 1IKND 2DVWA 2J4BA 2KATA 4BSXA 4A3TA 3KEZA 1E90A 1K8KG 2IO2C 1BI8B 3HIZA 3ISMC 2XPZA 4GYWA 3ZN3A 1H6KA 1OT8A 4OVVA 3AS4A 2WXPA 1TN7A 1S64A 2MOWA 3KEAA 3LJ3A 4IN3B 5ITZF 3D9NA 3TXNA 2XPYA 5B1AE 3G2SA 2BUGA 1E8WA 3I4GA 2VTBA 1HG2A 1N4QA 4EBAG 4I9CA 1LD8A 4GA2A 4KT6B 3AU5A 1HX8A 3UT8A 2WXOA 2IFUA 3R9MA 4BTAA 2MHKA 3MYVA 2J49A 5M72A 3LCAA 3GZ2A 4EZKA 2XZDG 3SHFA 2E0IA 3U3WA 3ASNE 3C98A 3HXEA 3APDA 3C3OA 2DWZA 1ELKA 2GRLA 2WM9A 4J6IA 3D9KA 1FVHA 5CBOA 3Q79A 4U63A 2YINA 3U64A 3E34A 4L7TA 3FTYA 4I43A 2RFAA 2H6FA 3B7BA 1EF1C 3L6AA 3EHRA 1X5BA 3DXMG 4HXIA 1O1RA 5EX0A 5E76A 4HLEA 3BEEA 4UQXA 3TAXA 4NURA 3DSWA 3IHVA 2B6CA 4LG6A 2AW6A 3CVNA 5ENNA 2KXPC 4GU5A 3ASHA 4GAAA 3Q9UC 1PC2A 3ZHEA 3HVEA 5JHAA 4X8QA 3FULA 1MQSA 3L08A 2I1JA 1FT2A 3CVWA 3CVLA 5KBAA 3ZUVB 1FCHA 1HFAA 2YHEA 3EHNA 4E85A 2VSNA 4J8SA 1H2VC 3DSSA 3LY7A 4JHKA 2GRPB 2PNNA 4YVOA 1TEZA 2CHWA 2R2LA 3RO3A 1U2VG 4CDRA 3CK9A 5BW8C 3CKCA 2Y69E 5AAOA 3FUEA 2XEEA 3MX3A 1QYMA 3UT7A 3PZ1A 3C3QA 4I17A 1DCEA 3URZA 2YQ8A 4N3AA 1MJ0A 2DIWA 3OTNA 3I4RB 1KLXA 3GZSA 2P9PG 3GYZA 4GYOA 5ENTD 4N3CA 4FJZA 2YNQA 4I1AA 5C1DA 2UY1A 4XZ4A 2DYRE 5AQBA 3CVUA 4YNDA 4HVBA 2R5SA 3Q4AB 4CT4A 2CFUA 3LEWA 4GMRA 3FU5A 2DCPA 2OOEA 4APFA 4FJYA 3LDZA 1HG5A 4BFRA 3ZFWA 1WY6A 4HRLA 2IJGX 2P9SG 1O1SA 3HXCA 2WXQA 2WPVA 1EYHA 4TXPA 3WXXA 1SZ9A 3PZ3A 4AXHA 3CHRA 3HHMA 4UWGA 2P58C 4I9EA 2ZIRA 2LXMA 4B89A 4BT9A 2RKKA 1YA0A 3UQ3A 4C0EA 3UM1A 2L0TB 4A3VA 5J90A 5JJ7A 4G24A 3MEKA 5CCLA 4J8EA 2X6HA 2Q7FA 4G8KA 4Q96A 1OCCE 1TNZA 2RD0A 4HRMB 4B93B 1PY1A 3U66A 2KC7A 4YDOA 5EN5D 4U96D 3AJIA 3QWVA 3CSTA 5LFAA 3B95A 4A1GA 2XQ0A 3ASOE 3MCXA 4C0MA 1TJCA 3EJNA 5T8IA 3FTWA 4KVOA 4DX5D 5FQ8A 2VYIA 3CQCB 2PL2A 3ABKE 3CHSA 4G25A 4UWKA 1S70B 2V5QC 1K1AA 4BY6A 2KCVA 4AY6A 4BX8A 3B7TA 4UI9J 4JL0A 2CG3A 2WXNA 3AS5A 4J7WA 5J08A 3NBNB 5T3RA 1B89A 4FP7A 2J08A 3ZNGA 3JUIA 3T5VA 2WQ7A 4DX2A 3RU0A 1N54A 4DRXE 3Q47B 4O1OA 1H6OA 1NFIE 1SVXA 5HKPA 1OWNA 3OAWA 2J07A 4RG9A 3MZLB 4MRUA 4L2YA 4L9PA 4TUUA 1YMPA 2JEKA 2P9UG 2CG2A 1SZAA 5JMND 3LJNA 5EYPF 3QKYA 2I6HA 5ENRD 5EIDA 2EIKE 4O60A 4OYSA 4UI9K 5DIZA 4RG6A 3J5QB 3L16A 1IQRA 4RLYA 3L22A 3ZYQA 3S2AA 3KS2A 3G2VA 4B8AA 2QFCA 4H7YA 2I2OA 4U95D 5CEAA 5FZQA 2IOLA 4GMJA 1UN9A 2OCCE 1K3ZD 2MRIA 3FH5A 4JEUA 3CVXA 5ANRA 4N39A 4ILIA 3CQGB 2AXVA 2KCKA 3B7RL 3E33A 4BX9A 5BPPA 2VSXE 3DSUA 1TNYA 2ETAA 2WXLA 3OXGA 4B8CB 3U4TA 4N2QA 2V4LA 3UINC 1NI1A 4KMOA 1D9SA 5DBKA 4WWOA 3ZW3A 3V30A 1IHGA 1NZNA 2WVIA 2A4ZA 5KJKA 3UIPC 5JHBA 3C5RA 5CEDB 3Q7FA 3CVQA 3E4BA 3DRAA 5G05J 3Q7AA 2WMNA 1ZBPA 4MBGA 3NZSA 1BU9A 3J5PA 4I2WA 1TJFA 5EIBE 1TYQG 4LCTA 3AS8A 3Q15A 5A23A 5AJLA 1E7UA 3AG1E 3MA5A 4IYPA 1FT1A 3PUJA 1EDUA 1N11A 3VLFA 5G55A 3FUNA 3D9LA 2XGOA 1H19A 5BV0A 5HRYA 3FUMA 1E8ZA 3ONLA 4LNGA 5JJTA 3ML9A 4I6JA 4LRZA 5B1BE 1EPUA 3FY4A 4FC8A 3UMVA 4JVSA 2FEZA 3G2TA 5AIJA 1TNOA 5KJNA 1N95A 3LPZA 1E7VA 4ANWA 4EECA 4DLQA 2Y3AA 2XCCA 3RAUA 2FBNA 2P9KG 1N4PA 3RSEG 4I2ZA 1KZPA 1N4RA 4GTSA 3E37A 4NACA 2OEVA 2X6IA 5LP0A 4DPRA 2KZTA 1Y8MA 4JHRA 3SBTB 4P29A 4JW1A 4ANUA 3FTSA 3ENEA 1TN6A 4PUCA 1KZOA 2XEVA 3PREA 4AJWA 3ESLA 4M7CA 4U0UA 2GRNB 5FQ7A 3QB2A 2F0YA 1N9AA 2VGXA 3FUKA 3SF4A 3CHQA 1N94A 3GZ1A 3FHEA 4G23A 2WXHA 2Y1LE 5CMYA 2E2EA 4HNAD 3S7FA 4FLHA 3BG0B 2L0IA 2AXZA 3NAWA 4L23A 1QQEA 3FU0A 3QJZA 4JA9A 4IRUA 4PS3A 3LY8A 1HO8A 4OAVB 1N4SA 4CEMA 3LYAA 5BNWA 4DI3A 2BKGA 3DBSA 3V2OA 2KBXA 2NC9A 3RK6A 1V54E 4EZLA 2WMOA 3CVPA 4MS6A 3D9MA 3DWLG 3ABLE 1LTXA 5BUZA 3ZYMA 3PZ2A 3ASFA 4MLPA 1KPSB 3QC1A 4GTVA 3SGHA 5HQ8A 3LS8A 1MX4A 1MX2A 2PQRA 3FDHA 4BTBA 4IULA 1OCZE 3ASGA 1QBQA 3EIQC 4K5AB 2P9LG 4APOA 5H7PA 1Z3XA 2P9NG 3TWWA 2R59A 3RO2A 1S0PA 1OUVA 3BU8A 4LUNU 4TV3A 1E96B 4GZ6A 4UUCA 4GTOA 4WNEA 3SFYA 3ULEG 4GPMA 4GZCA 2LSUA 3ZYKA 3UM2A 2XZTG 4ANVA 1LF8A 5KCMA 4PS7A 2NYJA 3RKVA 2WXKA 3SI5A 2ZU6B 1FPPA 2WXJA 2ZGDA 3S7JA 4ZFHA 5CCMA 3ZXPA 4CCAA 5AARA 5BT1A 5FT9A 4GCOA 5KJLA 2IU1A 3MJWA 2C0MA 4XX5A 2UWJG 3CHPA 1V55E 3O4ZA 3HXBA 1SA5A 2OEWA 2WXRA 3I3NA 4UQYA 2DBAA 1D8EA 3QARA 5FZSA 3ZGQA 3CK7A 3VTXA 3CHMA 3S7BA 4EHMA 2BEDA 4JXTA 3AAAC 1N0QA 5T4YA 4F6RD 5CERB 3PEUB 4Z68A 5HI7A 1N52A 4UQZA 2LNIA 5FIOA 2L6BA 3D9OA 4GTRA 4O6FA 5B3SE 3DSXA 3VLDA 3NOCD 3BG1B 5KJMA 3D3MA 4GZ3A 1Y6IA 4U07A 2RG8A 3D9JA 4AM9A 4YDEA 1K1BA 4GMLA 4RQIA 3NB2A 4BT8A 2NSZA 2XRYA 1HU3A 2AJAA 3JXJA 3KSQA 2LAHA 2C2LA 3PUKA 4XIFA 3I5PA 4FLBA 3ZHEB 3PZ4A 5LCWJ 2X6JA 3HVEB 1OCRE 3CGHA 1IYGA 4F7AA 1H2UA 2XEHA 3AG3E 1KT1A 3PE4A 3E32A 5CBNA 2QYUA 4BESA 1D8DA 4L2LA 1UN8A 4JEHA 1OWOA 2V4HC 1MX6A 4EBAA 4RVBA 3MV2B 3PE3A 3D9IA 5JA4D 1ELRA 4J0UA 4BWRA 2GROB 4KXKB 5G04J 3HYMB 4A55A 4GZ5A 3FUFA 3UM0A 1N0RA 1OCOE 4YDYA 3AG4E 3HXFA 4ME2A 2AVPA 3Q73A 2V8SE 1IQUA 3V79K 4JHJA 3QOUA 3IV0A 1TN8A 3DPDA 5CRVA 4Q94A 4NRHB 4G11A 3RRNB 3UKRG 3N71A 1VDYA 5A6CA 3QNKA 2H6HA 2LUHA 1OXJA 4LEUA 4HFGA 4Y6CA 5A7DB 3KSLA 4OVUA 4CT0A 1XNFA 1YYHA 2BTDA 1G3NB 2PM7A 3ZKJA 4ATZD 4HOQA 3ESKA 4XKCA 4H7XA 2UY1B 4ILGA 3L17A 4HOUA 4LERA 3P2BA 3WG7E 4I6EA 3JQ0A 4AVXA 2VGEA 4UWFA 1FVFA 4QFVA 3TG5A 4K0RA 2OV8A 1TR4A 4A63B 2WXMA 2J9QA 2R17C 3ASDA 4I1MA 1H2TC 5AYWD 1MYOA 1AP7A 3FUDA 2LXLA 2YHCA 5D66A 1RW2A 3ULYA 4DLOA 3UI2A 4DI4A 3MGBA 1INZA 2EINE 2PQNA 3D9HA 4J8FA 4DK5A 1JCRA 3IXEA 1JWGA 3HG0D 3UPVA 1Z5SC 3QWWA 3APFA 5AQ9A 4TUMA 1RZ4A 3MKQB 4CGVA 3NZUA 2XCBA 4CRWA 2IONA 3FU3A 4ZHBA 1HF8A 2XS8A 2CFZA 4K5BA 3ZYLA 4TXQA 2J8SD 3U9WA 3TGOA 3O48A 1HH8A 4EZJA 3C72A 2X38A 1ELWA 3DSTA 3APCA 1XGWA 3T5XA 3R7RA 3C3RA 4CYMD 1LD7A 5FTPA 4FA6A 4FHJA 1SA4A 5FINA 3CLJA 2EIME 3PZDA 1P5QA 3TL5A 2GRQB 3TWUA 2AWIA 5ENOD 2R02A 4WWPA 1WAO1 2CHZA 4JD2G 1TNUA 2C0LA 5CRUA 5EKQD 3CIAA 2H6GA 4GTQA 3LKUA 5FZRA 2IY0C 3FP3A 3IKOB 2B0OE 1NL4A 3B13A 4G8LA 3ZRHA 4GB9A 2X3MA 1H6PA 4JA7A 1U3CA 4HOTA 4JB8P 2ILRA 1OWPA 2OVBA 2LSVA 3FH8A 4U04A 5D0QD 3DPYA 4UI9C 2FI7A 4XEIG 4QQIA 4DX7D 3EIJA 2R03A 1QZ2A 4KVMA 2FF4A 3TWRA 3JUEA 3FU6A 1SQMA 4C9BB 4GTPA 4KBQA 4BETA 3L9TA 3ZIMA 3DEOA 1ZB1A 1OWMA 2WXFA 1WDYA 3CVYA 4ANXA 4N3BA 4AP2A 2R05A 3Q49B 4DX6D 3FUHA 3IEGA 3UTMA 2M63A 3SO8A 4J8DA 2FO7A 4PH4B 5IY5E 2J09A 4CZ2D 1H0AA 1JCQA 2BKKB 3HXDA 4I1OB 4ACLA 3UIOC 4XE0A 2IEJA 3UXGA 5KWDA 3PNTB 2VSYA 1JUQA 3TWQA 3ZPJA 3SNXA 2F37A 4OAUC 4KZ0A 4GYYA 3IHYA 4HRNA 4TXRA 4JPSA 5CMWA 5ARFA 2Y0BG 4LNUD 4GPKA 4WUYA 2GRRB 3Q5MA 2OVFA 5ANLA 1L5JA 2VSOE 4W9RA 1ZU2A 4G1TA 4LSZE 2PM6A 3KD7A 2XGSA 4G2VA 1BLXB 5LOZA 4DX1A 5E75A 2ZXWE 4WNDA 4ACKA 4E6HA 2XPIA 5BV1A 1Z3YA 1W3BA 3SBSA 2GRMA 3MKRA 5G05C 4ILHB 3L13A 4UWLA 3W9GA 2ONDA 3IBEA 5BXOA 4U0SA 3SQVA 4AY5A 3JYSA 3CKBA 2ETCA 5BXUA 5FWQA 5JJ6A 1MZCA 1JCSA 3F6QA 4HB5A 1GW6A 4FADA 4URKA 3TJPA 3CSFA 2P9IG 3HRAA 4MKTA 5D2MC 4K5CA 5AN8A 3R9AB 2KZTB 2XENA 3P1UA 1BPOA 4Q69A 4G26A 3ML8A 3PH0C 5HS0A 2VTBB 3FWVA 2VQ2A 2MYOA 1HZ4A 4ATGA 4I6GA 2EQXA 1U3DA 4J8YA 3SFZA 1O1TA 2L6JA 3OXLA 2VGXB 3AU4A 2Y4UA 5D0OD 4HI9A 5CHEE 3CVVA 4JC8A 5EYLA 2QYJA 5CECB 2ETBA 3TXMA 5ENPD 4XI0A 3UM3A 1WG0A 3ZEFA 3T9KA 4K03A 4D10C 3AG2E 3E30A 3Q78A 4DUIA 1DNPA 4HQDA 2V0PA 4F1PA 3EUVA 1Q2ZA 3BUAA 3G2UA 4BERA 2IOSA 3DEPA 1DVPA 2QY7A 3CEQA 1WM5A 2H6IA 1Z6TA 1YCSB 5KNGA 3V31A 3MV3B 1KT0A 3SD5A 3T8KA 5EDSA 1QNFA 2DYSE 2JLBA 4AEZC 5AQAA 4HS2A 3FUJA 3PVLA 3TWTA 4B0ZA 2VGYA 2RFMA 3ULQA 4WWNA 3CR3A 4HOSA 2EILE 3EU9A 4M3OA 4AOFA 1X81A 2KM4A 4LNBA 2JABA 4NQ0A 1NA3A 4HI8A 4TRQA 5AJDA 5ENSD 2F8XK 2X6KA 4V3IA 4Y6WA 1UJJA 4L1BA 2QZAA 3FTUA 1HXIA 1S63A 4GTMA 2Y4TA 1PAQA 3ONKA 3FEXA 5FQ6A 3FFLA 2LO6A 3RRMB 4U7EB 3FH7A 3VTYA 1JWFA 3OXFA 3SFXA 1UOHA 1BI7B 4N2SA 3JCKC 3PNLB 3T8MA 3MKQA 4FULA 4CDMA 3CV0A 2WXIA 4HORA 5G2NA 4CGWA 2A5EA 2X6FA 4CDNA 2XGMA 2XS1A 4GCNA 4WNFA 3CHOA 1AWCB 3PDNA 3QAQA 3DSVA 4F53A 2WQHA 4BSZB 2PZIA 3QWPA 3UT4A 2LAIA 2A5UA 3ZXSA 5EX3A 3HDXA 1MHQA 2HE0A 4PDXA 3NOGD 2HM8A 2WQ6A 2ZISA 3QK0A 4EQFA 3L54A 3PS6A 3FTVA 5FQ4A 3CK8A 4WAFA 4AV7A 3G2WA 4HBDA 4N5CA 2I1KA 4JZYA 4KZCA 4YVQC 3EDTB 4U0ZA 3KAEA 4RSYA 2FULA 5LX8A 4PS8A 2I9CA 4EPZA 3RJVA 1HS6A 4BEPA 2HYZA 3LXUX 3FUIA 3VLEA 4GA1A 2F8YA 3NQPA 3FTXA 3FTZA 3UUXA 3D9PA 2J4DA 1IXVA 2V5FA 2DZOA 3TG4A 2KCLA 1O5MA 3SZ7A 1IHBA 2HR2A 3EHMA 2GW1A 4XI9A 4WNGA 4UWHA 4GTTA 2DZNA 1OWLA 4A1SA 1DCQA 4U8HA 4XKBA 4C48B 1NA0A 3Q9NC 1E8YA 3TWXA 4U8YD 3EHQA 3V2XA 2IO3C 3K9IA 1SW6A 3PRZA 1DC2A 3RIBA 4ABNA 1A17A 4DJAA 3B7UX 4FU3A 3R7QA 3S7DA 3LVRE 1TNBA 5EILA 4R7LA 2CHXA 2QC9A 5C2YA 4FHKA 3W9FA 3DXKG 2IQCA 4GA0A 2GGFA 3RRUA 2ZGGA 5ENQD 2WB2A 5LCWC 4YDWA 4U8VD 2FO1E 3JQ1A 1BD8A 5KNHD 1UJKA 2IF4A 1A5EA 4HLLA 2WXGA 4N5QA 3Q75A 3NF1A 3QDNA 4AIFA 4B94A 2EIJE 3LY9A 3UKUG 3X2QE 3JXIA 3TWSA 3BQOA 3B7SA 4F3VA 3EU5A 3ZU7B 4NIKA 2BF0X 3ZVVA 3TWVA 1UG3A 2P2CP 2XHEA 5G04C 2NXPA 1OY3D 4GZDA 2VJ8A 2AXUA 3LVQE 1UW4B 4KYOB 1HE8A 5AENA 4O1PA 1NP7A 3ABME 3UX4A 3SY2A 3PEVB 3L82A 5AQ7A 2XRZA 5FJYA 2L9BA 1E8XA 4F1SA 1JPLA
chains in the Genus database with same CATH topology
3GW4A 2HO1A 3FEYA 5ARGA 2ONDA 2LAHA 2C2LA 3IBEA 4OYSA 4UI9K 5DIZA 4RG6A 3PUKA 4U0SA 2J4BA 2KATA 3I5PA 4XIFA 4BSXA 4AY5A 4A3TA 3JYSA 4FLBA 3KEZA 3ZHEB 1E90A 3L16A 5LCWJ 2X6JA 1IQRA 3CKBA 3HVEB 3CGHA 5FWQA 1IYGA 4F7AA 1H2UA 3HIZA 5JJ6A 3L22A 3ZYQA 3S2AA 3KS2A 3PE4A 1KT1A 3G2VA 2XPZA 1GW6A 4GYWA 2QFCA 4H7YA 2I2OA 3ZN3A 4B8AA 5FZQA 4FADA 1H6KA 4URKA 2IOLA 3TJPA 4GMJA 3CSFA 1UN9A 4OVVA 4MKTA 4L2LA 3AS4A 1UN8A 2WXPA 4JEHA 3R9AB 2KZTB 2MRIA 3P1UA 1OWOA 2MOWA 1BPOA 3LJ3A 3FH5A 4Q69A 4IN3B 4JEUA 3CVXA 4G26A 3ML8A 3PH0C 4N39A 4ILIA 5ANRA 3CQGB 4EBAA 2VTBB 2AXVA 3FWVA 2VQ2A 2KCKA 3D9NA 4RVBA 3TXNA 3MV2B 2XPYA 3B7RL 4BX9A 5BPPA 2VSXE 2BUGA 1E8WA 1HZ4A 3G2SA 3I4GA 4ATGA 2VTBA 3PE3A 1HG2A 3D9IA 2WXLA 4I6GA 2EQXA 1ELRA 4I9CA 4GA2A 4KT6B 3AU5A 4EBAG 3OXGA 4J0UA 4B8CB 1U3DA 1HX8A 3UT8A 4BWRA 2WXOA 2IFUA 4KXKB 3U4TA 5G04J 3SFZA 2L6JA 3OXLA 3HYMB 4BTAA 4A55A 2VGXB 4N2QA 2MHKA 2Y4UA 3AU4A 5D0OD 3MYVA 2V4LA 4GZ5A 2J49A 5CHEE 5M72A 3CVVA 4JC8A 4KMOA 3LCAA 3FUFA 3GZ2A 3TXMA 4XI0A 4EZKA 3SHFA 2E0IA 4ME2A 2AVPA 3ZEFA 5DBKA 3U3WA 4K03A 2V8SE 4WWOA 3ZW3A 4D10C 1IQUA 3C98A 1IHGA 3QOUA 3IV0A 4JHJA 1NZNA 3DPDA 4Q94A 4NRHB 2WVIA 2A4ZA 5KJKA 3APDA 1DNPA 5JHBA 2V0PA 4G11A 1ELKA 3RRNB 3N71A 2GRLA 1VDYA 3CVQA 2WM9A 5A6CA 3E4BA 4J6IA 5G05J 3G2UA 3QNKA 2WMNA 1ZBPA 2IOSA 4LEUA 3NZSA 4HFGA 3D9KA 1DVPA 2QY7A 4I2WA 1TJFA 3CEQA 4Y6CA 5A7DB 4LCTA 1WM5A 1FVHA 4OVUA 3AS8A 3Q15A 4CT0A 5A23A 1XNFA 5AJLA 2BTDA 2PM7A 4U63A 1E7UA 3MA5A 4HOQA 2YINA 4IYPA 3U64A 3PUJA 1Z6TA 1EDUA 3ESKA 4XKCA 4L7TA 4H7XA 2UY1B 3VLFA 5G55A 3FTYA 3FUNA 3D9LA 2XGOA 4I43A 3MV3B 1KT0A 4ILGA 3SD5A 3L17A 1H19A 4HOUA 1EF1C 3L6AA 1X5BA 4LERA 3P2BA 5BV0A 5EDSA 3FUMA 1E8ZA 4HXIA 1QNFA 5EX0A 3ONLA 4I6EA 3JQ0A 2JLBA 5E76A 4AEZC 4AVXA 5JJTA 4HLEA 4UWFA 1FVFA 3BEEA 3FUJA 3ML9A 3PVLA 4HS2A 4QFVA 4UQXA 3TG5A 4I6JA 4K0RA 2OV8A 3TAXA 4B0ZA 4NURA 4LRZA 2WXMA 2VGYA 3ULQA 1EPUA 3FY4A 3IHVA 2J9QA 4FC8A 4WWNA 3CR3A 4HOSA 4M3OA 3UMVA 4AOFA 4JVSA 2KM4A 2FEZA 2AW6A 3CVNA 4NQ0A 1NA3A 2R17C 3ASDA 1H2TC 3G2TA 4I1MA 4TRQA 5AJDA 4GU5A 5ENNA 5AYWD 5AIJA 2X6KA 4V3IA 4Y6WA 3FUDA 1UJJA 3ASHA 2YHCA 4GAAA 4L1BA 5KJNA 3LPZA 1E7VA 4ANWA 4EECA 1PC2A 4DLQA 3ZHEA 2Y3AA 4DLOA 3FTUA 3HVEA 5JHAA 1HXIA 4DI4A 3MGBA 3FULA 1INZA 2XCCA 1MQSA 2Y4TA 1PAQA 3L08A 2FBNA 2PQNA 4I2ZA 3ONKA 2I1JA 4J8FA 4DK5A 3FEXA 5FQ6A 3CVWA 3FFLA 1JWGA 2LO6A 3CVLA 3RRMB 4NACA 3FH7A 2X6IA 3VTYA 1JWFA 3OXFA 3UPVA 3QWWA 5LP0A 4DPRA 2KZTA 1Y8MA 4JHRA 3SBTB 4P29A 4JW1A 4ANUA 1FCHA 1HFAA 3APFA 3FTSA 2YHEA 3EHNA 3ENEA 4E85A 3MKQB 4PUCA 4CGVA 4N2SA 2XEVA 2VSNA 4J8SA 3NZUA 2XCBA 4CRWA 2IONA 3FU3A 3JCKC 3MKQA 3PNLB 4FULA 3T8MA 1HF8A 3PREA 4AJWA 3ESLA 4CDMA 3CV0A 2WXIA 1H2VC 4U0UA 5FQ7A 3QB2A 4HORA 2CFZA 5G2NA 3ZYLA 4CGWA 2X6FA 3LY7A 4CDNA 2XGMA 2VGXA 3FUKA 4JHKA 4GCNA 4WNFA 3CHOA 3PDNA 3U9WA 4YVOA 3TGOA 3QAQA 3O48A 1HH8A 1TEZA 4F53A 2CHWA 3SF4A 2WQHA 2X38A 1ELWA 3CHQA 4EZJA 3RO3A 2PZIA 3APCA 1XGWA 4CDRA 3CK9A 3GZ1A 3QWPA 3UT4A 2LAIA 3FHEA 3T5XA 5BW8C 3R7RA 3CKCA 4G23A 3FUEA 2WXHA 2A5UA 3ZXSA 5CMYA 5EX3A 3MX3A 3HDXA 2E2EA 5FTPA 4FA6A 3S7FA 3UT7A 4FHJA 1MHQA 4PDXA 4FLHA 3BG0B 2L0IA 2HM8A 2AXZA 3CLJA 4I17A 3PZDA 3URZA 2YQ8A 2WQ6A 3QK0A 1P5QA 4N3AA 4L23A 3TL5A 4EQFA 2DIWA 3L54A 3PS6A 1QQEA 3OTNA 3FTVA 5FQ4A 3CK8A 3FU0A 3QJZA 2AWIA 3I4RB 1KLXA 3GZSA 4IRUA 4JA9A 4WAFA 4AV7A 3G2WA 4N5CA 2I1KA 4WWPA 3GYZA 4GYOA 4JZYA 4PS3A 3LY8A 1HO8A 4KZCA 4N3CA 3EDTB 4FJZA 4YVQC 2YNQA 4U0ZA 1WAO1 3KAEA 4RSYA 4I1AA 5C1DA 4CEMA 3LYAA 5BNWA 2CHZA 2FULA 5LX8A 2UY1A 4DI3A 4PS8A 2C0LA 2I9CA 4EPZA 3DBSA 5EKQD 3RJVA 1HS6A 3CIAA 2NC9A 4XZ4A 3RK6A 2HYZA 3LXUX 3LKUA 3CVUA 4EZLA 4YNDA 4HVBA 5FZRA 2R5SA 3Q4AB 3FUIA 4CT4A 2CFUA 3LEWA 3VLEA 2WMOA 4GA1A 3FU5A 2DCPA 2OOEA 3CVPA 3NQPA 4APFA 4MS6A 3D9MA 3FP3A 4FJYA 3FTXA 3LDZA 3IKOB 3FTZA 3UUXA 3D9PA 1HG5A 2J4DA 3B13A 4BFRA 3ZYMA 5BUZA 3ZFWA 3ASFA 4GB9A 3ZRHA 1WY6A 2X3MA 4JA7A 1U3CA 2IJGX 4HOTA 2ILRA 4MLPA 2V5FA 3TG4A 2KCLA 1OWPA 3SZ7A 2WXQA 2WPVA 2HR2A 2LSVA 1EYHA 2GW1A 2OVBA 1SZ9A 3EHMA 3FH8A 4U04A 4XI9A 5D0QD 3WXXA 4WNGA 4UI9C 4UWHA 3QC1A 4AXHA 3CHRA 2FI7A 3SGHA 1OWLA 5HQ8A 3HHMA 3LS8A 4A1SA 4UWGA 2P58C 4I9EA 2PQRA 3FDHA 3EIJA 4BTBA 4IULA 4U8HA 4B89A 3ASGA 4BT9A 4XKBA 3EIQC 1QZ2A 1NA0A 1YA0A 4KVMA 2FF4A 1E8YA 3UQ3A 4APOA 4C0EA 3FU6A 1SQMA 2L0TB 4A3VA 5J90A 4C9BB 5JJ7A 1Z3XA 4KBQA 4G24A 3K9IA 3MEKA 5CCLA 3PRZA 2R59A 4J8EA 3RO2A 2X6HA 1S0PA 3RIBA 3ZIMA 1OUVA 4LUNU 2Q7FA 4TV3A 1E96B 4ABNA 4GZ6A 1A17A 1OWMA 4Q96A 4DJAA 3B7UX 4FU3A 4WNEA 2RD0A 3R7QA 3S7DA 2WXFA 3LVRE 3CVYA 4ANXA 4GZCA 4N3BA 4AP2A 2LSUA 3Q49B 3ZYKA 3FUHA 3IEGA 4ANVA 1LF8A 1PY1A 2M63A 5KCMA 4J8DA 2FO7A 4PH4B 4PS7A 3U66A 4R7LA 2CHXA 2KC7A 2J09A 3RKVA 5C2YA 1H0AA 4FHKA 2WXKA 3SI5A 3QWVA 2IQCA 3CSTA 4I1OB 2ZU6B 2WXJA 4GA0A 3S7JA 5CCMA 5LFAA 2GGFA 3RRUA 4A1GA 2XQ0A 4ACLA 4XE0A 4CCAA 5BT1A 5FT9A 4GCOA 5KJLA 2IU1A 3MCXA 2WB2A 3MJWA 2C0MA 4C0MA 5LCWC 1TJCA 3EJNA 3PNTB 4XX5A 2UWJG 3CHPA 5T8IA 2VSYA 1JUQA 3O4ZA 3FTWA 4KVOA 5FQ8A 3JQ1A 3ZPJA 3SNXA 2VYIA 3CQCB 2PL2A 1UJKA 2WXRA 3CHSA 4KZ0A 4G25A 4UWKA 2IF4A 3I3NA 4GYYA 4UQYA 2DBAA 3IHYA 2WXGA 3QARA 4BY6A 2KCVA 5FZSA 3ZGQA 3CK7A 4JPSA 3VTXA 3CHMA 3NF1A 4AY6A 3QDNA 3S7BA 4AIFA 4B94A 3B7TA 4BX8A 4JXTA 3LY9A 5CMWA 4UI9J 5ARFA 4JL0A 5T4YA 2CG3A 2WXNA 4GPKA 3AS5A 3PEUB 5J08A 3B7SA 4WUYA 4F3VA 5T3RA 1B89A 5HI7A 4FP7A 1N52A 2BF0X 3Q5MA 2J08A 2LNIA 3JUIA 4UQZA 2OVFA 5ANLA 3ZVVA 1UG3A 1L5JA 3T5VA 2XHEA 2VSOE 5G04C 4W9RA 2WQ7A 1ZU2A 2NXPA 3RU0A 1N54A 4G1TA 2PM6A 4GZDA 2VJ8A 2AXUA 3D9OA 3LVQE 3KD7A 2XGSA 4O6FA 1UW4B 4KYOB 3VLDA 4G2VA 1HE8A 5AENA 5LOZA 3BG1B 5KJMA 5E75A 4WNDA 3Q47B 3D3MA 1NP7A 4GZ3A 4ACKA 3UX4A 4E6HA 2XPIA 5BV1A 1OWNA 1Y6IA 3OAWA 1Z3YA 3PEVB 1W3BA 4U07A 2J07A 4RG9A 3MZLB 2RG8A 3D9JA 4MRUA 3SBSA 4L2YA 4AM9A 2GRMA 2XRZA 4TUUA 2JEKA 3MKRA 4GMLA 5G05C 4ILHB 2CG2A 1SZAA 3L13A 5FJYA 4BT8A 2L9BA 1E8XA 2NSZA 3QKYA 4F1SA 2XRYA 4UWLA 1HU3A 2I6HA 1JPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J49 A;  2NXP A;  2J4B A; 
#chains in the Genus database with same CATH topology
 3GW4 A;  2HO1 A;  3FEY A;  5ARG A;  1IKN D;  2DVW A;  2J4B A;  2KAT A;  4BSX A;  4A3T A;  3KEZ A;  1E90 A;  1K8K G;  2IO2 C;  1BI8 B;  3HIZ A;  3ISM C;  2XPZ A;  4GYW A;  3ZN3 A;  1H6K A;  1OT8 A;  4OVV A;  3AS4 A;  2WXP A;  1TN7 A;  1S64 A;  2MOW A;  3KEA A;  3LJ3 A;  4IN3 B;  5ITZ F;  3D9N A;  3TXN A;  2XPY A;  5B1A E;  3G2S A;  2BUG A;  1E8W A;  3I4G A;  2VTB A;  1HG2 A;  1N4Q A;  4EBA G;  4I9C A;  1LD8 A;  4GA2 A;  4KT6 B;  3AU5 A;  1HX8 A;  3UT8 A;  2WXO A;  2IFU A;  3R9M A;  4BTA A;  2MHK A;  3MYV A;  2J49 A;  5M72 A;  3LCA A;  3GZ2 A;  4EZK A;  2XZD G;  3SHF A;  2E0I A;  3U3W A;  3ASN E;  3C98 A;  3HXE A;  3APD A;  3C3O A;  2DWZ A;  1ELK A;  2GRL A;  2WM9 A;  4J6I A;  3D9K A;  1FVH A;  5CBO A;  3Q79 A;  4U63 A;  2YIN A;  3U64 A;  3E34 A;  4L7T A;  3FTY A;  4I43 A;  2RFA A;  2H6F A;  3B7B A;  1EF1 C;  3L6A A;  3EHR A;  1X5B A;  3DXM G;  4HXI A;  1O1R A;  5EX0 A;  5E76 A;  4HLE A;  3BEE A;  4UQX A;  3TAX A;  4NUR A;  3DSW A;  3IHV A;  2B6C A;  4LG6 A;  2AW6 A;  3CVN A;  5ENN A;  2KXP C;  4GU5 A;  3ASH A;  4GAA A;  3Q9U C;  1PC2 A;  3ZHE A;  3HVE A;  5JHA A;  4X8Q A;  3FUL A;  1MQS A;  3L08 A;  2I1J A;  1FT2 A;  3CVW A;  3CVL A;  5KBA A;  3ZUV B;  1FCH A;  1HFA A;  2YHE A;  3EHN A;  4E85 A;  2VSN A;  4J8S A;  1H2V C;  3DSS A;  3LY7 A;  4JHK A;  2GRP B;  2PNN A;  4YVO A;  1TEZ A;  2CHW A;  2R2L A;  3RO3 A;  1U2V G;  4CDR A;  3CK9 A;  5BW8 C;  3CKC A;  2Y69 E;  5AAO A;  3FUE A;  2XEE A;  3MX3 A;  1QYM A;  3UT7 A;  3PZ1 A;  3C3Q A;  4I17 A;  1DCE A;  3URZ A;  2YQ8 A;  4N3A A;  1MJ0 A;  2DIW A;  3OTN A;  3I4R B;  1KLX A;  3GZS A;  2P9P G;  3GYZ A;  4GYO A;  5ENT D;  4N3C A;  4FJZ A;  2YNQ A;  4I1A A;  5C1D A;  2UY1 A;  4XZ4 A;  2DYR E;  5AQB A;  3CVU A;  4YND A;  4HVB A;  2R5S A;  3Q4A B;  4CT4 A;  2CFU A;  3LEW A;  4GMR A;  3FU5 A;  2DCP A;  2OOE A;  4APF A;  4FJY A;  3LDZ A;  1HG5 A;  4BFR A;  3ZFW A;  1WY6 A;  4HRL A;  2IJG X;  2P9S G;  1O1S A;  3HXC A;  2WXQ A;  2WPV A;  1EYH A;  4TXP A;  3WXX A;  1SZ9 A;  3PZ3 A;  4AXH A;  3CHR A;  3HHM A;  4UWG A;  2P58 C;  4I9E A;  2ZIR A;  2LXM A;  4B89 A;  4BT9 A;  2RKK A;  1YA0 A;  3UQ3 A;  4C0E A;  3UM1 A;  2L0T B;  4A3V A;  5J90 A;  5JJ7 A;  4G24 A;  3MEK A;  5CCL A;  4J8E A;  2X6H A;  2Q7F A;  4G8K A;  4Q96 A;  1OCC E;  1TNZ A;  2RD0 A;  4HRM B;  4B93 B;  1PY1 A;  3U66 A;  2KC7 A;  4YDO A;  5EN5 D;  4U96 D;  3AJI A;  3QWV A;  3CST A;  5LFA A;  3B95 A;  4A1G A;  2XQ0 A;  3ASO E;  3MCX A;  4C0M A;  1TJC A;  3EJN A;  5T8I A;  3FTW A;  4KVO A;  4DX5 D;  5FQ8 A;  2VYI A;  3CQC B;  2PL2 A;  3ABK E;  3CHS A;  4G25 A;  4UWK A;  1S70 B;  2V5Q C;  1K1A A;  4BY6 A;  2KCV A;  4AY6 A;  4BX8 A;  3B7T A;  4UI9 J;  4JL0 A;  2CG3 A;  2WXN A;  3AS5 A;  4J7W A;  5J08 A;  3NBN B;  5T3R A;  1B89 A;  4FP7 A;  2J08 A;  3ZNG A;  3JUI A;  3T5V A;  2WQ7 A;  4DX2 A;  3RU0 A;  1N54 A;  4DRX E;  3Q47 B;  4O1O A;  1H6O A;  1NFI E;  1SVX A;  5HKP A;  1OWN A;  3OAW A;  2J07 A;  4RG9 A;  3MZL B;  4MRU A;  4L2Y A;  4L9P A;  4TUU A;  1YMP A;  2JEK A;  2P9U G;  2CG2 A;  1SZA A;  5JMN D;  3LJN A;  5EYP F;  3QKY A;  2I6H A;  5ENR D;  5EID A;  2EIK E;  4O60 A;  4OYS A;  4UI9 K;  5DIZ A;  4RG6 A;  3J5Q B;  3L16 A;  1IQR A;  4RLY A;  3L22 A;  3ZYQ A;  3S2A A;  3KS2 A;  3G2V A;  4B8A A;  2QFC A;  4H7Y A;  2I2O A;  4U95 D;  5CEA A;  5FZQ A;  2IOL A;  4GMJ A;  1UN9 A;  2OCC E;  1K3Z D;  2MRI A;  3FH5 A;  4JEU A;  3CVX A;  5ANR A;  4N39 A;  4ILI A;  3CQG B;  2AXV A;  2KCK A;  3B7R L;  3E33 A;  4BX9 A;  5BPP A;  2VSX E;  3DSU A;  1TNY A;  2ETA A;  2WXL A;  3OXG A;  4B8C B;  3U4T A;  4N2Q A;  2V4L A;  3UIN C;  1NI1 A;  4KMO A;  1D9S A;  5DBK A;  4WWO A;  3ZW3 A;  3V30 A;  1IHG A;  1NZN A;  2WVI A;  2A4Z A;  5KJK A;  3UIP C;  5JHB A;  3C5R A;  5CED B;  3Q7F A;  3CVQ A;  3E4B A;  3DRA A;  5G05 J;  3Q7A A;  2WMN A;  1ZBP A;  4MBG A;  3NZS A;  1BU9 A;  3J5P A;  4I2W A;  1TJF A;  5EIB E;  1TYQ G;  4LCT A;  3AS8 A;  3Q15 A;  5A23 A;  5AJL A;  1E7U A;  3AG1 E;  3MA5 A;  4IYP A;  1FT1 A;  3PUJ A;  1EDU A;  1N11 A;  3VLF A;  5G55 A;  3FUN A;  3D9L A;  2XGO A;  1H19 A;  5BV0 A;  5HRY A;  3FUM A;  1E8Z A;  3ONL A;  4LNG A;  5JJT A;  3ML9 A;  4I6J A;  4LRZ A;  5B1B E;  1EPU A;  3FY4 A;  4FC8 A;  3UMV A;  4JVS A;  2FEZ A;  3G2T A;  5AIJ A;  1TNO A;  5KJN A;  1N95 A;  3LPZ A;  1E7V A;  4ANW A;  4EEC A;  4DLQ A;  2Y3A A;  2XCC A;  3RAU A;  2FBN A;  2P9K G;  1N4P A;  3RSE G;  4I2Z A;  1KZP A;  1N4R A;  4GTS A;  3E37 A;  4NAC A;  2OEV A;  2X6I A;  5LP0 A;  4DPR A;  2KZT A;  1Y8M A;  4JHR A;  3SBT B;  4P29 A;  4JW1 A;  4ANU A;  3FTS A;  3ENE A;  1TN6 A;  4PUC A;  1KZO A;  2XEV A;  3PRE A;  4AJW A;  3ESL A;  4M7C A;  4U0U A;  2GRN B;  5FQ7 A;  3QB2 A;  2F0Y A;  1N9A A;  2VGX A;  3FUK A;  3SF4 A;  3CHQ A;  1N94 A;  3GZ1 A;  3FHE A;  4G23 A;  2WXH A;  2Y1L E;  5CMY A;  2E2E A;  4HNA D;  3S7F A;  4FLH A;  3BG0 B;  2L0I A;  2AXZ A;  3NAW A;  4L23 A;  1QQE A;  3FU0 A;  3QJZ A;  4JA9 A;  4IRU A;  4PS3 A;  3LY8 A;  1HO8 A;  4OAV B;  1N4S A;  4CEM A;  3LYA A;  5BNW A;  4DI3 A;  2BKG A;  3DBS A;  3V2O A;  2KBX A;  2NC9 A;  3RK6 A;  1V54 E;  4EZL A;  2WMO A;  3CVP A;  4MS6 A;  3D9M A;  3DWL G;  3ABL E;  1LTX A;  5BUZ A;  3ZYM A;  3PZ2 A;  3ASF A;  4MLP A;  1KPS B;  3QC1 A;  4GTV A;  3SGH A;  5HQ8 A;  3LS8 A;  1MX4 A;  1MX2 A;  2PQR A;  3FDH A;  4BTB A;  4IUL A;  1OCZ E;  3ASG A;  1QBQ A;  3EIQ C;  4K5A B;  2P9L G;  4APO A;  5H7P A;  1Z3X A;  2P9N G;  3TWW A;  2R59 A;  3RO2 A;  1S0P A;  1OUV A;  3BU8 A;  4LUN U;  4TV3 A;  1E96 B;  4GZ6 A;  4UUC A;  4GTO A;  4WNE A;  3SFY A;  3ULE G;  4GPM A;  4GZC A;  2LSU A;  3ZYK A;  3UM2 A;  2XZT G;  4ANV A;  1LF8 A;  5KCM A;  4PS7 A;  2NYJ A;  3RKV A;  2WXK A;  3SI5 A;  2ZU6 B;  1FPP A;  2WXJ A;  2ZGD A;  3S7J A;  4ZFH A;  5CCM A;  3ZXP A;  4CCA A;  5AAR A;  5BT1 A;  5FT9 A;  4GCO A;  5KJL A;  2IU1 A;  3MJW A;  2C0M A;  4XX5 A;  2UWJ G;  3CHP A;  1V55 E;  3O4Z A;  3HXB A;  1SA5 A;  2OEW A;  2WXR A;  3I3N A;  4UQY A;  2DBA A;  1D8E A;  3QAR A;  5FZS A;  3ZGQ A;  3CK7 A;  3VTX A;  3CHM A;  3S7B A;  4EHM A;  2BED A;  4JXT A;  3AAA C;  1N0Q A;  5T4Y A;  4F6R D;  5CER B;  3PEU B;  4Z68 A;  5HI7 A;  1N52 A;  4UQZ A;  2LNI A;  5FIO A;  2L6B A;  3D9O A;  4GTR A;  4O6F A;  5B3S E;  3DSX A;  3VLD A;  3NOC D;  3BG1 B;  5KJM A;  3D3M A;  4GZ3 A;  1Y6I A;  4U07 A;  2RG8 A;  3D9J A;  4AM9 A;  4YDE A;  1K1B A;  4GML A;  4RQI A;  3NB2 A;  4BT8 A;  2NSZ A;  2XRY A;  1HU3 A;  2AJA A;  3JXJ A;  3KSQ A;  2LAH A;  2C2L A;  3PUK A;  4XIF A;  3I5P A;  4FLB A;  3ZHE B;  3PZ4 A;  5LCW J;  2X6J A;  3HVE B;  1OCR E;  3CGH A;  1IYG A;  4F7A A;  1H2U A;  2XEH A;  3AG3 E;  1KT1 A;  3PE4 A;  3E32 A;  5CBN A;  2QYU A;  4BES A;  1D8D A;  4L2L A;  1UN8 A;  4JEH A;  1OWO A;  2V4H C;  1MX6 A;  4EBA A;  4RVB A;  3MV2 B;  3PE3 A;  3D9I A;  5JA4 D;  1ELR A;  4J0U A;  4BWR A;  2GRO B;  4KXK B;  5G04 J;  3HYM B;  4A55 A;  4GZ5 A;  3FUF A;  3UM0 A;  1N0R A;  1OCO E;  4YDY A;  3AG4 E;  3HXF A;  4ME2 A;  2AVP A;  3Q73 A;  2V8S E;  1IQU A;  3V79 K;  4JHJ A;  3QOU A;  3IV0 A;  1TN8 A;  3DPD A;  5CRV A;  4Q94 A;  4NRH B;  4G11 A;  3RRN B;  3UKR G;  3N71 A;  1VDY A;  5A6C A;  3QNK A;  2H6H A;  2LUH A;  1OXJ A;  4LEU A;  4HFG A;  4Y6C A;  5A7D B;  3KSL A;  4OVU A;  4CT0 A;  1XNF A;  1YYH A;  2BTD A;  1G3N B;  2PM7 A;  3ZKJ A;  4ATZ D;  4HOQ A;  3ESK A;  4XKC A;  4H7X A;  2UY1 B;  4ILG A;  3L17 A;  4HOU A;  4LER A;  3P2B A;  3WG7 E;  4I6E A;  3JQ0 A;  4AVX A;  2VGE A;  4UWF A;  1FVF A;  4QFV A;  3TG5 A;  4K0R A;  2OV8 A;  1TR4 A;  4A63 B;  2WXM A;  2J9Q A;  2R17 C;  3ASD A;  4I1M A;  1H2T C;  5AYW D;  1MYO A;  1AP7 A;  3FUD A;  2LXL A;  2YHC A;  5D66 A;  1RW2 A;  3ULY A;  4DLO A;  3UI2 A;  4DI4 A;  3MGB A;  1INZ A;  2EIN E;  2PQN A;  3D9H A;  4J8F A;  4DK5 A;  1JCR A;  3IXE A;  1JWG A;  3HG0 D;  3UPV A;  1Z5S C;  3QWW A;  3APF A;  5AQ9 A;  4TUM A;  1RZ4 A;  3MKQ B;  4CGV A;  3NZU A;  2XCB A;  4CRW A;  2ION A;  3FU3 A;  4ZHB A;  1HF8 A;  2XS8 A;  2CFZ A;  4K5B A;  3ZYL A;  4TXQ A;  2J8S D;  3U9W A;  3TGO A;  3O48 A;  1HH8 A;  4EZJ A;  3C72 A;  2X38 A;  1ELW A;  3DST A;  3APC A;  1XGW A;  3T5X A;  3R7R A;  3C3R A;  4CYM D;  1LD7 A;  5FTP A;  4FA6 A;  4FHJ A;  1SA4 A;  5FIN A;  3CLJ A;  2EIM E;  3PZD A;  1P5Q A;  3TL5 A;  2GRQ B;  3TWU A;  2AWI A;  5ENO D;  2R02 A;  4WWP A;  1WAO 1;  2CHZ A;  4JD2 G;  1TNU A;  2C0L A;  5CRU A;  5EKQ D;  3CIA A;  2H6G A;  4GTQ A;  3LKU A;  5FZR A;  2IY0 C;  3FP3 A;  3IKO B;  2B0O E;  1NL4 A;  3B13 A;  4G8L A;  3ZRH A;  4GB9 A;  2X3M A;  1H6P A;  4JA7 A;  1U3C A;  4HOT A;  4JB8 P;  2ILR A;  1OWP A;  2OVB A;  2LSV A;  3FH8 A;  4U04 A;  5D0Q D;  3DPY A;  4UI9 C;  2FI7 A;  4XEI G;  4QQI A;  4DX7 D;  3EIJ A;  2R03 A;  1QZ2 A;  4KVM A;  2FF4 A;  3TWR A;  3JUE A;  3FU6 A;  1SQM A;  4C9B B;  4GTP A;  4KBQ A;  4BET A;  3L9T A;  3ZIM A;  3DEO A;  1ZB1 A;  1OWM A;  2WXF A;  1WDY A;  3CVY A;  4ANX A;  4N3B A;  4AP2 A;  2R05 A;  3Q49 B;  4DX6 D;  3FUH A;  3IEG A;  3UTM A;  2M63 A;  3SO8 A;  4J8D A;  2FO7 A;  4PH4 B;  5IY5 E;  2J09 A;  4CZ2 D;  1H0A A;  1JCQ A;  2BKK B;  3HXD A;  4I1O B;  4ACL A;  3UIO C;  4XE0 A;  2IEJ A;  3UXG A;  5KWD A;  3PNT B;  2VSY A;  1JUQ A;  3TWQ A;  3ZPJ A;  3SNX A;  2F37 A;  4OAU C;  4KZ0 A;  4GYY A;  3IHY A;  4HRN A;  4TXR A;  4JPS A;  5CMW A;  5ARF A;  2Y0B G;  4LNU D;  4GPK A;  4WUY A;  2GRR B;  3Q5M A;  2OVF A;  5ANL A;  1L5J A;  2VSO E;  4W9R A;  1ZU2 A;  4G1T A;  4LSZ E;  2PM6 A;  3KD7 A;  2XGS A;  4G2V A;  1BLX B;  5LOZ A;  4DX1 A;  5E75 A;  2ZXW E;  4WND A;  4ACK A;  4E6H A;  2XPI A;  5BV1 A;  1Z3Y A;  1W3B A;  3SBS A;  2GRM A;  3MKR A;  5G05 C;  4ILH B;  3L13 A;  4UWL A;  3W9G A;  2OND A;  3IBE A;  5BXO A;  4U0S A;  3SQV A;  4AY5 A;  3JYS A;  3CKB A;  2ETC A;  5BXU A;  5FWQ A;  5JJ6 A;  1MZC A;  1JCS A;  3F6Q A;  4HB5 A;  1GW6 A;  4FAD A;  4URK A;  3TJP A;  3CSF A;  2P9I G;  3HRA A;  4MKT A;  5D2M C;  4K5C A;  5AN8 A;  3R9A B;  2KZT B;  2XEN A;  3P1U A;  1BPO A;  4Q69 A;  4G26 A;  3ML8 A;  3PH0 C;  5HS0 A;  2VTB B;  3FWV A;  2VQ2 A;  2MYO A;  1HZ4 A;  4ATG A;  4I6G A;  2EQX A;  1U3D A;  4J8Y A;  3SFZ A;  1O1T A;  2L6J A;  3OXL A;  2VGX B;  3AU4 A;  2Y4U A;  5D0O D;  4HI9 A;  5CHE E;  3CVV A;  4JC8 A;  5EYL A;  2QYJ A;  5CEC B;  2ETB A;  3TXM A;  5ENP D;  4XI0 A;  3UM3 A;  1WG0 A;  3ZEF A;  3T9K A;  4K03 A;  4D10 C;  3AG2 E;  3E30 A;  3Q78 A;  4DUI A;  1DNP A;  4HQD A;  2V0P A;  4F1P A;  3EUV A;  1Q2Z A;  3BUA A;  3G2U A;  4BER A;  2IOS A;  3DEP A;  1DVP A;  2QY7 A;  3CEQ A;  1WM5 A;  2H6I A;  1Z6T A;  1YCS B;  5KNG A;  3V31 A;  3MV3 B;  1KT0 A;  3SD5 A;  3T8K A;  5EDS A;  1QNF A;  2DYS E;  2JLB A;  4AEZ C;  5AQA A;  4HS2 A;  3FUJ A;  3PVL A;  3TWT A;  4B0Z A;  2VGY A;  2RFM A;  3ULQ A;  4WWN A;  3CR3 A;  4HOS A;  2EIL E;  3EU9 A;  4M3O A;  4AOF A;  1X81 A;  2KM4 A;  4LNB A;  2JAB A;  4NQ0 A;  1NA3 A;  4HI8 A;  4TRQ A;  5AJD A;  5ENS D;  2F8X K;  2X6K A;  4V3I A;  4Y6W A;  1UJJ A;  4L1B A;  2QZA A;  3FTU A;  1HXI A;  1S63 A;  4GTM A;  2Y4T A;  1PAQ A;  3ONK A;  3FEX A;  5FQ6 A;  3FFL A;  2LO6 A;  3RRM B;  4U7E B;  3FH7 A;  3VTY A;  1JWF A;  3OXF A;  3SFX A;  1UOH A;  1BI7 B;  4N2S A;  3JCK C;  3PNL B;  3T8M A;  3MKQ A;  4FUL A;  4CDM A;  3CV0 A;  2WXI A;  4HOR A;  5G2N A;  4CGW A;  2A5E A;  2X6F A;  4CDN A;  2XGM A;  2XS1 A;  4GCN A;  4WNF A;  3CHO A;  1AWC B;  3PDN A;  3QAQ A;  3DSV A;  4F53 A;  2WQH A;  4BSZ B;  2PZI A;  3QWP A;  3UT4 A;  2LAI A;  2A5U A;  3ZXS A;  5EX3 A;  3HDX A;  1MHQ A;  2HE0 A;  4PDX A;  3NOG D;  2HM8 A;  2WQ6 A;  2ZIS A;  3QK0 A;  4EQF A;  3L54 A;  3PS6 A;  3FTV A;  5FQ4 A;  3CK8 A;  4WAF A;  4AV7 A;  3G2W A;  4HBD A;  4N5C A;  2I1K A;  4JZY A;  4KZC A;  4YVQ C;  3EDT B;  4U0Z A;  3KAE A;  4RSY A;  2FUL A;  5LX8 A;  4PS8 A;  2I9C A;  4EPZ A;  3RJV A;  1HS6 A;  4BEP A;  2HYZ A;  3LXU X;  3FUI A;  3VLE A;  4GA1 A;  2F8Y A;  3NQP A;  3FTX A;  3FTZ A;  3UUX A;  3D9P A;  2J4D A;  1IXV A;  2V5F A;  2DZO A;  3TG4 A;  2KCL A;  1O5M A;  3SZ7 A;  1IHB A;  2HR2 A;  3EHM A;  2GW1 A;  4XI9 A;  4WNG A;  4UWH A;  4GTT A;  2DZN A;  1OWL A;  4A1S A;  1DCQ A;  4U8H A;  4XKB A;  4C48 B;  1NA0 A;  3Q9N C;  1E8Y A;  3TWX A;  4U8Y D;  3EHQ A;  3V2X A;  2IO3 C;  3K9I A;  1SW6 A;  3PRZ A;  1DC2 A;  3RIB A;  4ABN A;  1A17 A;  4DJA A;  3B7U X;  4FU3 A;  3R7Q A;  3S7D A;  3LVR E;  1TNB A;  5EIL A;  4R7L A;  2CHX A;  2QC9 A;  5C2Y A;  4FHK A;  3W9F A;  3DXK G;  2IQC A;  4GA0 A;  2GGF A;  3RRU A;  2ZGG A;  5ENQ D;  2WB2 A;  5LCW C;  4YDW A;  4U8V D;  2FO1 E;  3JQ1 A;  1BD8 A;  5KNH D;  1UJK A;  2IF4 A;  1A5E A;  4HLL A;  2WXG A;  4N5Q A;  3Q75 A;  3NF1 A;  3QDN A;  4AIF A;  4B94 A;  2EIJ E;  3LY9 A;  3UKU G;  3X2Q E;  3JXI A;  3TWS A;  3BQO A;  3B7S A;  4F3V A;  3EU5 A;  3ZU7 B;  4NIK A;  2BF0 X;  3ZVV A;  3TWV A;  1UG3 A;  2P2C P;  2XHE A;  5G04 C;  2NXP A;  1OY3 D;  4GZD A;  2VJ8 A;  2AXU A;  3LVQ E;  1UW4 B;  4KYO B;  1HE8 A;  5AEN A;  4O1P A;  1NP7 A;  3ABM E;  3UX4 A;  3SY2 A;  3PEV B;  3L82 A;  5AQ7 A;  2XRZ A;  5FJY A;  2L9B A;  1E8X A;  4F1S A;  1JPL A; 
#chains in the Genus database with same CATH homology
 3GW4 A;  2HO1 A;  3FEY A;  5ARG A;  2OND A;  2LAH A;  2C2L A;  3IBE A;  4OYS A;  4UI9 K;  5DIZ A;  4RG6 A;  3PUK A;  4U0S A;  2J4B A;  2KAT A;  3I5P A;  4XIF A;  4BSX A;  4AY5 A;  4A3T A;  3JYS A;  4FLB A;  3KEZ A;  3ZHE B;  1E90 A;  3L16 A;  5LCW J;  2X6J A;  1IQR A;  3CKB A;  3HVE B;  3CGH A;  5FWQ A;  1IYG A;  4F7A A;  1H2U A;  3HIZ A;  5JJ6 A;  3L22 A;  3ZYQ A;  3S2A A;  3KS2 A;  3PE4 A;  1KT1 A;  3G2V A;  2XPZ A;  1GW6 A;  4GYW A;  2QFC A;  4H7Y A;  2I2O A;  3ZN3 A;  4B8A A;  5FZQ A;  4FAD A;  1H6K A;  4URK A;  2IOL A;  3TJP A;  4GMJ A;  3CSF A;  1UN9 A;  4OVV A;  4MKT A;  4L2L A;  3AS4 A;  1UN8 A;  2WXP A;  4JEH A;  3R9A B;  2KZT B;  2MRI A;  3P1U A;  1OWO A;  2MOW A;  1BPO A;  3LJ3 A;  3FH5 A;  4Q69 A;  4IN3 B;  4JEU A;  3CVX A;  4G26 A;  3ML8 A;  3PH0 C;  4N39 A;  4ILI A;  5ANR A;  3CQG B;  4EBA A;  2VTB B;  2AXV A;  3FWV A;  2VQ2 A;  2KCK A;  3D9N A;  4RVB A;  3TXN A;  3MV2 B;  2XPY A;  3B7R L;  4BX9 A;  5BPP A;  2VSX E;  2BUG A;  1E8W A;  1HZ4 A;  3G2S A;  3I4G A;  4ATG A;  2VTB A;  3PE3 A;  1HG2 A;  3D9I A;  2WXL A;  4I6G A;  2EQX A;  1ELR A;  4I9C A;  4GA2 A;  4KT6 B;  3AU5 A;  4EBA G;  3OXG A;  4J0U A;  4B8C B;  1U3D A;  1HX8 A;  3UT8 A;  4BWR A;  2WXO A;  2IFU A;  4KXK B;  3U4T A;  5G04 J;  3SFZ A;  2L6J A;  3OXL A;  3HYM B;  4BTA A;  4A55 A;  2VGX B;  4N2Q A;  2MHK A;  2Y4U A;  3AU4 A;  5D0O D;  3MYV A;  2V4L A;  4GZ5 A;  2J49 A;  5CHE E;  5M72 A;  3CVV A;  4JC8 A;  4KMO A;  3LCA A;  3FUF A;  3GZ2 A;  3TXM A;  4XI0 A;  4EZK A;  3SHF A;  2E0I A;  4ME2 A;  2AVP A;  3ZEF A;  5DBK A;  3U3W A;  4K03 A;  2V8S E;  4WWO A;  3ZW3 A;  4D10 C;  1IQU A;  3C98 A;  1IHG A;  3QOU A;  3IV0 A;  4JHJ A;  1NZN A;  3DPD A;  4Q94 A;  4NRH B;  2WVI A;  2A4Z A;  5KJK A;  3APD A;  1DNP A;  5JHB A;  2V0P A;  4G11 A;  1ELK A;  3RRN B;  3N71 A;  2GRL A;  1VDY A;  3CVQ A;  2WM9 A;  5A6C A;  3E4B A;  4J6I A;  5G05 J;  3G2U A;  3QNK A;  2WMN A;  1ZBP A;  2IOS A;  4LEU A;  3NZS A;  4HFG A;  3D9K A;  1DVP A;  2QY7 A;  4I2W A;  1TJF A;  3CEQ A;  4Y6C A;  5A7D B;  4LCT A;  1WM5 A;  1FVH A;  4OVU A;  3AS8 A;  3Q15 A;  4CT0 A;  5A23 A;  1XNF A;  5AJL A;  2BTD A;  2PM7 A;  4U63 A;  1E7U A;  3MA5 A;  4HOQ A;  2YIN A;  4IYP A;  3U64 A;  3PUJ A;  1Z6T A;  1EDU A;  3ESK A;  4XKC A;  4L7T A;  4H7X A;  2UY1 B;  3VLF A;  5G55 A;  3FTY A;  3FUN A;  3D9L A;  2XGO A;  4I43 A;  3MV3 B;  1KT0 A;  4ILG A;  3SD5 A;  3L17 A;  1H19 A;  4HOU A;  1EF1 C;  3L6A A;  1X5B A;  4LER A;  3P2B A;  5BV0 A;  5EDS A;  3FUM A;  1E8Z A;  4HXI A;  1QNF A;  5EX0 A;  3ONL A;  4I6E A;  3JQ0 A;  2JLB A;  5E76 A;  4AEZ C;  4AVX A;  5JJT A;  4HLE A;  4UWF A;  1FVF A;  3BEE A;  3FUJ A;  3ML9 A;  3PVL A;  4HS2 A;  4QFV A;  4UQX A;  3TG5 A;  4I6J A;  4K0R A;  2OV8 A;  3TAX A;  4B0Z A;  4NUR A;  4LRZ A;  2WXM A;  2VGY A;  3ULQ A;  1EPU A;  3FY4 A;  3IHV A;  2J9Q A;  4FC8 A;  4WWN A;  3CR3 A;  4HOS A;  4M3O A;  3UMV A;  4AOF A;  4JVS A;  2KM4 A;  2FEZ A;  2AW6 A;  3CVN A;  4NQ0 A;  1NA3 A;  2R17 C;  3ASD A;  1H2T C;  3G2T A;  4I1M A;  4TRQ A;  5AJD A;  4GU5 A;  5ENN A;  5AYW D;  5AIJ A;  2X6K A;  4V3I A;  4Y6W A;  3FUD A;  1UJJ A;  3ASH A;  2YHC A;  4GAA A;  4L1B A;  5KJN A;  3LPZ A;  1E7V A;  4ANW A;  4EEC A;  1PC2 A;  4DLQ A;  3ZHE A;  2Y3A A;  4DLO A;  3FTU A;  3HVE A;  5JHA A;  1HXI A;  4DI4 A;  3MGB A;  3FUL A;  1INZ A;  2XCC A;  1MQS A;  2Y4T A;  1PAQ A;  3L08 A;  2FBN A;  2PQN A;  4I2Z A;  3ONK A;  2I1J A;  4J8F A;  4DK5 A;  3FEX A;  5FQ6 A;  3CVW A;  3FFL A;  1JWG A;  2LO6 A;  3CVL A;  3RRM B;  4NAC A;  3FH7 A;  2X6I A;  3VTY A;  1JWF A;  3OXF A;  3UPV A;  3QWW A;  5LP0 A;  4DPR A;  2KZT A;  1Y8M A;  4JHR A;  3SBT B;  4P29 A;  4JW1 A;  4ANU A;  1FCH A;  1HFA A;  3APF A;  3FTS A;  2YHE A;  3EHN A;  3ENE A;  4E85 A;  3MKQ B;  4PUC A;  4CGV A;  4N2S A;  2XEV A;  2VSN A;  4J8S A;  3NZU A;  2XCB A;  4CRW A;  2ION A;  3FU3 A;  3JCK C;  3MKQ A;  3PNL B;  4FUL A;  3T8M A;  1HF8 A;  3PRE A;  4AJW A;  3ESL A;  4CDM A;  3CV0 A;  2WXI A;  1H2V C;  4U0U A;  5FQ7 A;  3QB2 A;  4HOR A;  2CFZ A;  5G2N A;  3ZYL A;  4CGW A;  2X6F A;  3LY7 A;  4CDN A;  2XGM A;  2VGX A;  3FUK A;  4JHK A;  4GCN A;  4WNF A;  3CHO A;  3PDN A;  3U9W A;  4YVO A;  3TGO A;  3QAQ A;  3O48 A;  1HH8 A;  1TEZ A;  4F53 A;  2CHW A;  3SF4 A;  2WQH A;  2X38 A;  1ELW A;  3CHQ A;  4EZJ A;  3RO3 A;  2PZI A;  3APC A;  1XGW A;  4CDR A;  3CK9 A;  3GZ1 A;  3QWP A;  3UT4 A;  2LAI A;  3FHE A;  3T5X A;  5BW8 C;  3R7R A;  3CKC A;  4G23 A;  3FUE A;  2WXH A;  2A5U A;  3ZXS A;  5CMY A;  5EX3 A;  3MX3 A;  3HDX A;  2E2E A;  5FTP A;  4FA6 A;  3S7F A;  3UT7 A;  4FHJ A;  1MHQ A;  4PDX A;  4FLH A;  3BG0 B;  2L0I A;  2HM8 A;  2AXZ A;  3CLJ A;  4I17 A;  3PZD A;  3URZ A;  2YQ8 A;  2WQ6 A;  3QK0 A;  1P5Q A;  4N3A A;  4L23 A;  3TL5 A;  4EQF A;  2DIW A;  3L54 A;  3PS6 A;  1QQE A;  3OTN A;  3FTV A;  5FQ4 A;  3CK8 A;  3FU0 A;  3QJZ A;  2AWI A;  3I4R B;  1KLX A;  3GZS A;  4IRU A;  4JA9 A;  4WAF A;  4AV7 A;  3G2W A;  4N5C A;  2I1K A;  4WWP A;  3GYZ A;  4GYO A;  4JZY A;  4PS3 A;  3LY8 A;  1HO8 A;  4KZC A;  4N3C A;  3EDT B;  4FJZ A;  4YVQ C;  2YNQ A;  4U0Z A;  1WAO 1;  3KAE A;  4RSY A;  4I1A A;  5C1D A;  4CEM A;  3LYA A;  5BNW A;  2CHZ A;  2FUL A;  5LX8 A;  2UY1 A;  4DI3 A;  4PS8 A;  2C0L A;  2I9C A;  4EPZ A;  3DBS A;  5EKQ D;  3RJV A;  1HS6 A;  3CIA A;  2NC9 A;  4XZ4 A;  3RK6 A;  2HYZ A;  3LXU X;  3LKU A;  3CVU A;  4EZL A;  4YND A;  4HVB A;  5FZR A;  2R5S A;  3Q4A B;  3FUI A;  4CT4 A;  2CFU A;  3LEW A;  3VLE A;  2WMO A;  4GA1 A;  3FU5 A;  2DCP A;  2OOE A;  3CVP A;  3NQP A;  4APF A;  4MS6 A;  3D9M A;  3FP3 A;  4FJY A;  3FTX A;  3LDZ A;  3IKO B;  3FTZ A;  3UUX A;  3D9P A;  1HG5 A;  2J4D A;  3B13 A;  4BFR A;  3ZYM A;  5BUZ A;  3ZFW A;  3ASF A;  4GB9 A;  3ZRH A;  1WY6 A;  2X3M A;  4JA7 A;  1U3C A;  2IJG X;  4HOT A;  2ILR A;  4MLP A;  2V5F A;  3TG4 A;  2KCL A;  1OWP A;  3SZ7 A;  2WXQ A;  2WPV A;  2HR2 A;  2LSV A;  1EYH A;  2GW1 A;  2OVB A;  1SZ9 A;  3EHM A;  3FH8 A;  4U04 A;  4XI9 A;  5D0Q D;  3WXX A;  4WNG A;  4UI9 C;  4UWH A;  3QC1 A;  4AXH A;  3CHR A;  2FI7 A;  3SGH A;  1OWL A;  5HQ8 A;  3HHM A;  3LS8 A;  4A1S A;  4UWG A;  2P58 C;  4I9E A;  2PQR A;  3FDH A;  3EIJ A;  4BTB A;  4IUL A;  4U8H A;  4B89 A;  3ASG A;  4BT9 A;  4XKB A;  3EIQ C;  1QZ2 A;  1NA0 A;  1YA0 A;  4KVM A;  2FF4 A;  1E8Y A;  3UQ3 A;  4APO A;  4C0E A;  3FU6 A;  1SQM A;  2L0T B;  4A3V A;  5J90 A;  4C9B B;  5JJ7 A;  1Z3X A;  4KBQ A;  4G24 A;  3K9I A;  3MEK A;  5CCL A;  3PRZ A;  2R59 A;  4J8E A;  3RO2 A;  2X6H A;  1S0P A;  3RIB A;  3ZIM A;  1OUV A;  4LUN U;  2Q7F A;  4TV3 A;  1E96 B;  4ABN A;  4GZ6 A;  1A17 A;  1OWM A;  4Q96 A;  4DJA A;  3B7U X;  4FU3 A;  4WNE A;  2RD0 A;  3R7Q A;  3S7D A;  2WXF A;  3LVR E;  3CVY A;  4ANX A;  4GZC A;  4N3B A;  4AP2 A;  2LSU A;  3Q49 B;  3ZYK A;  3FUH A;  3IEG A;  4ANV A;  1LF8 A;  1PY1 A;  2M63 A;  5KCM A;  4J8D A;  2FO7 A;  4PH4 B;  4PS7 A;  3U66 A;  4R7L A;  2CHX A;  2KC7 A;  2J09 A;  3RKV A;  5C2Y A;  1H0A A;  4FHK A;  2WXK A;  3SI5 A;  3QWV A;  2IQC A;  3CST A;  4I1O B;  2ZU6 B;  2WXJ A;  4GA0 A;  3S7J A;  5CCM A;  5LFA A;  2GGF A;  3RRU A;  4A1G A;  2XQ0 A;  4ACL A;  4XE0 A;  4CCA A;  5BT1 A;  5FT9 A;  4GCO A;  5KJL A;  2IU1 A;  3MCX A;  2WB2 A;  3MJW A;  2C0M A;  4C0M A;  5LCW C;  1TJC A;  3EJN A;  3PNT B;  4XX5 A;  2UWJ G;  3CHP A;  5T8I A;  2VSY A;  1JUQ A;  3O4Z A;  3FTW A;  4KVO A;  5FQ8 A;  3JQ1 A;  3ZPJ A;  3SNX A;  2VYI A;  3CQC B;  2PL2 A;  1UJK A;  2WXR A;  3CHS A;  4KZ0 A;  4G25 A;  4UWK A;  2IF4 A;  3I3N A;  4GYY A;  4UQY A;  2DBA A;  3IHY A;  2WXG A;  3QAR A;  4BY6 A;  2KCV A;  5FZS A;  3ZGQ A;  3CK7 A;  4JPS A;  3VTX A;  3CHM A;  3NF1 A;  4AY6 A;  3QDN A;  3S7B A;  4AIF A;  4B94 A;  3B7T A;  4BX8 A;  4JXT A;  3LY9 A;  5CMW A;  4UI9 J;  5ARF A;  4JL0 A;  5T4Y A;  2CG3 A;  2WXN A;  4GPK A;  3AS5 A;  3PEU B;  5J08 A;  3B7S A;  4WUY A;  4F3V A;  5T3R A;  1B89 A;  5HI7 A;  4FP7 A;  1N52 A;  2BF0 X;  3Q5M A;  2J08 A;  2LNI A;  3JUI A;  4UQZ A;  2OVF A;  5ANL A;  3ZVV A;  1UG3 A;  1L5J A;  3T5V A;  2XHE A;  2VSO E;  5G04 C;  4W9R A;  2WQ7 A;  1ZU2 A;  2NXP A;  3RU0 A;  1N54 A;  4G1T A;  2PM6 A;  4GZD A;  2VJ8 A;  2AXU A;  3D9O A;  3LVQ E;  3KD7 A;  2XGS A;  4O6F A;  1UW4 B;  4KYO B;  3VLD A;  4G2V A;  1HE8 A;  5AEN A;  5LOZ A;  3BG1 B;  5KJM A;  5E75 A;  4WND A;  3Q47 B;  3D3M A;  1NP7 A;  4GZ3 A;  4ACK A;  3UX4 A;  4E6H A;  2XPI A;  5BV1 A;  1OWN A;  1Y6I A;  3OAW A;  1Z3Y A;  3PEV B;  1W3B A;  4U07 A;  2J07 A;  4RG9 A;  3MZL B;  2RG8 A;  3D9J A;  4MRU A;  3SBS A;  4L2Y A;  4AM9 A;  2GRM A;  2XRZ A;  4TUU A;  2JEK A;  3MKR A;  4GML A;  5G05 C;  4ILH B;  2CG2 A;  1SZA A;  3L13 A;  5FJY A;  4BT8 A;  2L9B A;  1E8X A;  2NSZ A;  3QKY A;  4F1S A;  2XRY A;  4UWL A;  1HU3 A;  2I6H A;  1JPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...