2NXPA

Structure of ntd2 domain of the human taf5 subunit of tfiid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
149
structure length
149
Chain Sequence
QPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 5
publication title Structural analysis and dimerization potential of the human TAF5 subunit of TFIID.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 45
structure length 149
sequence length 149
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04494 TFIID_NTD2 WD40 associated region in TFIID subunit, NTD2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nxpA00
2J4BA 2NXPA 2J49A
chains in the Genus database with same CATH superfamily
5ARFA 3ZXSA 3SY2A 4EBAA 3ZYMA 1N4PA 3PE3A 4ATZD 3CVLA 1PAQA 4JHRA 4CZ2D 5KBAA 2B0OE 1E96B 3JCKC 4EECA 4HI8A 2OV8A 2DZNA 1DCEA 3MA5A 1OWNA 2J8SD 3FUKA 3ASFA 3CVPA 2XGMA 3QK0A 2WXRA 2F0YA 2V4LA 5EIBE 1HS6A 4DPRA 3DSUA 3C72A 4HRMB 3D3MA 3MGBA 4F53A 1DNPA 5EIDA 5G04C 3PS6A 1LF8A 3P1UA 5ENNA 2XPIA 3BQOA 3ZKJA 1IXVA 3HVEB 1SZAA 1OWPA 4JEHA 3I4GA 3D9IA 2ZGGA 2LAIA 5KCMA 5B1AE 3DEPA 3HVEA 3PREA 4BX9A 2AXZA 3FUNA 5KJLA 2BKKB 3RO3A 4KYOB 2MOWA 1E7VA 2IOLA 2R03A 2HM8A 4ANXA 4LNBA 2P9UG 2P9IG 4ANVA 4JHJA 3KS2A 2GW1A 2P9LG 5G2NA 2HE0A 4UUCA 4HOQA 4MRUA 4FC8A 2AWIA 3UM3A 2M63A 2XRZA 1K1AA 2KCKA 4LNUD 3UKRG 3AG3E 3ZXPA 1H2VC 2RFAA 4JA7A 2IFUA 4RVBA 2J49A 3HRAA 4ACKA 5B1BE 1E8WA 2BUGA 4K5BA 1D8EA 4A1GA 3JXJA 2F37A 2Y4UA 3ZU7B 5KJKA 4ANUA 5LCWC 1BLXB 3UIOC 4DX7D 3EHRA 4GTPA 3SFXA 1JUQA 4MBGA 1WM5A 3QKYA 3FTXA 3Q15A 3KD7A 4CDMA 4ANWA 1L5JA 4TUMA 2XGOA 1V55E 5CRUA 3AS8A 3ML9A 1TJCA 2VJ8A 2V5FA 4MS6A 3U64A 3APFA 1HH8A 2V8SE 5EKQD 5CCLA 1Z3YA 3LS8A 5FQ8A 3B95A 3EJNA 4K0RA 2XHEA 4GMLA 1E8ZA 4DX1A 2VSXE 5EYPF 4CYMD 2XRYA 3LJNA 4HFGA 3UT4A 2V0PA 3PE4A 1S70B 2P9KG 5D0QD 2A5EA 4J7WA 3UM2A 2NSZA 1SZ9A 3CQCB 4N3AA 4XEIG 3FH7A 4FU3A 2ONDA 4CCAA 2VGEA 2PNNA 3NB2A 3FEYA 2CFUA 4UWHA 2DYSE 5CMYA 1OWOA 2PM6A 1N0QA 4G2VA 3BU8A 4JB8P 3UXGA 3NZSA 1FT2A 4RG9A 3LKUA 1EDUA 4BESA 3TJPA 4J8YA 3EU9A 2WPVA 3FY4A 3UINC 1IHGA 2X6KA 3PRZA 1E90A 4UWFA 1DCQA 4J6IA 1YMPA 4X8QA 5G05J 1H19A 2I6HA 5EX3A 5J08A 5T3RA 3D9MA 3ZW3A 3HYMB 5LFAA 3HXCA 4WWPA 2GRLA 1JCSA 3T8KA 4B8AA 3S7DA 3FHEA 4BTAA 3CVQA 2X6FA 3IV0A 2J9QA 3W9GA 3IXEA 4K5AB 3DXMG 3JXIA 2X6JA 3Q73A 5T4YA 4BT9A 1FPPA 2MHKA 3AJIA 5CMWA 4FA6A 1TJFA 1X5BA 3ULQA 3GZ1A 4PS7A 3AAAC 4ACLA 5HS0A 2YINA 2R17C 2WMNA 2L9BA 3GW4A 3VLFA 3IHYA 5A7DB 5FQ4A 4I9CA 4BSZB 2WXGA 4LNGA 1WAO1 3FEXA 1DVPA 3MX3A 3EHMA 2ETCA 2JEKA 1N11A 1N9AA 3L82A 1EYHA 5D0OD 1SA5A 3LY7A 4IN3B 2X6HA 1MX6A 4GTRA 1U2VG 5FTPA 3OXGA 2UWJG 1N4RA 3LPZA 2GRQB 2CHXA 3U66A 4GAAA 3ABKE 4JXTA 2J07A 3QWPA 1ELKA 2OCCE 4O60A 2ETAA 2ZIRA 2XQ0A 3TWVA 3Q7AA 3T5VA 2HYZA 3T8MA 1HF8A 4YDYA 2IJGX 3FUEA 2H6IA 3EDTB 1N4QA 2J4DA 3CVWA 4HOSA 2FEZA 4U07A 1HX8A 3Q79A 4GTMA 4CDRA 2LSUA 4GZ5A 3FU0A 3ASDA 4I1MA 2QYUA 4FLBA 4OYSA 2L6JA 4A55A 2V5QC 2BEDA 2CHZA 3EU5A 4TV3A 4D10C 2GGFA 5C2YA 2RD0A 1JCRA 3L16A 1ELRA 3CVVA 4WNFA 2QY7A 3LVQE 4RG6A 3CHRA 3HDXA 4Q69A 3D9HA 3HHMA 4G24A 2UY1B 3Q5MA 3D9KA 4J8DA 4DK5A 4IRUA 2AJAA 4HOUA 3G2WA 3TWWA 2BF0X 2UY1A 3L6AA 4ZFHA 3QB2A 5AIJA 4U0ZA 5E75A 1HFAA 2J09A 4UI9C 4O1OA 4CGVA 3ZRHA 3B7SA 1TNZA 2F8YA 1E7UA 3S7FA 3TG5A 3LJ3A 1OCRE 2VSYA 1H2TC 5BUZA 2PL2A 3PUKA 5AN8A 3TAXA 1TNYA 1FVHA 4KT6B 4UWLA 1D9SA 5LOZA 4F3VA 3GYZA 3WG7E 1TNUA 1JWGA 2Y3AA 1BU9A 3FP3A 1QNFA 2XZTG 4DRXE 1HZ4A 4I6JA 5D66A 4FHJA 5HRYA 4LSZE 3GZSA 1O5MA 4HS2A 1TNOA 1OCCE 4RQIA 3LY9A 3ZYQA 2DYRE 3ML8A 1AP7A 2Y4TA 1TN7A 3SHFA 1UN8A 2LUHA 3L9TA 4NURA 2WMOA 4OAVB 4ME2A 3TWXA 2WXKA 5JHBA 5BW8C 1FVFA 4B94A 3FH8A 3V2OA 4GPMA 5EDSA 1FCHA 1IQUA 4JHKA 4GCNA 2VTBB 4P29A 1O1TA 2H6FA 5HI7A 2XEVA 3HXEA 3WXXA 4LRZA 4I2WA 1OCZE 2EINE 3UX4A 4ATGA 3UKUG 1QBQA 2F8XK 3UPVA 3EHQA 2IO3C 3ZN3A 5JJ6A 3N71A 4BY6A 1YYHA 1N52A 4I43A 4FLHA 1MX4A 4JVSA 3ENEA 4BETA 1YA0A 4KVOA 2RFMA 4TXRA 3CR3A 3CV0A 3LYAA 4BX8A 1W3BA 4G11A 4I9EA 3FTYA 3PDNA 4GYWA 2IU1A 3ISMC 3J5PA 4I1OB 4FJYA 4AJWA 3TWTA 4UQXA 2X3MA 5ARGA 4W9RA 2EIJE 1KT0A 4RLYA 2QFCA 3V30A 4XI9A 4GTSA 2YNQA 3LVRE 4QQIA 2DZOA 3DSWA 3QOUA 2KM4A 3RK6A 5KWDA 5ANRA 3CLJA 1H6KA 3O48A 3MV2B 3RRUA 5CECB 3OTNA 1Z6TA 3TWSA 4DI4A 4C0MA 3APDA 3R9AB 1AWCB 1WDYA 1E8YA 4JEUA 3NBNB 5M72A 3LCAA 4LEUA 4PUCA 3OXLA 5JA4D 2Q7FA 4BFRA 3LDZA 3IKOB 3QAQA 4XKBA 2NYJA 3DWLG 1UW4B 2WQ7A 4M7CA 1E8XA 1KLXA 1OWLA 2LXMA 4GZDA 4J8FA 2DCPA 3PNTB 1OXJA 3KAEA 4I17A 5ANLA 3FTWA 5T8IA 1S0PA 3R7QA 3L22A 2XPZA 3ULEG 3UM0A 2XEHA 4HORA 3QARA 4KXKB 3UUXA 2YHEA 4WUYA 1MQSA 4AM9A 4G8LA 2I1JA 3ESLA 3W9FA 4L2LA 3NOCD 4AOFA 4HLEA 3DEOA 2WXQA 3MJWA 1H0AA 1A17A 2ZU6B 3E33A 4F1SA 3PUJA 3D9PA 4EZKA 3S7JA 1O1SA 5KJMA 3D9LA 2EILE 1TYQG 2ILRA 1MX2A 4B89A 3LY8A 1Z5SC 4ILGA 3UT8A 4EZLA 3TWUA 5JJ7A 2R2LA 2XEEA 2ZGDA 4XZ4A 4AEZC 4CEMA 5J90A 3DSSA 1UOHA 4CRWA 4U8YD 4GTOA 4APFA 3FTZA 3VLDA 4U8HA 4U95D 3BUAA 3L08A 2P9PG 2LAHA 1KZOA 1HE8A 2HO1A 3B7UX 3TXNA 3RO2A 3B7BA 3QWWA 5FZQA 3MEKA 5BV0A 5D2MC 5FT9A 4BEPA 4GMRA 1PC2A 4YVOA 3MKQB 3ASHA 1N95A 1BI7B 3SFYA 1U3DA 3L54A 3FWVA 2NC9A 4GYYA 2AVPA 4A63B 4YDOA 2IONA 4DUIA 2B6CA 2CFZA 1Y6IA 4OAUC 1MZCA 4U0UA 3ZUVB 4BT8A 2P9SG 4PS8A 2HR2A 4HB5A 2ZXWE 5DBKA 4O6FA 3D9JA 5KNHD 2GRMA 5BPPA 3CHSA 4XX5A 4JW1A 3T9KA 4GZCA 2IOSA 4XE0A 2JABA 3CVYA 4XKCA 3ZPJA 3MV3B 4HRNA 1OY3D 2WVIA 2IEJA 3ULYA 4UWGA 2WXOA 3UI2A 2XCBA 5FQ6A 3DBSA 4GZ6A 4AXHA 4F6RD 3C5RA 4HOTA 2GROB 3T5XA 3U3WA 1K8KG 3Q49B 2VGXB 4AY5A 5JJTA 3SO8A 1S64A 4EPZA 4U0SA 2VGXA 2VYIA 5FZSA 3D9NA 2R02A 3PEUB 5EN5D 1PY1A 3IHVA 2AW6A 2I1KA 4FADA 3QWVA 3JUIA 2IQCA 1ELWA 3OXFA 5EYLA 5EILA 4GA0A 4NACA 4CGWA 3FUHA 2KC7A 3ASGA 1KT1A 3MZLB 3C3QA 5CEAA 3KEAA 1EPUA 4R7LA 4WNDA 4JD2G 4KZ0A 4L2YA 5CRVA 3L13A 1OUVA 4ILHB 2VSOE 5B3SE 4JZYA 4WNGA 5IY5E 3SBSA 5G04J 4I1AA 1SVXA 2MRIA 1DC2A 3ZEFA 3CHQA 5G55A 3FTSA 4N39A 3ASOE 3FU6A 1UG3A 3CK9A 1UJJA 3B13A 1X81A 3PZ3A 1ZU2A 4G8KA 1S63A 3SQVA 2KCVA 4WWNA 4TXQA 2AXVA 5G05C 2I9CA 3HIZA 1NA0A 4Y6CA 2XENA 1HG2A 3V2XA 2EQXA 3SI5A 4I6GA 1OWMA 3ONLA 3FTVA 1XGWA 3FUDA 3PVLA 2R59A 4KBQA 4URKA 3PH0C 1TR4A 2MYOA 2NXPA 2LO6A 1N54A 3Q9NC 3TXMA 2VSNA 3D9OA 3ZYLA 4BTBA 2DWZA 3SNXA 1UJKA 4L23A 4EQFA 5CHEE 3CKBA 4WNEA 3EUVA 3BG1B 4ILIA 4J8EA 4N3BA 2IY0C 1KPSB 3HG0D 4NQ0A 2WQ6A 5BT1A 1SQMA 3G2VA 4GCOA 2OEWA 1V54E 5AQ7A 1BD8A 2WXNA 2Y0BG 4UQZA 5JMND 1B89A 4XIFA 1TN6A 3PZ2A 1GW6A 3AU4A 2DBAA 4U04A 2GRRB 4GPKA 2C0LA 4GTTA 3CVXA 3UMVA 5AARA 1H6OA 3L17A 1QYMA 2LXLA 4J8SA 2VQ2A 4N2SA 3PZ1A 3CQGB 3IEGA 2AXUA 4LERA 4C9BB 4O1PA 2PM7A 2Y69E 3RKVA 2OOEA 4FHKA 5FQ7A 4H7XA 4B93B 5FJYA 3S2AA 4UQYA 3IBEA 4DI3A 3MYVA 3TL5A 4GTQA 1IHBA 4KVMA 4C48B 3J5QB 3TWQA 1VDYA 3E37A 3EIJA 5A6CA 2P2CP 2VTBA 3FFLA 2LNIA 4ZHBA 5C1DA 2PQRA 1BI8B 4DX6D 4Y6WA 5FWQA 4JA9A 4AY6A 2IO2C 4DX5D 1NI1A 1N0RA 4HXIA 2KZTB 2XGSA 5FINA 1SA4A 3FTUA 3FH5A 1NL4A 4GTVA 3VTXA 2WM9A 2CG3A 3PZ4A 3MKRA 3I3NA 4GMJA 2DIWA 1A5EA 3CK7A 2KZTA 5BXUA 3S7BA 3FDHA 4C0EA 1HU3A 4YNDA 4AV7A 2OVBA 2BKGA 2H6HA 5AAOA 3SF4A 2WQHA 3NZUA 1K1BA 4L1BA 3TWRA 1INZA 1JCQA 4HBDA 5FZRA 5BNWA 2ETBA 4V3IA 2Y1LE 4EZJA 3AU5A 4LUNU 2PQNA 2KXPC 1HXIA 2FULA 4KZCA 3U9WA 3FULA 3G2TA 4HI9A 3CHOA 2WXFA 3ASNE 1N4SA 1NP7A 5A23A 4NIKA 3AG2E 4F7AA 2EIKE 3APCA 3K9IA 2VGYA 4AVXA 5ENQD 3CHPA 3LEWA 2YHCA 2L0IA 2P9NG 3Q75A 3OAWA 4APOA 3DSXA 1RW2A 4DJAA 3ZYKA 2WXJA 3CSTA 4N3CA 3C98A 3PEVB 4I6EA 3JYSA 3V31A 2KATA 2R05A 1LD8A 1HO8A 3FUMA 4TUUA 2RG8A 4PS3A 5AYWD 1WY6A 3F6QA 4WAFA 3QC1A 3NF1A 5BXOA 4FJZA 1D8DA 4M3OA 4CT4A 2WXIA 1Q2ZA 3AG4E 3Q78A 5AQ9A 4DX2A 5CCMA 3ZIMA 3DXKG 3TG4A 3ZNGA 4HVBA 4AP2A 2LSVA 5FIOA 3SZ7A 1KZPA 2RKKA 3CVNA 5CBOA 4N2QA 5AJDA 1ZB1A 4TXPA 2XPYA 4YDWA 3Q47B 4LG6A 3P2BA 4G1TA 1JWFA 5BV1A 3E30A 4OVUA 4U8VD 5AENA 3SFZA 3SD5A 4E6HA 4E85A 5ENRD 2J4BA 2ZISA 2IF4A 3CKCA 3I5PA 2GRPB 4GA1A 5LX8A 3KSQA 3HXDA 3JQ1A 4RSYA 3O4ZA 3ZVVA 2XZDG 1P5QA 2R5SA 1EF1C 5AQAA 3RIBA 2FI7A 1TNBA 1Y8MA 2A5UA 3RJVA 3NOGD 3UT7A 5ENSD 3RSEG 5JHAA 4HNAD 2WXHA 3FUIA 2WXMA 5KNGA 3LXUX 5H7PA 3QJZA 4GB9A 5AQBA 3R9MA 4N5CA 2I2OA 3Q9UC 4Q96A 5CERB 3MKQA 4I2ZA 3V79K 4AIFA 1YCSB 2A4ZA 4ABNA 1UN9A 4GYOA 3Q4AB 4JC8A 4UI9J 3B7RL 4KMOA 3CIAA 4A3VA 1QZ2A 5E76A 1LTXA 2KCLA 4DLQA 3PNLB 2GRNB 1JPLA 3DPDA 4K03A 3DSVA 4HRLA 2XS1A 4B8CB 2FF4A 3KSLA 2C2LA 4G25A 3KEZA 4HQDA 4Q94A 3ESKA 1N94A 4GA2A 2E2EA 1H2UA 5ENOD 3CVUA 3U4TA 1NA3A 3UM1A 3CSFA 2KBXA 4L7TA 3X2QE 2PZIA 3VTYA 4A1SA 1IYGA 4WWOA 1MYOA 4Z68A 3R7RA 3EHNA 4MLPA 3TGOA 4FULA 1TEZA 2FO7A 3RU0A 2XCCA 1IQRA 4GU5A 3G2UA 3FU5A 2FO1E 1NFIE 5KJNA 3EIQC 4NRHB 4A3TA 2CHWA 1NZNA 4FP7A 3ABME 3UTMA 4F1PA 2WB2A 1MJ0A 3JUEA 3G2SA 1FT1A 4U96D 3RAUA 4K5CA 3ABLE 1SW6A 3QDNA 4U63A 4H7YA 2EIME 3DSTA 1HG5A 5HQ8A 4G23A 1BPOA 3ONKA 2OVFA 1MHQA 3NAWA 3SGHA 4J0UA 4LCTA 2DVWA 4IULA 3URZA 3BG0B 3SBTB 2CG2A 3VLEA 4CDNA 4G26A 3AS5A 3ZFWA 3E34A 4N5QA 4PH4B 4UI9K 5HKPA 1O1RA 3UQ3A 5ITZF 3CK8A 1K3ZD 4IYPA 2QZAA 3ZGQA 3B7TA 4JL0A 4YDEA 3Q7FA 4BSXA 1QQEA 3DPYA 5EX0A 3RRMB 4U7EB 3DRAA 5ENTD 1LD7A 1U3CA 4TRQA 1WG0A 2FBNA 1IKND 4BERA 5CEDB 1Z3XA 3CHMA 4OVVA 3C3OA 2P58C 1OT8A 2E0IA 3FUFA 3E4BA 1H6PA 2L0TB 2WXLA 5ENPD 4DLOA 2WXPA 3PZDA 3JQ0A 1G3NB 1ZBPA 5DIZA 2BTDA 4MKTA 2J08A 3MCXA 4YVQC 3QNKA 2V4HC 4PDXA 5CBNA 2QC9A 4EHMA 5AJLA 4B0ZA 3AG1E 2C0MA 3HXFA 3I4RB 3HXBA 2YQ8A 3C3RA 4CT0A 5LCWJ 3FUJA 3FU3A 2X6IA 2X38A 2L6BA 1TN8A 3GZ2A 4BWRA 4HLLA 2OEVA 2QYJA 4L9PA 3ZHEB 3CEQA 5LP0A 3NQPA 3RRNB 3BEEA 3UIPC 4UWKA 1RZ4A 4EBAG 3E32A 1XNFA 1OCOE 3ZHEA 4GZ3A 4XI0A 3AS4A 2H6GA 4JPSA 4QFVA 3CGHA 2XS8A 2JLBA
chains in the Genus database with same CATH topology
5ARFA 3ZXSA 3QWWA 5FZQA 4CDRA 4EBAA 2LSUA 3MEKA 4GZ5A 5BV0A 5FT9A 3ZYMA 1PC2A 3FU0A 3ASDA 3PE3A 3CVLA 4I1MA 4YVOA 1PAQA 4F7AA 4JHRA 3APCA 3K9IA 4FLBA 2VGYA 4OYSA 4AVXA 2L6JA 3CHPA 3MKQB 1E96B 4A55A 3LEWA 3JCKC 4EECA 2YHCA 2L0IA 3ASHA 2OV8A 2CHZA 3OAWA 4APOA 3RO2A 1U3DA 3L54A 3FWVA 2NC9A 3MA5A 4TV3A 4D10C 2GGFA 2AVPA 1OWNA 4GYYA 3FUKA 2WXJA 3ZYKA 4DJAA 3CSTA 2IONA 3ASFA 5C2YA 4N3CA 3C98A 2RD0A 3L16A 1ELRA 3CVPA 2CFZA 3PEVB 1Y6IA 2XGMA 4I6EA 3QK0A 4WNFA 3CVVA 3JYSA 2QY7A 3LVQE 4RG6A 2KATA 3CHRA 2WXRA 3HDXA 4BT8A 4U0UA 1HO8A 2V4LA 1HS6A 3FUMA 4DPRA 4TUUA 4PS8A 2HR2A 2RG8A 4PS3A 4Q69A 5AYWD 1WY6A 4WAFA 5DBKA 3QC1A 4O6FA 3D3MA 3HHMA 3MGBA 4G24A 4F53A 1DNPA 2UY1B 3Q5MA 3NF1A 3D9KA 3D9JA 4FJZA 4J8DA 5G04C 4DK5A 3PS6A 4IRUA 2GRMA 5BPPA 1LF8A 3CHSA 4XX5A 4JW1A 4HOUA 4M3OA 4CT4A 3G2WA 3P1UA 2WXIA 4GZCA 5ENNA 2IOSA 4XE0A 2BF0X 2XPIA 3CVYA 4XKCA 2UY1A 3ZPJA 3MV3B 3L6AA 3QB2A 5CCMA 5AIJA 4U0ZA 2WVIA 3ZIMA 5E75A 3HVEB 4HVBA 1HFAA 1SZAA 2J09A 1OWPA 4JEHA 3TG4A 4UWGA 4AP2A 3I4GA 4UI9C 2LSVA 3SZ7A 3D9IA 4CGVA 3ZRHA 3B7SA 2WXOA 3CVNA 2LAIA 5KCMA 2XCBA 5FQ6A 3DBSA 4GZ6A 4AXHA 4HOTA 3HVEA 4N2QA 3PREA 5AJDA 4BX9A 2AXZA 1E7UA 3FUNA 3T5XA 5KJLA 2XPYA 3S7FA 3U3WA 3Q49B 2VGXB 3TG5A 3Q47B 3RO3A 4KYOB 2MOWA 3P2BA 4G1TA 3LJ3A 1JWFA 5BV1A 4AY5A 1E7VA 5JJTA 2IOLA 2HM8A 4OVUA 4EPZA 2VSYA 4ANXA 4U0SA 2VGXA 5AENA 3SFZA 1H2TC 3SD5A 4ANVA 4E6HA 2VYIA 4JHJA 5FZSA 4E85A 5BUZA 3KS2A 3D9NA 2J4BA 2GW1A 2PL2A 3PUKA 3PEUB 2IF4A 3CKCA 5G2NA 3TAXA 1FVHA 1PY1A 3IHVA 4KT6B 2AW6A 2I1KA 3I5PA 4GA1A 4FADA 4HOQA 4UWLA 5LX8A 3QWVA 3JUIA 4MRUA 3JQ1A 4FC8A 5LOZA 2AWIA 4F3VA 4RSYA 3O4ZA 3ZVVA 3GYZA 2M63A 2IQCA 2XRZA 1ELWA 1P5QA 1EF1C 2R5SA 2KCKA 1JWGA 3OXFA 2Y3AA 4GA0A 4NACA 3RIBA 3FP3A 4CGWA 1QNFA 2FI7A 1HZ4A 3FUHA 1Y8MA 1H2VC 4I6JA 2KC7A 2IFUA 3ASGA 4JA7A 4RVBA 1KT1A 2J49A 3MZLB 2A5UA 3RJVA 4ACKA 3UT7A 4FHJA 1E8WA 1EPUA 4R7LA 4WNDA 3GZSA 4HS2A 4KZ0A 4L2YA 5JHAA 2BUGA 3L13A 3LY9A 3ZYQA 1OUVA 2WXHA 3FUIA 4ILHB 4A1GA 2VSOE 2Y4UA 2WXMA 4JZYA 3ML8A 5KJKA 4WNGA 3LXUX 3SBSA 4ANUA 5G04J 2Y4TA 3QJZA 3SHFA 5LCWC 4GB9A 4I1AA 1UN8A 4N5CA 2I2OA 4NURA 2WMOA 4Q96A 2MRIA 3ZEFA 3MKQA 4I2ZA 4ME2A 4AIFA 2A4ZA 3CHQA 2WXKA 5G55A 5JHBA 3FTSA 1FVFA 5BW8C 4ABNA 4N39A 1JUQA 3FU6A 1UN9A 1WM5A 1UG3A 3CK9A 4GYOA 3Q4AB 3QKYA 3FTXA 3Q15A 4JC8A 3KD7A 4B94A 3FH8A 4CDMA 1UJJA 4UI9J 3B7RL 4ANWA 3B13A 1L5JA 4KMOA 3CIAA 2XGOA 4A3VA 5EDSA 1ZU2A 3AS8A 3ML9A 1FCHA 1QZ2A 5E76A 2KCLA 1TJCA 2VJ8A 2V5FA 3PNLB 1IQUA 4JHKA 4MS6A 4DLQA 4GCNA 1JPLA 2VTBB 3DPDA 4P29A 3U64A 3APFA 2KCVA 1HH8A 2V8SE 4WWNA 2AXVA 4K03A 5EKQD 5CCLA 5G05C 1Z3YA 4B8CB 2I9CA 3LS8A 3HIZA 5FQ8A 1NA0A 4Y6CA 2FF4A 3EJNA 4K0RA 2XHEA 5HI7A 4GMLA 2C2LA 1HG2A 2XEVA 1E8ZA 4G25A 3WXXA 3KEZA 2EQXA 4LRZA 2VSXE 4I2WA 3SI5A 4I6GA 1OWMA 4Q94A 2XRYA 3ESKA 4HFGA 3UT4A 2V0PA 3UX4A 3PE4A 3ONLA 3FTVA 1XGWA 3FUDA 3PVLA 4GA2A 2R59A 4ATGA 4KBQA 2E2EA 1H2UA 5D0QD 3CVUA 2NSZA 1SZ9A 4URKA 3U4TA 3CQCB 1NA3A 3CSFA 3PH0C 4N3AA 4L7TA 3UPVA 3FH7A 4FU3A 2ONDA 2NXPA 2PZIA 4CCAA 2LO6A 3VTYA 4A1SA 1IYGA 1N54A 4WWOA 3ZN3A 5JJ6A 3EHNA 3R7RA 4MLPA 3TXMA 2VSNA 3TGOA 3N71A 4BY6A 4FULA 3D9OA 1N52A 4I43A 1TEZA 3ZYLA 4BTBA 4FLHA 2FO7A 3FEYA 2CFUA 4JVSA 3ENEA 3RU0A 1YA0A 2XCCA 4KVOA 3SNXA 4UWHA 1IQRA 4GU5A 1UJKA 3CR3A 3G2UA 3FU5A 3CV0A 3LYAA 1OWOA 2PM6A 5CMYA 4BX8A 1W3BA 4G11A 4L23A 4I9EA 3FTYA 4EQFA 3PDNA 4GYWA 5KJNA 3EIQC 4NRHB 2IU1A 4I1OB 4A3TA 2CHWA 5CHEE 4FJYA 3CKBA 4G2VA 4AJWA 4WNEA 4UQXA 1NZNA 2X3MA 4FP7A 3BG1B 4ILIA 2WB2A 4J8EA 3NZSA 4N3BA 5ARGA 3G2SA 4W9RA 1KT0A 4RG9A 2QFCA 3LKUA 1EDUA 3QDNA 4NQ0A 4XI9A 2WQ6A 2YNQA 3LVRE 5BT1A 1SQMA 3G2VA 4U63A 4H7YA 4GCOA 3TJPA 2WXNA 3QOUA 2KM4A 4UQZA 3RK6A 1B89A 1HG5A 4XIFA 5HQ8A 5ANRA 3CLJA 1GW6A 3AU4A 1BPOA 2DBAA 2WPVA 1H6KA 4G23A 4U04A 3O48A 3MV2B 3ONKA 4GPKA 2OVFA 3RRUA 3FY4A 3OTNA 1MHQA 2C0LA 1IHGA 1Z6TA 4DI4A 3CVXA 3SGHA 4C0MA 3UMVA 4J0UA 3APDA 4LCTA 4IULA 3L17A 3R9AB 3URZA 2X6KA 1E8YA 1E90A 3PRZA 4UWFA 4J8SA 4JEUA 5M72A 4J6IA 2VQ2A 3BG0B 4N2SA 3LCAA 3CQGB 4LEUA 4PUCA 3IEGA 5G05J 2AXUA 2CG2A 3SBTB 3VLEA 3OXLA 4CDNA 1H19A 2I6HA 4LERA 5EX3A 4C9BB 2Q7FA 4BFRA 5J08A 3LDZA 4G26A 5T3RA 3AS5A 3IKOB 2PM7A 3D9MA 3QAQA 3ZFWA 4XKBA 3RKVA 3HYMB 3ZW3A 2OOEA 4FHKA 5FQ7A 4H7XA 5LFAA 1UW4B 4PH4B 4UI9K 5FJYA 3UQ3A 4WWPA 1E8XA 3S2AA 2WQ7A 2GRLA 1KLXA 4UQYA 1OWLA 4B8AA 3CK8A 3IBEA 3S7DA 4GZDA 4J8FA 2DCPA 4IYPA 3PNTB 4DI3A 3MYVA 3TL5A 3ZGQA 3B7TA 4JL0A 3KAEA 3FHEA 4I17A 4KVMA 5ANLA 4BTAA 3FTWA 4BSXA 5T8IA 3CVQA 1QQEA 1S0PA 5EX0A 2X6FA 3IV0A 3RRMB 1VDYA 2J9QA 3R7QA 3EIJA 3L22A 2XPZA 5A6CA 1U3CA 2X6JA 4TRQA 5T4YA 2VTBA 3FFLA 2LNIA 2FBNA 5C1DA 2PQRA 4BT9A 4HORA 3QARA 4KXKB 3UUXA 1Z3XA 2MHKA 2YHEA 5CMWA 3CHMA 4OVVA 2P58C 4WUYA 4Y6WA 2E0IA 5FWQA 4FA6A 1MQSA 4JA9A 1TJFA 1X5BA 3ULQA 4AY6A 3FUFA 4AM9A 3E4BA 2I1JA 3GZ1A 3ESLA 4PS7A 4L2LA 4ACLA 4AOFA 2L0TB 2YINA 2WXLA 2R17C 4DLOA 4HXIA 2WMNA 2WXPA 2KZTB 4HLEA 2XGSA 2L9BA 3FTUA 3PZDA 3FH5A 3GW4A 3VLFA 3VTXA 3IHYA 3JQ0A 5A7DB 2WM9A 1ZBPA 5FQ4A 2CG3A 4I9CA 5DIZA 2BTDA 2WXGA 3MKRA 3I3NA 4GMJA 4MKTA 2DIWA 2WXQA 2J08A 3MCXA 4YVQC 3CK7A 2KZTA 1WAO1 3MJWA 3FEXA 3QNKA 4PDXA 1DVPA 3MX3A 3EHMA 1H0AA 3S7BA 2JEKA 1A17A 3FDHA 4C0EA 2ZU6B 5AJLA 4B0ZA 3PUJA 4F1SA 2C0MA 1EYHA 5D0OD 3I4RB 3D9PA 1HU3A 4YNDA 4EZKA 4AV7A 2YQ8A 3LY7A 3S7JA 2OVBA 4IN3B 2X6HA 5KJMA 3D9LA 5FTPA 3OXGA 2UWJG 3SF4A 2WQHA 3NZUA 4CT0A 5LCWJ 2ILRA 3FUJA 3LPZA 2CHXA 3FU3A 3U66A 4L1BA 4GAAA 1INZA 2X6IA 2X38A 4B89A 3LY8A 3GZ2A 4ILGA 3UT8A 4EZLA 4BWRA 4JXTA 5FZRA 5BNWA 2J07A 3QWPA 1ELKA 5JJ7A 4AEZC 5J90A 4XZ4A 3ZHEB 4CEMA 4V3IA 4EZJA 4CRWA 2XQ0A 3AU5A 3CEQA 4LUNU 5LP0A 3T5VA 2HYZA 3T8MA 3NQPA 3RRNB 2PQNA 4APFA 1HF8A 3FTZA 2IJGX 3VLDA 3BEEA 1HXIA 2FULA 4KZCA 4U8HA 3U9WA 3FULA 3FUEA 4UWKA 4EBAG 3G2TA 3EDTB 3L08A 1XNFA 2J4DA 2LAHA 3CHOA 3ZHEA 4GZ3A 4XI0A 3CVWA 2WXFA 4HOSA 2FEZA 3AS4A 4U07A 1HE8A 2HO1A 1HX8A 3B7UX 3TXNA 4JPSA 4QFVA 1NP7A 5A23A 3CGHA 2JLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4B A;  2NXP A;  2J49 A; 
#chains in the Genus database with same CATH topology
 5ARF A;  3ZXS A;  3SY2 A;  4EBA A;  3ZYM A;  1N4P A;  3PE3 A;  4ATZ D;  3CVL A;  1PAQ A;  4JHR A;  4CZ2 D;  5KBA A;  2B0O E;  1E96 B;  3JCK C;  4EEC A;  4HI8 A;  2OV8 A;  2DZN A;  1DCE A;  3MA5 A;  1OWN A;  2J8S D;  3FUK A;  3ASF A;  3CVP A;  2XGM A;  3QK0 A;  2WXR A;  2F0Y A;  2V4L A;  5EIB E;  1HS6 A;  4DPR A;  3DSU A;  3C72 A;  4HRM B;  3D3M A;  3MGB A;  4F53 A;  1DNP A;  5EID A;  5G04 C;  3PS6 A;  1LF8 A;  3P1U A;  5ENN A;  2XPI A;  3BQO A;  3ZKJ A;  1IXV A;  3HVE B;  1SZA A;  1OWP A;  4JEH A;  3I4G A;  3D9I A;  2ZGG A;  2LAI A;  5KCM A;  5B1A E;  3DEP A;  3HVE A;  3PRE A;  4BX9 A;  2AXZ A;  3FUN A;  5KJL A;  2BKK B;  3RO3 A;  4KYO B;  2MOW A;  1E7V A;  2IOL A;  2R03 A;  2HM8 A;  4ANX A;  4LNB A;  2P9U G;  2P9I G;  4ANV A;  4JHJ A;  3KS2 A;  2GW1 A;  2P9L G;  5G2N A;  2HE0 A;  4UUC A;  4HOQ A;  4MRU A;  4FC8 A;  2AWI A;  3UM3 A;  2M63 A;  2XRZ A;  1K1A A;  2KCK A;  4LNU D;  3UKR G;  3AG3 E;  3ZXP A;  1H2V C;  2RFA A;  4JA7 A;  2IFU A;  4RVB A;  2J49 A;  3HRA A;  4ACK A;  5B1B E;  1E8W A;  2BUG A;  4K5B A;  1D8E A;  4A1G A;  3JXJ A;  2F37 A;  2Y4U A;  3ZU7 B;  5KJK A;  4ANU A;  5LCW C;  1BLX B;  3UIO C;  4DX7 D;  3EHR A;  4GTP A;  3SFX A;  1JUQ A;  4MBG A;  1WM5 A;  3QKY A;  3FTX A;  3Q15 A;  3KD7 A;  4CDM A;  4ANW A;  1L5J A;  4TUM A;  2XGO A;  1V55 E;  5CRU A;  3AS8 A;  3ML9 A;  1TJC A;  2VJ8 A;  2V5F A;  4MS6 A;  3U64 A;  3APF A;  1HH8 A;  2V8S E;  5EKQ D;  5CCL A;  1Z3Y A;  3LS8 A;  5FQ8 A;  3B95 A;  3EJN A;  4K0R A;  2XHE A;  4GML A;  1E8Z A;  4DX1 A;  2VSX E;  5EYP F;  4CYM D;  2XRY A;  3LJN A;  4HFG A;  3UT4 A;  2V0P A;  3PE4 A;  1S70 B;  2P9K G;  5D0Q D;  2A5E A;  4J7W A;  3UM2 A;  2NSZ A;  1SZ9 A;  3CQC B;  4N3A A;  4XEI G;  3FH7 A;  4FU3 A;  2OND A;  4CCA A;  2VGE A;  2PNN A;  3NB2 A;  3FEY A;  2CFU A;  4UWH A;  2DYS E;  5CMY A;  1OWO A;  2PM6 A;  1N0Q A;  4G2V A;  3BU8 A;  4JB8 P;  3UXG A;  3NZS A;  1FT2 A;  4RG9 A;  3LKU A;  1EDU A;  4BES A;  3TJP A;  4J8Y A;  3EU9 A;  2WPV A;  3FY4 A;  3UIN C;  1IHG A;  2X6K A;  3PRZ A;  1E90 A;  4UWF A;  1DCQ A;  4J6I A;  1YMP A;  4X8Q A;  5G05 J;  1H19 A;  2I6H A;  5EX3 A;  5J08 A;  5T3R A;  3D9M A;  3ZW3 A;  3HYM B;  5LFA A;  3HXC A;  4WWP A;  2GRL A;  1JCS A;  3T8K A;  4B8A A;  3S7D A;  3FHE A;  4BTA A;  3CVQ A;  2X6F A;  3IV0 A;  2J9Q A;  3W9G A;  3IXE A;  4K5A B;  3DXM G;  3JXI A;  2X6J A;  3Q73 A;  5T4Y A;  4BT9 A;  1FPP A;  2MHK A;  3AJI A;  5CMW A;  4FA6 A;  1TJF A;  1X5B A;  3ULQ A;  3GZ1 A;  4PS7 A;  3AAA C;  4ACL A;  5HS0 A;  2YIN A;  2R17 C;  2WMN A;  2L9B A;  3GW4 A;  3VLF A;  3IHY A;  5A7D B;  5FQ4 A;  4I9C A;  4BSZ B;  2WXG A;  4LNG A;  1WAO 1;  3FEX A;  1DVP A;  3MX3 A;  3EHM A;  2ETC A;  2JEK A;  1N11 A;  1N9A A;  3L82 A;  1EYH A;  5D0O D;  1SA5 A;  3LY7 A;  4IN3 B;  2X6H A;  1MX6 A;  4GTR A;  1U2V G;  5FTP A;  3OXG A;  2UWJ G;  1N4R A;  3LPZ A;  2GRQ B;  2CHX A;  3U66 A;  4GAA A;  3ABK E;  4JXT A;  2J07 A;  3QWP A;  1ELK A;  2OCC E;  4O60 A;  2ETA A;  2ZIR A;  2XQ0 A;  3TWV A;  3Q7A A;  3T5V A;  2HYZ A;  3T8M A;  1HF8 A;  4YDY A;  2IJG X;  3FUE A;  2H6I A;  3EDT B;  1N4Q A;  2J4D A;  3CVW A;  4HOS A;  2FEZ A;  4U07 A;  1HX8 A;  3Q79 A;  4GTM A;  4CDR A;  2LSU A;  4GZ5 A;  3FU0 A;  3ASD A;  4I1M A;  2QYU A;  4FLB A;  4OYS A;  2L6J A;  4A55 A;  2V5Q C;  2BED A;  2CHZ A;  3EU5 A;  4TV3 A;  4D10 C;  2GGF A;  5C2Y A;  2RD0 A;  1JCR A;  3L16 A;  1ELR A;  3CVV A;  4WNF A;  2QY7 A;  3LVQ E;  4RG6 A;  3CHR A;  3HDX A;  4Q69 A;  3D9H A;  3HHM A;  4G24 A;  2UY1 B;  3Q5M A;  3D9K A;  4J8D A;  4DK5 A;  4IRU A;  2AJA A;  4HOU A;  3G2W A;  3TWW A;  2BF0 X;  2UY1 A;  3L6A A;  4ZFH A;  3QB2 A;  5AIJ A;  4U0Z A;  5E75 A;  1HFA A;  2J09 A;  4UI9 C;  4O1O A;  4CGV A;  3ZRH A;  3B7S A;  1TNZ A;  2F8Y A;  1E7U A;  3S7F A;  3TG5 A;  3LJ3 A;  1OCR E;  2VSY A;  1H2T C;  5BUZ A;  2PL2 A;  3PUK A;  5AN8 A;  3TAX A;  1TNY A;  1FVH A;  4KT6 B;  4UWL A;  1D9S A;  5LOZ A;  4F3V A;  3GYZ A;  3WG7 E;  1TNU A;  1JWG A;  2Y3A A;  1BU9 A;  3FP3 A;  1QNF A;  2XZT G;  4DRX E;  1HZ4 A;  4I6J A;  5D66 A;  4FHJ A;  5HRY A;  4LSZ E;  3GZS A;  1O5M A;  4HS2 A;  1TNO A;  1OCC E;  4RQI A;  3LY9 A;  3ZYQ A;  2DYR E;  3ML8 A;  1AP7 A;  2Y4T A;  1TN7 A;  3SHF A;  1UN8 A;  2LUH A;  3L9T A;  4NUR A;  2WMO A;  4OAV B;  4ME2 A;  3TWX A;  2WXK A;  5JHB A;  5BW8 C;  1FVF A;  4B94 A;  3FH8 A;  3V2O A;  4GPM A;  5EDS A;  1FCH A;  1IQU A;  4JHK A;  4GCN A;  2VTB B;  4P29 A;  1O1T A;  2H6F A;  5HI7 A;  2XEV A;  3HXE A;  3WXX A;  4LRZ A;  4I2W A;  1OCZ E;  2EIN E;  3UX4 A;  4ATG A;  3UKU G;  1QBQ A;  2F8X K;  3UPV A;  3EHQ A;  2IO3 C;  3ZN3 A;  5JJ6 A;  3N71 A;  4BY6 A;  1YYH A;  1N52 A;  4I43 A;  4FLH A;  1MX4 A;  4JVS A;  3ENE A;  4BET A;  1YA0 A;  4KVO A;  2RFM A;  4TXR A;  3CR3 A;  3CV0 A;  3LYA A;  4BX8 A;  1W3B A;  4G11 A;  4I9E A;  3FTY A;  3PDN A;  4GYW A;  2IU1 A;  3ISM C;  3J5P A;  4I1O B;  4FJY A;  4AJW A;  3TWT A;  4UQX A;  2X3M A;  5ARG A;  4W9R A;  2EIJ E;  1KT0 A;  4RLY A;  2QFC A;  3V30 A;  4XI9 A;  4GTS A;  2YNQ A;  3LVR E;  4QQI A;  2DZO A;  3DSW A;  3QOU A;  2KM4 A;  3RK6 A;  5KWD A;  5ANR A;  3CLJ A;  1H6K A;  3O48 A;  3MV2 B;  3RRU A;  5CEC B;  3OTN A;  1Z6T A;  3TWS A;  4DI4 A;  4C0M A;  3APD A;  3R9A B;  1AWC B;  1WDY A;  1E8Y A;  4JEU A;  3NBN B;  5M72 A;  3LCA A;  4LEU A;  4PUC A;  3OXL A;  5JA4 D;  2Q7F A;  4BFR A;  3LDZ A;  3IKO B;  3QAQ A;  4XKB A;  2NYJ A;  3DWL G;  1UW4 B;  2WQ7 A;  4M7C A;  1E8X A;  1KLX A;  1OWL A;  2LXM A;  4GZD A;  4J8F A;  2DCP A;  3PNT B;  1OXJ A;  3KAE A;  4I17 A;  5ANL A;  3FTW A;  5T8I A;  1S0P A;  3R7Q A;  3L22 A;  2XPZ A;  3ULE G;  3UM0 A;  2XEH A;  4HOR A;  3QAR A;  4KXK B;  3UUX A;  2YHE A;  4WUY A;  1MQS A;  4AM9 A;  4G8L A;  2I1J A;  3ESL A;  3W9F A;  4L2L A;  3NOC D;  4AOF A;  4HLE A;  3DEO A;  2WXQ A;  3MJW A;  1H0A A;  1A17 A;  2ZU6 B;  3E33 A;  4F1S A;  3PUJ A;  3D9P A;  4EZK A;  3S7J A;  1O1S A;  5KJM A;  3D9L A;  2EIL E;  1TYQ G;  2ILR A;  1MX2 A;  4B89 A;  3LY8 A;  1Z5S C;  4ILG A;  3UT8 A;  4EZL A;  3TWU A;  5JJ7 A;  2R2L A;  2XEE A;  2ZGD A;  4XZ4 A;  4AEZ C;  4CEM A;  5J90 A;  3DSS A;  1UOH A;  4CRW A;  4U8Y D;  4GTO A;  4APF A;  3FTZ A;  3VLD A;  4U8H A;  4U95 D;  3BUA A;  3L08 A;  2P9P G;  2LAH A;  1KZO A;  1HE8 A;  2HO1 A;  3B7U X;  3TXN A;  3RO2 A;  3B7B A;  3QWW A;  5FZQ A;  3MEK A;  5BV0 A;  5D2M C;  5FT9 A;  4BEP A;  4GMR A;  1PC2 A;  4YVO A;  3MKQ B;  3ASH A;  1N95 A;  1BI7 B;  3SFY A;  1U3D A;  3L54 A;  3FWV A;  2NC9 A;  4GYY A;  2AVP A;  4A63 B;  4YDO A;  2ION A;  4DUI A;  2B6C A;  2CFZ A;  1Y6I A;  4OAU C;  1MZC A;  4U0U A;  3ZUV B;  4BT8 A;  2P9S G;  4PS8 A;  2HR2 A;  4HB5 A;  2ZXW E;  5DBK A;  4O6F A;  3D9J A;  5KNH D;  2GRM A;  5BPP A;  3CHS A;  4XX5 A;  4JW1 A;  3T9K A;  4GZC A;  2IOS A;  4XE0 A;  2JAB A;  3CVY A;  4XKC A;  3ZPJ A;  3MV3 B;  4HRN A;  1OY3 D;  2WVI A;  2IEJ A;  3ULY A;  4UWG A;  2WXO A;  3UI2 A;  2XCB A;  5FQ6 A;  3DBS A;  4GZ6 A;  4AXH A;  4F6R D;  3C5R A;  4HOT A;  2GRO B;  3T5X A;  3U3W A;  1K8K G;  3Q49 B;  2VGX B;  4AY5 A;  5JJT A;  3SO8 A;  1S64 A;  4EPZ A;  4U0S A;  2VGX A;  2VYI A;  5FZS A;  3D9N A;  2R02 A;  3PEU B;  5EN5 D;  1PY1 A;  3IHV A;  2AW6 A;  2I1K A;  4FAD A;  3QWV A;  3JUI A;  2IQC A;  1ELW A;  3OXF A;  5EYL A;  5EIL A;  4GA0 A;  4NAC A;  4CGW A;  3FUH A;  2KC7 A;  3ASG A;  1KT1 A;  3MZL B;  3C3Q A;  5CEA A;  3KEA A;  1EPU A;  4R7L A;  4WND A;  4JD2 G;  4KZ0 A;  4L2Y A;  5CRV A;  3L13 A;  1OUV A;  4ILH B;  2VSO E;  5B3S E;  4JZY A;  4WNG A;  5IY5 E;  3SBS A;  5G04 J;  4I1A A;  1SVX A;  2MRI A;  1DC2 A;  3ZEF A;  3CHQ A;  5G55 A;  3FTS A;  4N39 A;  3ASO E;  3FU6 A;  1UG3 A;  3CK9 A;  1UJJ A;  3B13 A;  1X81 A;  3PZ3 A;  1ZU2 A;  4G8K A;  1S63 A;  3SQV A;  2KCV A;  4WWN A;  4TXQ A;  2AXV A;  5G05 C;  2I9C A;  3HIZ A;  1NA0 A;  4Y6C A;  2XEN A;  1HG2 A;  3V2X A;  2EQX A;  3SI5 A;  4I6G A;  1OWM A;  3ONL A;  3FTV A;  1XGW A;  3FUD A;  3PVL A;  2R59 A;  4KBQ A;  4URK A;  3PH0 C;  1TR4 A;  2MYO A;  2NXP A;  2LO6 A;  1N54 A;  3Q9N C;  3TXM A;  2VSN A;  3D9O A;  3ZYL A;  4BTB A;  2DWZ A;  3SNX A;  1UJK A;  4L23 A;  4EQF A;  5CHE E;  3CKB A;  4WNE A;  3EUV A;  3BG1 B;  4ILI A;  4J8E A;  4N3B A;  2IY0 C;  1KPS B;  3HG0 D;  4NQ0 A;  2WQ6 A;  5BT1 A;  1SQM A;  3G2V A;  4GCO A;  2OEW A;  1V54 E;  5AQ7 A;  1BD8 A;  2WXN A;  2Y0B G;  4UQZ A;  5JMN D;  1B89 A;  4XIF A;  1TN6 A;  3PZ2 A;  1GW6 A;  3AU4 A;  2DBA A;  4U04 A;  2GRR B;  4GPK A;  2C0L A;  4GTT A;  3CVX A;  3UMV A;  5AAR A;  1H6O A;  3L17 A;  1QYM A;  2LXL A;  4J8S A;  2VQ2 A;  4N2S A;  3PZ1 A;  3CQG B;  3IEG A;  2AXU A;  4LER A;  4C9B B;  4O1P A;  2PM7 A;  2Y69 E;  3RKV A;  2OOE A;  4FHK A;  5FQ7 A;  4H7X A;  4B93 B;  5FJY A;  3S2A A;  4UQY A;  3IBE A;  4DI3 A;  3MYV A;  3TL5 A;  4GTQ A;  1IHB A;  4KVM A;  4C48 B;  3J5Q B;  3TWQ A;  1VDY A;  3E37 A;  3EIJ A;  5A6C A;  2P2C P;  2VTB A;  3FFL A;  2LNI A;  4ZHB A;  5C1D A;  2PQR A;  1BI8 B;  4DX6 D;  4Y6W A;  5FWQ A;  4JA9 A;  4AY6 A;  2IO2 C;  4DX5 D;  1NI1 A;  1N0R A;  4HXI A;  2KZT B;  2XGS A;  5FIN A;  1SA4 A;  3FTU A;  3FH5 A;  1NL4 A;  4GTV A;  3VTX A;  2WM9 A;  2CG3 A;  3PZ4 A;  3MKR A;  3I3N A;  4GMJ A;  2DIW A;  1A5E A;  3CK7 A;  2KZT A;  5BXU A;  3S7B A;  3FDH A;  4C0E A;  1HU3 A;  4YND A;  4AV7 A;  2OVB A;  2BKG A;  2H6H A;  5AAO A;  3SF4 A;  2WQH A;  3NZU A;  1K1B A;  4L1B A;  3TWR A;  1INZ A;  1JCQ A;  4HBD A;  5FZR A;  5BNW A;  2ETB A;  4V3I A;  2Y1L E;  4EZJ A;  3AU5 A;  4LUN U;  2PQN A;  2KXP C;  1HXI A;  2FUL A;  4KZC A;  3U9W A;  3FUL A;  3G2T A;  4HI9 A;  3CHO A;  2WXF A;  3ASN E;  1N4S A;  1NP7 A;  5A23 A;  4NIK A;  3AG2 E;  4F7A A;  2EIK E;  3APC A;  3K9I A;  2VGY A;  4AVX A;  5ENQ D;  3CHP A;  3LEW A;  2YHC A;  2L0I A;  2P9N G;  3Q75 A;  3OAW A;  4APO A;  3DSX A;  1RW2 A;  4DJA A;  3ZYK A;  2WXJ A;  3CST A;  4N3C A;  3C98 A;  3PEV B;  4I6E A;  3JYS A;  3V31 A;  2KAT A;  2R05 A;  1LD8 A;  1HO8 A;  3FUM A;  4TUU A;  2RG8 A;  4PS3 A;  5AYW D;  1WY6 A;  3F6Q A;  4WAF A;  3QC1 A;  3NF1 A;  5BXO A;  4FJZ A;  1D8D A;  4M3O A;  4CT4 A;  2WXI A;  1Q2Z A;  3AG4 E;  3Q78 A;  5AQ9 A;  4DX2 A;  5CCM A;  3ZIM A;  3DXK G;  3TG4 A;  3ZNG A;  4HVB A;  4AP2 A;  2LSV A;  5FIO A;  3SZ7 A;  1KZP A;  2RKK A;  3CVN A;  5CBO A;  4N2Q A;  5AJD A;  1ZB1 A;  4TXP A;  2XPY A;  4YDW A;  3Q47 B;  4LG6 A;  3P2B A;  4G1T A;  1JWF A;  5BV1 A;  3E30 A;  4OVU A;  4U8V D;  5AEN A;  3SFZ A;  3SD5 A;  4E6H A;  4E85 A;  5ENR D;  2J4B A;  2ZIS A;  2IF4 A;  3CKC A;  3I5P A;  2GRP B;  4GA1 A;  5LX8 A;  3KSQ A;  3HXD A;  3JQ1 A;  4RSY A;  3O4Z A;  3ZVV A;  2XZD G;  1P5Q A;  2R5S A;  1EF1 C;  5AQA A;  3RIB A;  2FI7 A;  1TNB A;  1Y8M A;  2A5U A;  3RJV A;  3NOG D;  3UT7 A;  5ENS D;  3RSE G;  5JHA A;  4HNA D;  2WXH A;  3FUI A;  2WXM A;  5KNG A;  3LXU X;  5H7P A;  3QJZ A;  4GB9 A;  5AQB A;  3R9M A;  4N5C A;  2I2O A;  3Q9U C;  4Q96 A;  5CER B;  3MKQ A;  4I2Z A;  3V79 K;  4AIF A;  1YCS B;  2A4Z A;  4ABN A;  1UN9 A;  4GYO A;  3Q4A B;  4JC8 A;  4UI9 J;  3B7R L;  4KMO A;  3CIA A;  4A3V A;  1QZ2 A;  5E76 A;  1LTX A;  2KCL A;  4DLQ A;  3PNL B;  2GRN B;  1JPL A;  3DPD A;  4K03 A;  3DSV A;  4HRL A;  2XS1 A;  4B8C B;  2FF4 A;  3KSL A;  2C2L A;  4G25 A;  3KEZ A;  4HQD A;  4Q94 A;  3ESK A;  1N94 A;  4GA2 A;  2E2E A;  1H2U A;  5ENO D;  3CVU A;  3U4T A;  1NA3 A;  3UM1 A;  3CSF A;  2KBX A;  4L7T A;  3X2Q E;  2PZI A;  3VTY A;  4A1S A;  1IYG A;  4WWO A;  1MYO A;  4Z68 A;  3R7R A;  3EHN A;  4MLP A;  3TGO A;  4FUL A;  1TEZ A;  2FO7 A;  3RU0 A;  2XCC A;  1IQR A;  4GU5 A;  3G2U A;  3FU5 A;  2FO1 E;  1NFI E;  5KJN A;  3EIQ C;  4NRH B;  4A3T A;  2CHW A;  1NZN A;  4FP7 A;  3ABM E;  3UTM A;  4F1P A;  2WB2 A;  1MJ0 A;  3JUE A;  3G2S A;  1FT1 A;  4U96 D;  3RAU A;  4K5C A;  3ABL E;  1SW6 A;  3QDN A;  4U63 A;  4H7Y A;  2EIM E;  3DST A;  1HG5 A;  5HQ8 A;  4G23 A;  1BPO A;  3ONK A;  2OVF A;  1MHQ A;  3NAW A;  3SGH A;  4J0U A;  4LCT A;  2DVW A;  4IUL A;  3URZ A;  3BG0 B;  3SBT B;  2CG2 A;  3VLE A;  4CDN A;  4G26 A;  3AS5 A;  3ZFW A;  3E34 A;  4N5Q A;  4PH4 B;  4UI9 K;  5HKP A;  1O1R A;  3UQ3 A;  5ITZ F;  3CK8 A;  1K3Z D;  4IYP A;  2QZA A;  3ZGQ A;  3B7T A;  4JL0 A;  4YDE A;  3Q7F A;  4BSX A;  1QQE A;  3DPY A;  5EX0 A;  3RRM B;  4U7E B;  3DRA A;  5ENT D;  1LD7 A;  1U3C A;  4TRQ A;  1WG0 A;  2FBN A;  1IKN D;  4BER A;  5CED B;  1Z3X A;  3CHM A;  4OVV A;  3C3O A;  2P58 C;  1OT8 A;  2E0I A;  3FUF A;  3E4B A;  1H6P A;  2L0T B;  2WXL A;  5ENP D;  4DLO A;  2WXP A;  3PZD A;  3JQ0 A;  1G3N B;  1ZBP A;  5DIZ A;  2BTD A;  4MKT A;  2J08 A;  3MCX A;  4YVQ C;  3QNK A;  2V4H C;  4PDX A;  5CBN A;  2QC9 A;  4EHM A;  5AJL A;  4B0Z A;  3AG1 E;  2C0M A;  3HXF A;  3I4R B;  3HXB A;  2YQ8 A;  3C3R A;  4CT0 A;  5LCW J;  3FUJ A;  3FU3 A;  2X6I A;  2X38 A;  2L6B A;  1TN8 A;  3GZ2 A;  4BWR A;  4HLL A;  2OEV A;  2QYJ A;  4L9P A;  3ZHE B;  3CEQ A;  5LP0 A;  3NQP A;  3RRN B;  3BEE A;  3UIP C;  4UWK A;  1RZ4 A;  4EBA G;  3E32 A;  1XNF A;  1OCO E;  3ZHE A;  4GZ3 A;  4XI0 A;  3AS4 A;  2H6G A;  4JPS A;  4QFV A;  3CGH A;  2XS8 A;  2JLB A; 
#chains in the Genus database with same CATH homology
 5ARF A;  3ZXS A;  3QWW A;  5FZQ A;  4CDR A;  4EBA A;  2LSU A;  3MEK A;  4GZ5 A;  5BV0 A;  5FT9 A;  3ZYM A;  1PC2 A;  3FU0 A;  3ASD A;  3PE3 A;  3CVL A;  4I1M A;  4YVO A;  1PAQ A;  4F7A A;  4JHR A;  3APC A;  3K9I A;  4FLB A;  2VGY A;  4OYS A;  4AVX A;  2L6J A;  3CHP A;  3MKQ B;  1E96 B;  4A55 A;  3LEW A;  3JCK C;  4EEC A;  2YHC A;  2L0I A;  3ASH A;  2OV8 A;  2CHZ A;  3OAW A;  4APO A;  3RO2 A;  1U3D A;  3L54 A;  3FWV A;  2NC9 A;  3MA5 A;  4TV3 A;  4D10 C;  2GGF A;  2AVP A;  1OWN A;  4GYY A;  3FUK A;  2WXJ A;  3ZYK A;  4DJA A;  3CST A;  2ION A;  3ASF A;  5C2Y A;  4N3C A;  3C98 A;  2RD0 A;  3L16 A;  1ELR A;  3CVP A;  2CFZ A;  3PEV B;  1Y6I A;  2XGM A;  4I6E A;  3QK0 A;  4WNF A;  3CVV A;  3JYS A;  2QY7 A;  3LVQ E;  4RG6 A;  2KAT A;  3CHR A;  2WXR A;  3HDX A;  4BT8 A;  4U0U A;  1HO8 A;  2V4L A;  1HS6 A;  3FUM A;  4DPR A;  4TUU A;  4PS8 A;  2HR2 A;  2RG8 A;  4PS3 A;  4Q69 A;  5AYW D;  1WY6 A;  4WAF A;  5DBK A;  3QC1 A;  4O6F A;  3D3M A;  3HHM A;  3MGB A;  4G24 A;  4F53 A;  1DNP A;  2UY1 B;  3Q5M A;  3NF1 A;  3D9K A;  3D9J A;  4FJZ A;  4J8D A;  5G04 C;  4DK5 A;  3PS6 A;  4IRU A;  2GRM A;  5BPP A;  1LF8 A;  3CHS A;  4XX5 A;  4JW1 A;  4HOU A;  4M3O A;  4CT4 A;  3G2W A;  3P1U A;  2WXI A;  4GZC A;  5ENN A;  2IOS A;  4XE0 A;  2BF0 X;  2XPI A;  3CVY A;  4XKC A;  2UY1 A;  3ZPJ A;  3MV3 B;  3L6A A;  3QB2 A;  5CCM A;  5AIJ A;  4U0Z A;  2WVI A;  3ZIM A;  5E75 A;  3HVE B;  4HVB A;  1HFA A;  1SZA A;  2J09 A;  1OWP A;  4JEH A;  3TG4 A;  4UWG A;  4AP2 A;  3I4G A;  4UI9 C;  2LSV A;  3SZ7 A;  3D9I A;  4CGV A;  3ZRH A;  3B7S A;  2WXO A;  3CVN A;  2LAI A;  5KCM A;  2XCB A;  5FQ6 A;  3DBS A;  4GZ6 A;  4AXH A;  4HOT A;  3HVE A;  4N2Q A;  3PRE A;  5AJD A;  4BX9 A;  2AXZ A;  1E7U A;  3FUN A;  3T5X A;  5KJL A;  2XPY A;  3S7F A;  3U3W A;  3Q49 B;  2VGX B;  3TG5 A;  3Q47 B;  3RO3 A;  4KYO B;  2MOW A;  3P2B A;  4G1T A;  3LJ3 A;  1JWF A;  5BV1 A;  4AY5 A;  1E7V A;  5JJT A;  2IOL A;  2HM8 A;  4OVU A;  4EPZ A;  2VSY A;  4ANX A;  4U0S A;  2VGX A;  5AEN A;  3SFZ A;  1H2T C;  3SD5 A;  4ANV A;  4E6H A;  2VYI A;  4JHJ A;  5FZS A;  4E85 A;  5BUZ A;  3KS2 A;  3D9N A;  2J4B A;  2GW1 A;  2PL2 A;  3PUK A;  3PEU B;  2IF4 A;  3CKC A;  5G2N A;  3TAX A;  1FVH A;  1PY1 A;  3IHV A;  4KT6 B;  2AW6 A;  2I1K A;  3I5P A;  4GA1 A;  4FAD A;  4HOQ A;  4UWL A;  5LX8 A;  3QWV A;  3JUI A;  4MRU A;  3JQ1 A;  4FC8 A;  5LOZ A;  2AWI A;  4F3V A;  4RSY A;  3O4Z A;  3ZVV A;  3GYZ A;  2M63 A;  2IQC A;  2XRZ A;  1ELW A;  1P5Q A;  1EF1 C;  2R5S A;  2KCK A;  1JWG A;  3OXF A;  2Y3A A;  4GA0 A;  4NAC A;  3RIB A;  3FP3 A;  4CGW A;  1QNF A;  2FI7 A;  1HZ4 A;  3FUH A;  1Y8M A;  1H2V C;  4I6J A;  2KC7 A;  2IFU A;  3ASG A;  4JA7 A;  4RVB A;  1KT1 A;  2J49 A;  3MZL B;  2A5U A;  3RJV A;  4ACK A;  3UT7 A;  4FHJ A;  1E8W A;  1EPU A;  4R7L A;  4WND A;  3GZS A;  4HS2 A;  4KZ0 A;  4L2Y A;  5JHA A;  2BUG A;  3L13 A;  3LY9 A;  3ZYQ A;  1OUV A;  2WXH A;  3FUI A;  4ILH B;  4A1G A;  2VSO E;  2Y4U A;  2WXM A;  4JZY A;  3ML8 A;  5KJK A;  4WNG A;  3LXU X;  3SBS A;  4ANU A;  5G04 J;  2Y4T A;  3QJZ A;  3SHF A;  5LCW C;  4GB9 A;  4I1A A;  1UN8 A;  4N5C A;  2I2O A;  4NUR A;  2WMO A;  4Q96 A;  2MRI A;  3ZEF A;  3MKQ A;  4I2Z A;  4ME2 A;  4AIF A;  2A4Z A;  3CHQ A;  2WXK A;  5G55 A;  5JHB A;  3FTS A;  1FVF A;  5BW8 C;  4ABN A;  4N39 A;  1JUQ A;  3FU6 A;  1UN9 A;  1WM5 A;  1UG3 A;  3CK9 A;  4GYO A;  3Q4A B;  3QKY A;  3FTX A;  3Q15 A;  4JC8 A;  3KD7 A;  4B94 A;  3FH8 A;  4CDM A;  1UJJ A;  4UI9 J;  3B7R L;  4ANW A;  3B13 A;  1L5J A;  4KMO A;  3CIA A;  2XGO A;  4A3V A;  5EDS A;  1ZU2 A;  3AS8 A;  3ML9 A;  1FCH A;  1QZ2 A;  5E76 A;  2KCL A;  1TJC A;  2VJ8 A;  2V5F A;  3PNL B;  1IQU A;  4JHK A;  4MS6 A;  4DLQ A;  4GCN A;  1JPL A;  2VTB B;  3DPD A;  4P29 A;  3U64 A;  3APF A;  2KCV A;  1HH8 A;  2V8S E;  4WWN A;  2AXV A;  4K03 A;  5EKQ D;  5CCL A;  5G05 C;  1Z3Y A;  4B8C B;  2I9C A;  3LS8 A;  3HIZ A;  5FQ8 A;  1NA0 A;  4Y6C A;  2FF4 A;  3EJN A;  4K0R A;  2XHE A;  5HI7 A;  4GML A;  2C2L A;  1HG2 A;  2XEV A;  1E8Z A;  4G25 A;  3WXX A;  3KEZ A;  2EQX A;  4LRZ A;  2VSX E;  4I2W A;  3SI5 A;  4I6G A;  1OWM A;  4Q94 A;  2XRY A;  3ESK A;  4HFG A;  3UT4 A;  2V0P A;  3UX4 A;  3PE4 A;  3ONL A;  3FTV A;  1XGW A;  3FUD A;  3PVL A;  4GA2 A;  2R59 A;  4ATG A;  4KBQ A;  2E2E A;  1H2U A;  5D0Q D;  3CVU A;  2NSZ A;  1SZ9 A;  4URK A;  3U4T A;  3CQC B;  1NA3 A;  3CSF A;  3PH0 C;  4N3A A;  4L7T A;  3UPV A;  3FH7 A;  4FU3 A;  2OND A;  2NXP A;  2PZI A;  4CCA A;  2LO6 A;  3VTY A;  4A1S A;  1IYG A;  1N54 A;  4WWO A;  3ZN3 A;  5JJ6 A;  3EHN A;  3R7R A;  4MLP A;  3TXM A;  2VSN A;  3TGO A;  3N71 A;  4BY6 A;  4FUL A;  3D9O A;  1N52 A;  4I43 A;  1TEZ A;  3ZYL A;  4BTB A;  4FLH A;  2FO7 A;  3FEY A;  2CFU A;  4JVS A;  3ENE A;  3RU0 A;  1YA0 A;  2XCC A;  4KVO A;  3SNX A;  4UWH A;  1IQR A;  4GU5 A;  1UJK A;  3CR3 A;  3G2U A;  3FU5 A;  3CV0 A;  3LYA A;  1OWO A;  2PM6 A;  5CMY A;  4BX8 A;  1W3B A;  4G11 A;  4L23 A;  4I9E A;  3FTY A;  4EQF A;  3PDN A;  4GYW A;  5KJN A;  3EIQ C;  4NRH B;  2IU1 A;  4I1O B;  4A3T A;  2CHW A;  5CHE E;  4FJY A;  3CKB A;  4G2V A;  4AJW A;  4WNE A;  4UQX A;  1NZN A;  2X3M A;  4FP7 A;  3BG1 B;  4ILI A;  2WB2 A;  4J8E A;  3NZS A;  4N3B A;  5ARG A;  3G2S A;  4W9R A;  1KT0 A;  4RG9 A;  2QFC A;  3LKU A;  1EDU A;  3QDN A;  4NQ0 A;  4XI9 A;  2WQ6 A;  2YNQ A;  3LVR E;  5BT1 A;  1SQM A;  3G2V A;  4U63 A;  4H7Y A;  4GCO A;  3TJP A;  2WXN A;  3QOU A;  2KM4 A;  4UQZ A;  3RK6 A;  1B89 A;  1HG5 A;  4XIF A;  5HQ8 A;  5ANR A;  3CLJ A;  1GW6 A;  3AU4 A;  1BPO A;  2DBA A;  2WPV A;  1H6K A;  4G23 A;  4U04 A;  3O48 A;  3MV2 B;  3ONK A;  4GPK A;  2OVF A;  3RRU A;  3FY4 A;  3OTN A;  1MHQ A;  2C0L A;  1IHG A;  1Z6T A;  4DI4 A;  3CVX A;  3SGH A;  4C0M A;  3UMV A;  4J0U A;  3APD A;  4LCT A;  4IUL A;  3L17 A;  3R9A B;  3URZ A;  2X6K A;  1E8Y A;  1E90 A;  3PRZ A;  4UWF A;  4J8S A;  4JEU A;  5M72 A;  4J6I A;  2VQ2 A;  3BG0 B;  4N2S A;  3LCA A;  3CQG B;  4LEU A;  4PUC A;  3IEG A;  5G05 J;  2AXU A;  2CG2 A;  3SBT B;  3VLE A;  3OXL A;  4CDN A;  1H19 A;  2I6H A;  4LER A;  5EX3 A;  4C9B B;  2Q7F A;  4BFR A;  5J08 A;  3LDZ A;  4G26 A;  5T3R A;  3AS5 A;  3IKO B;  2PM7 A;  3D9M A;  3QAQ A;  3ZFW A;  4XKB A;  3RKV A;  3HYM B;  3ZW3 A;  2OOE A;  4FHK A;  5FQ7 A;  4H7X A;  5LFA A;  1UW4 B;  4PH4 B;  4UI9 K;  5FJY A;  3UQ3 A;  4WWP A;  1E8X A;  3S2A A;  2WQ7 A;  2GRL A;  1KLX A;  4UQY A;  1OWL A;  4B8A A;  3CK8 A;  3IBE A;  3S7D A;  4GZD A;  4J8F A;  2DCP A;  4IYP A;  3PNT B;  4DI3 A;  3MYV A;  3TL5 A;  3ZGQ A;  3B7T A;  4JL0 A;  3KAE A;  3FHE A;  4I17 A;  4KVM A;  5ANL A;  4BTA A;  3FTW A;  4BSX A;  5T8I A;  3CVQ A;  1QQE A;  1S0P A;  5EX0 A;  2X6F A;  3IV0 A;  3RRM B;  1VDY A;  2J9Q A;  3R7Q A;  3EIJ A;  3L22 A;  2XPZ A;  5A6C A;  1U3C A;  2X6J A;  4TRQ A;  5T4Y A;  2VTB A;  3FFL A;  2LNI A;  2FBN A;  5C1D A;  2PQR A;  4BT9 A;  4HOR A;  3QAR A;  4KXK B;  3UUX A;  1Z3X A;  2MHK A;  2YHE A;  5CMW A;  3CHM A;  4OVV A;  2P58 C;  4WUY A;  4Y6W A;  2E0I A;  5FWQ A;  4FA6 A;  1MQS A;  4JA9 A;  1TJF A;  1X5B A;  3ULQ A;  4AY6 A;  3FUF A;  4AM9 A;  3E4B A;  2I1J A;  3GZ1 A;  3ESL A;  4PS7 A;  4L2L A;  4ACL A;  4AOF A;  2L0T B;  2YIN A;  2WXL A;  2R17 C;  4DLO A;  4HXI A;  2WMN A;  2WXP A;  2KZT B;  4HLE A;  2XGS A;  2L9B A;  3FTU A;  3PZD A;  3FH5 A;  3GW4 A;  3VLF A;  3VTX A;  3IHY A;  3JQ0 A;  5A7D B;  2WM9 A;  1ZBP A;  5FQ4 A;  2CG3 A;  4I9C A;  5DIZ A;  2BTD A;  2WXG A;  3MKR A;  3I3N A;  4GMJ A;  4MKT A;  2DIW A;  2WXQ A;  2J08 A;  3MCX A;  4YVQ C;  3CK7 A;  2KZT A;  1WAO 1;  3MJW A;  3FEX A;  3QNK A;  4PDX A;  1DVP A;  3MX3 A;  3EHM A;  1H0A A;  3S7B A;  2JEK A;  1A17 A;  3FDH A;  4C0E A;  2ZU6 B;  5AJL A;  4B0Z A;  3PUJ A;  4F1S A;  2C0M A;  1EYH A;  5D0O D;  3I4R B;  3D9P A;  1HU3 A;  4YND A;  4EZK A;  4AV7 A;  2YQ8 A;  3LY7 A;  3S7J A;  2OVB A;  4IN3 B;  2X6H A;  5KJM A;  3D9L A;  5FTP A;  3OXG A;  2UWJ G;  3SF4 A;  2WQH A;  3NZU A;  4CT0 A;  5LCW J;  2ILR A;  3FUJ A;  3LPZ A;  2CHX A;  3FU3 A;  3U66 A;  4L1B A;  4GAA A;  1INZ A;  2X6I A;  2X38 A;  4B89 A;  3LY8 A;  3GZ2 A;  4ILG A;  3UT8 A;  4EZL A;  4BWR A;  4JXT A;  5FZR A;  5BNW A;  2J07 A;  3QWP A;  1ELK A;  5JJ7 A;  4AEZ C;  5J90 A;  4XZ4 A;  3ZHE B;  4CEM A;  4V3I A;  4EZJ A;  4CRW A;  2XQ0 A;  3AU5 A;  3CEQ A;  4LUN U;  5LP0 A;  3T5V A;  2HYZ A;  3T8M A;  3NQP A;  3RRN B;  2PQN A;  4APF A;  1HF8 A;  3FTZ A;  2IJG X;  3VLD A;  3BEE A;  1HXI A;  2FUL A;  4KZC A;  4U8H A;  3U9W A;  3FUL A;  3FUE A;  4UWK A;  4EBA G;  3G2T A;  3EDT B;  3L08 A;  1XNF A;  2J4D A;  2LAH A;  3CHO A;  3ZHE A;  4GZ3 A;  4XI0 A;  3CVW A;  2WXF A;  4HOS A;  2FEZ A;  3AS4 A;  4U07 A;  1HE8 A;  2HO1 A;  1HX8 A;  3B7U X;  3TXN A;  4JPS A;  4QFV A;  1NP7 A;  5A23 A;  3CGH A;  2JLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...