3EUVA

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10, w102t, y154t) in complex with biotingpp
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
total genus 132
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3euvA00
3DSVA 4GTSA 1N95A 3EUVA 1N4QA 3E30A 3E34A 1O5MA 1TNUA 1JCRA 1NI1A 1TNYA 1DCEA 3C72A 3PZ1A 3DRAA 1TNOA 1TN8A 1KZOA 1N4SA 1N4PA 1KZPA 3KSLA 3DSTA 4GTTA 2H6IA 1N9AA 3Q7AA 3KSQA 1O1TA 4LNGA 3HXCA 2H6HA 4GTPA 2ZIRA 3Q78A 3DSWA 1S64A 1D8EA 3PZ4A 2ZISA 1X81A 1LTXA 2H6GA 4MBGA 3DSXA 1D8DA 3HXEA 3HXBA 3E32A 1FT2A 3Q75A 3DSUA 3Q79A 4L9PA 2H6FA 4YDEA 2BEDA 3SFXA 4EHMA 1O1RA 1TN6A 3DPYA 1TN7A 4YDOA 4LNBA 1JCQA 3PZ2A 3PZ3A 2F0YA 3HXDA 1N4RA 1LD7A 1LD8A 4GTQA 1S63A 1NL4A 1SA4A 3HXFA 1QBQA 1MZCA 1FPPA 3E37A 2IEJA 4GTVA 3Q73A 1TNZA 2R2LA 3Q7FA 1JCSA 3SFYA 3E33A 1SA5A 1O1SA 3DSSA 4GTMA 3EU5A 1N94A 4GTRA 4GTOA 1TNBA 1FT1A
chains in the Genus database with same CATH superfamily
1Q2ZA 4JVSA 4GTSA 2XHEA 2CG3A 4J8DA 1N4QA 3MV2B 3QAQA 1WM5A 2WXNA 4HNAD 1SW6A 3CVWA 3IXEA 1K1BA 2GGFA 4GTTA 1N9AA 3GZSA 1Z5SC 1N54A 4WNEA 4TXPA 2ZIRA 5CEDB 3ZGQA 5KNHD 4ANVA 3UKRG 2VSXE 1A5EA 3DSXA 4KVOA 3JXIA 2JABA 2KM4A 5HI7A 3P1UA 3BU8A 5FZSA 2QYUA 4CT4A 3C3RA 5E75A 3NB2A 5JJ6A 3UT4A 4HI9A 2F0YA 2MHKA 5DIZA 2DIWA 5CEAA 4DX7D 1E8YA 3CQGB 5LFAA 4RLYA 3Q73A 4A1SA 2RG8A 5M72A 3MCXA 3FUEA 4JEHA 4E85A 2MRIA 4FLHA 4I1AA 1FT1A 3J5QB 2P9SG 4LEUA 3DSVA 3T5VA 1QYMA 3PS6A 1RW2A 2WQ7A 2ETAA 2LO6A 3LDZA 2V4HC 3DRAA 4LRZA 2GRRB 3DPDA 2IFUA 3Q4AB 2PQNA 4MKTA 2BKGA 5EN5D 3R9AB 2Q7FA 2EIJE 5B1AE 1H2TC 1S70B 2HR2A 4I6EA 3MX3A 4U0ZA 2FO7A 3PZ4A 2GRNB 3MZLB 3EIJA 3AJIA 3PNTB 3JYSA 2X6FA 2XCBA 3V30A 1XNFA 3CIAA 1FCHA 2AXZA 3NQPA 5LCWC 4UWLA 3D9IA 2GROB 4HLEA 3IV0A 3RO3A 2KXPC 2WXHA 4G25A 3ZRHA 2FBNA 4WAFA 3L9TA 2KBXA 3SNXA 3URZA 3EDTB 2BTDA 3GZ2A 3ZHEB 3S7JA 5FQ6A 3B95A 3CKBA 1UOHA 4UWGA 3DSSA 3B7RL 1U3DA 3CVYA 2UY1A 1NP7A 2LSVA 2FI7A 1UW4B 2WXFA 5ENOD 3D9NA 2LUHA 4ACLA 3ZYMA 5LCWJ 2CFZA 1N0RA 3QC1A 4XIFA 3SBTB 3HYMB 4G11A 2R03A 4KYOB 2P9PG 2J9QA 3KSQA 4UWFA 1KT0A 2LAIA 1O1TA 3MJWA 4MRUA 3AAAC 3APFA 3CLJA 2WXLA 1D8EA 3PNLB 4I1MA 3X2QE 4B0ZA 3HVEA 3FU6A 4JHJA 4LERA 3I3NA 3QJZA 2OCCE 2KC7A 4F6RD 5EX0A 3SO8A 2KZTB 3GW4A 4I6JA 1HS6A 2EILE 2KCKA 1N4RA 3LS8A 4HQDA 3PEVB 3D9JA 3SQVA 3OAWA 3MGBA 3QK0A 2WVIA 1YA0A 4HXIA 2R2LA 4FU3A 4PDXA 3RAUA 4AXHA 4GZ3A 2LXMA 4G8KA 4GA2A 4IRUA 1MX6A 4UI9C 3FU5A 2P9KG 2XRYA 3RKVA 3HHMA 2A5UA 2KCVA 2I6HA 2OV8A 4UQXA 3SBSA 3ZNGA 5CCMA 4FULA 4RG6A 4XE0A 5BPPA 5AQBA 4NIKA 4Y6CA 2F8XK 4F1PA 1ZB1A 3LVQE 4BFRA 5BV0A 1A17A 2IY0C 2Y69E 4GCNA 3ASFA 3EU9A 3QDNA 2BKKB 2DYRE 4AY6A 3JUIA 4GPKA 4I2WA 3FUMA 4KZ0A 3ENEA 2VGEA 3L13A 3D9PA 2R5SA 4FP7A 3MEKA 3FTSA 1FT2A 2P9IG 4K5CA 3PUKA 3RRNB 4CDMA 4MS6A 3P2BA 3FEYA 3BG1B 4I43A 1MJ0A 3KD7A 4MLPA 1OWLA 3IKOB 4U07A 2X6HA 4DI4A 3D9LA 3B13A 2R59A 1SA4A 1VDYA 4BX8A 2WXPA 3I4GA 3JQ1A 3LJNA 4WWOA 5CMWA 4EQFA 2FULA 2IEJA 3J5PA 2XPZA 5BUZA 2QYJA 1HU3A 5IY5E 3ASGA 3U4TA 4AY5A 4GTRA 3D3MA 2FEZA 3CHMA 3EHNA 2XPYA 3G2WA 1N11A 1H6KA 3ZFWA 2CHZA 4PH4B 1NZNA 4TV3A 1DCEA 3JUEA 4FHJA 3ASNE 1IYGA 3FUNA 2E2EA 2P58C 4DX2A 4ZFHA 3NBNB 2XEHA 4U0SA 3LYAA 1E8XA 2OEVA 3O48A 2R02A 3G2SA 4G2VA 4EBAG 3TWQA 2H6GA 2CHWA 1PC2A 2L6BA 4AOFA 3DBSA 1MYOA 2IOSA 5AIJA 5D66A 4JL0A 1TJCA 2P9NG 4U8YD 1DVPA 4JC8A 1G3NB 2AXUA 4U04A 2J4DA 4HRMB 4QFVA 3SFXA 4EHMA 1TN7A 4TUMA 2L6JA 3CR3A 3ULQA 3V79K 1HX8A 1LD8A 1XGWA 3ESKA 3HXFA 2WQ6A 3CEQA 1BPOA 4I1OB 4DX1A 3SD5A 3AS8A 2LNIA 2IOLA 3AG3E 2CFUA 2XENA 4BTBA 3IBEA 1TNZA 1YMPA 4X8QA 2AW6A 2DZNA 5G05J 2X6IA 4GPMA 5CRVA 3UM1A 1KLXA 2UWJG 4NURA 4XI0A 3FH8A 4U8VD 4BSXA 3CVNA 4LSZE 1AP7A 2WXMA 2Y4UA 2XS1A 4GCOA 4A3TA 3LXUX 4JZYA 3UTMA 1JPLA 3TWUA 5BT1A 2H6HA 3G2TA 3FU3A 4AV7A 2VSNA 3LKUA 3RRMB 5ENPD 4FA6A 4OVUA 3ZUVB 5CRUA 5CHEE 4U95D 3UM2A 4ANUA 2WXIA 3UT7A 2IO2C 5CECB 3SF4A 4RG9A 5CBNA 4TXRA 3IHVA 2MOWA 4HFGA 5ANLA 4GZDA 3DEOA 2C0MA 4J8YA 3PH0C 1NA0A 5ANRA 5HRYA 4UI9K 3TJPA 2C0LA 2XQ0A 3ESLA 3VTYA 4HBDA 4HRLA 5LX8A 4GTVA 1WDYA 4DK5A 3D9MA 3UI2A 1BI7B 3UUXA 5E76A 4TRQA 3MKQA 1KPSB 4K0RA 3EIQC 2NSZA 4KBQA 4GTOA 1TNBA 4EZLA 5JA4D 1BD8A 4AP2A 3TAXA 4ILGA 4KXKB 4DUIA 3SZ7A 3UIPC 2ZGDA 4N3AA 4GYWA 4XKBA 5HS0A 2H6IA 3Q7AA 1OCZE 4Q94A 5HKPA 2Y4TA 2WXJA 4GTPA 5EX3A 3APDA 4N3CA 3B7UX 3D9HA 2DBAA 3KEAA 2P2CP 4HVBA 4MBGA 1D8DA 3APCA 3E32A 5B1BE 2LAHA 2Y1LE 3Q79A 4L9PA 1K3ZD 4PS3A 5CMYA 3CK7A 1UN8A 2Y0BG 3LJ3A 2BUGA 5KBAA 1FVFA 4V3IA 4GMLA 2ETCA 4L2YA 1EF1C 1Z3YA 3PVLA 3LY7A 2NXPA 4DRXE 4JW1A 3UKUG 5A7DB 2XPIA 3SHFA 3VLDA 4Y6WA 2CHXA 1BU9A 4G24A 3K9IA 3ZN3A 1U2VG 3R7QA 3TWSA 4UQYA 2XGMA 2R17C 1IQRA 4CDNA 4AVXA 1TJFA 4L1BA 5JHAA 3EUVA 3FULA 4C0MA 3RK6A 3AS5A 1E96B 1TNYA 1MX2A 5FQ7A 3PZ1A 4A63B 4XI9A 2FO1E 1N4SA 5FIOA 4JHKA 3Q9NC 1YYHA 5FZRA 3FTVA 4BT9A 2ZGGA 3HXCA 1OXJA 1HXIA 3FTXA 3ASHA 1Z6TA 3DSWA 4PS8A 4WWNA 5T8IA 1LTXA 4JEUA 3WG7E 3O4ZA 4XX5A 1SZAA 1DNPA 2J09A 5EYPF 3FDHA 2RD0A 3JCKC 4HS2A 4H7YA 3PREA 4RQIA 4GZCA 3LVRE 2H6FA 2B6CA 1ELWA 4YNDA 2DCPA 3KS2A 2XRZA 3NOGD 2WXGA 3FP3A 3PZ3A 2WXOA 3ZVVA 3OXFA 4BETA 3PE4A 4GTQA 2V5FA 5D0OD 2KATA 4U7EB 2Y3AA 4LNUD 1RZ4A 4CEMA 3RO2A 5FQ8A 3MKQB 3BEEA 4BY6A 1OCOE 4TUUA 3SY2A 3LY8A 3ASOE 3FUIA 3L54A 3F6QA 3DEPA 4JHRA 4D10C 4FLBA 4A1GA 2AJAA 1INZA 4HRNA 3ZYQA 3Q49B 4APFA 5H7PA 3FUKA 3ONKA 3RU0A 2RFMA 5AAOA 3U64A 2PNNA 3PRZA 3QWVA 4CZ2D 4HLLA 4U0UA 3FUHA 3B7BA 3QARA 4HORA 2YHCA 2AXVA 1IHBA 1EDUA 2ONDA 3TXNA 2XEEA 1N4PA 4JXTA 4Q69A 2C2LA 1P5QA 1K1AA 5KCMA 2AWIA 3FWVA 2PZIA 2VTBA 3OXGA 2XEVA 3HIZA 2DWZA 3LPZA 3CVQA 2RFAA 4IN3B 2VJ8A 1SVXA 3LEWA 3ZXSA 2YQ8A 2VGYA 5FJYA 1BI8B 4WNGA 5EILA 4OVVA 4G1TA 3ABLE 3ONLA 3DSUA 4N39A 4NACA 2WB2A 2BEDA 2YHEA 1O1RA 5ITZF 5J90A 4LNBA 3TG4A 3BG0B 2XS8A 5BV1A 1KT1A 5AJDA 5EYLA 2JEKA 3CVLA 4UI9J 2V5QC 3MV3B 1JWFA 3L08A 2J08A 4I6GA 1ZBPA 3S7BA 1SA5A 3LY9A 4CGWA 3TWVA 4A3VA 4GTMA 4FADA 3ZXPA 4YDWA 3L6AA 1NFIE 5DBKA 2IF4A 3C3QA 4R7LA 4L2LA 4KVMA 3ZKJA 4J8FA 4B8AA 2UY1B 3FFLA 4XZ4A 3VTXA 2WXKA 2NYJA 3ML9A 3MYVA 2I2OA 3KSLA 3CGHA 2QFCA 3FTYA 1HG5A 1E8WA 5CCLA 4LNGA 1WG0A 4CT0A 2OOEA 2VGXA 3S7DA 3L82A 1ELKA 5FWQA 2EQXA 4BEPA 4J0UA 3HXEA 2QC9A 3HXBA 2PL2A 3QKYA 4OAUC 3CHOA 3TGOA 4J6IA 3TWTA 2EIME 3NOCD 4ABNA 5C1DA 2FF4A 5G04C 5BXOA 3HVEB 1HF8A 1IKND 3MKRA 4O1OA 5JJ7A 2A4ZA 2GRLA 4GYYA 4FHKA 3C5RA 1ZU2A 1E7VA 4B94A 4EECA 1TYQG 4W9RA 1MZCA 4CDRA 3E37A 5ENSD 5AQ9A 2A5EA 5FZQA 3DWLG 3RIBA 3T8KA 4HI8A 3S7FA 3N71A 4BT8A 2WMNA 1IXVA 4URKA 4N2QA 3TWRA 1S0PA 5JJTA 1JUQA 5JMND 3QWWA 5AYWD 1O5MA 4BX9A 1PAQA 5FT9A 2HO1A 3ULEG 2HYZA 3DXKG 5J08A 4GA1A 5G04J 4JD2G 3ZEFA 3C98A 1OWOA 3HRAA 1H19A 1YCSB 5AN8A 5EIBE 3W9FA 2X6KA 4N5CA 3CK8A 2QY7A 5G2NA 5ENTD 1HE8A 1H6OA 4KMOA 4L23A 3B7SA 4P29A 4ME2A 4C0EA 3EHRA 1N52A 1HG2A 2ZISA 2I1KA 1MX4A 3B7TA 4I2ZA 4N2SA 2IQCA 4GAAA 3CVPA 1Y6IA 3D9OA 1HFAA 3UM0A 2X38A 3ZHEA 2IU1A 3ZPJA 1JCQA 3QB2A 1X5BA 4RVBA 4XKCA 1S63A 3CK9A 4JA7A 3ML8A 2XZDG 5KJKA 5D0QD 4O1PA 1U3CA 1OY3D 3PE3A 2NC9A 4HB5A 4UQZA 2EIKE 2J07A 2PM7A 1OWNA 3SFYA 3NZSA 1IHGA 1O1SA 3QOUA 4ILHB 3EU5A 3ISMC 2VSOE 3W9GA 2PM6A 4HOQA 3UPVA 3FH5A 1MQSA 1OCRE 3L16A 2F8YA 1Z3XA 4ANXA 5G55A 3HDXA 1HO8A 3C72A 5T3RA 1SZ9A 2VQ2A 1TNOA 3VLFA 5B3SE 2VSYA 1TN8A 2WPVA 4GU5A 4BTAA 1H0AA 3KAEA 4H7XA 4APOA 4DX5D 2VGXB 1UN9A 2GRQB 3JQ0A 5BW8C 4KZCA 2V8SE 2WQHA 2KZTA 3CV0A 3UM3A 4DI3A 3CKCA 5LOZA 3TL5A 4G23A 4Z68A 2J49A 3ZW3A 1H6PA 5KJNA 5C2YA 2V0PA 1HH8A 4J8EA 4I9CA 1FVHA 3EJNA 3UMVA 4DLOA 3D9KA 5EKQD 1HZ4A 3OXLA 1TN6A 3CVVA 3CHRA 1Y8MA 3HXDA 4PUCA 1N0QA 4DLQA 1FPPA 1D9SA 1PY1A 4G8LA 4DJAA 3NZUA 4F53A 4BWRA 3ABME 3FHEA 3FY4A 5AENA 5AJLA 5HQ8A 3I5PA 5ARGA 5A23A 4CGVA 4U8HA 3CSTA 3CHQA 1WY6A 2EINE 2J4BA 1OUVA 1TEZA 4ACKA 2R05A 1OWMA 4C9BB 2GRPB 3T9KA 3FEXA 3QWPA 5CERB 1UJJA 1QQEA 3UINC 5KNGA 4A55A 2B0OE 4EPZA 3T5XA 5BXUA 4TXQA 4E6HA 3AU4A 2DVWA 2X6JA 4ANWA 4M3OA 1NA3A 3IEGA 4OAVB 1JWGA 3C3OA 4B93B 3ZIMA 3FUFA 2WXQA 3GZ1A 5KJMA 1AWCB 1K8KG 2AVPA 3CVUA 3Q75A 3Q5MA 3FTUA 3BQOA 4LCTA 4GA0A 2LSUA 1OT8A 2WM9A 2XGOA 4OYSA 3U3WA 3NAWA 3WXXA 4F1SA 4N5QA 1NL4A 3ZYLA 1TR4A 4HOTA 3U9WA 5ENQD 5CBOA 2J8SD 2MYOA 4UWKA 4WWPA 1JCSA 3PDNA 4U96D 3E33A 4NQ0A 4FJZA 1DC2A 3EHQA 2HM8A 5FINA 3R9MA 3MA5A 3E30A 1TNUA 3FH7A 3TWWA 5D2MC 1IQUA 3V31A 4DX6D 2LXLA 3ULYA 4LG6A 4UUCA 3L22A 2YNQA 3DSTA 4WNDA 2DYSE 2YINA 3T8MA 3FTWA 3UT8A 4IYPA 1H2VC 4HOUA 2GW1A 3SGHA 4BERA 4B89A 2CG2A 2WMOA 3RJVA 4KT6B 4ILIA 3FTZA 1QZ2A 3UX4A 2ILRA 5LP0A 3Q15A 1GW6A 3JXJA 1EYHA 2QZAA 3AG4E 4ZHBA 4YDEA 4CRWA 2HE0A 3PEUB 4YDOA 3CSFA 4G26A 4GMJA 3Q9UC 2XZTG 1L5JA 2IONA 4DPRA 4ATGA 1QBQA 1V55E 4N3BA 3BUAA 4J8SA 3G2VA 4LUNU 2OVBA 4O60A 3Q7FA 4JA9A 1V54E 3AU5A 4EBAA 4EZJA 4YVOA 3SI5A 2GRMA 3FUJA 3SFZA 2JLBA 4K03A 3OTNA 4AEZC 1N95A 5KWDA 3ASDA 1QNFA 4FJYA 4BSZB 4O6FA 2PQRA 2XCCA 3AS4A 5JHBA 2OVFA 3EHMA 1KZOA 4CCAA 1B89A 3ABKE 5KJLA 3NF1A 3TXMA 4K5BA 4EZKA 4GB9A 4GMRA 1S64A 2ZU6B 3LCAA 4B8CB 2BF0X 4PS7A 4NRHB 3G2UA 3DXMG 5ENNA 2VYIA 4M7CA 1E90A 3Q47B 3L17A 5EDSA 4GZ5A 1BLXB 4GZ6A 2V4LA 3FUDA 3PZDA 2RKKA 4WUYA 1UJKA 1W3BA 1H2UA 5AQ7A 3ZU7B 2L0TB 5FQ4A 4ATZD 2L9BA 4XEIG 2E0IA 3TG5A 1E8ZA 1OCCE 3AG2E 1MHQA 4AIFA 2OEWA 3E34A 4WNFA 1JCRA 2P9LG 3CHPA 1NI1A 2DZOA 2ETBA 5G05C 5AQAA 4F7AA 1OWPA 2I9CA 4F3VA 3RRUA 1KZPA 3CQCB 4JB8P 4AM9A 1WAO1 3RSEG 5ARFA 4YVQC 4I9EA 3Q78A 3TWXA 3ZYKA 3PUJA 4RSYA 2L0IA 3E4BA 1ELRA 5T4YA 4AJWA 4C48B 1X81A 3UXGA 3KEZA 2KCLA 4JPSA 2IJGX 2X3MA 4Q96A 1LF8A 3FU0A 2WXRA 3CVXA 4YDYA 2VTBB 2F37A 5ENRD 5FTPA 3V2XA 3VLEA 4J7WA 3UIOC 3I4RB 4I17A 3DPYA 3IHYA 3PZ2A 3S2AA 5AARA 1LD7A 1DCQA 2XGSA 4QQIA 4IULA 4FC8A 3GYZA 5EIDA 4L7TA 3U66A 5BNWA 4U63A 2ZXWE 4CYMD 2I1JA 1UG3A 3R7RA 5A6CA 4K5AB 1EPUA 4GYOA 3AG1E 1E7UA 2P9UG 3QNKA 3UQ3A 1SQMA 3CHSA 3HG0D 4BESA 1N94A 3V2OA 2M63A 2IO3C 4UWHA 4HOSA
chains in the Genus database with same CATH topology
3DSVA 4GTSA 1N95A 3EUVA 1N4QA 3E30A 3E34A 1O5MA 1TNUA 1JCRA 1NI1A 1TNYA 1DCEA 3C72A 3PZ1A 3DRAA 1TNOA 1TN8A 1KZOA 1N4SA 1N4PA 1KZPA 3KSLA 3DSTA 4GTTA 2H6IA 1N9AA 3Q7AA 3KSQA 1O1TA 4LNGA 3HXCA 2H6HA 4GTPA 2ZIRA 3Q78A 3DSWA 1S64A 1D8EA 3PZ4A 2ZISA 1X81A 1LTXA 2H6GA 4MBGA 3DSXA 1D8DA 3HXEA 3HXBA 3E32A 1FT2A 3Q75A 3DSUA 3Q79A 4L9PA 2H6FA 4YDEA 2BEDA 3SFXA 4EHMA 1O1RA 1TN6A 3DPYA 1TN7A 4YDOA 4LNBA 1JCQA 3PZ2A 3PZ3A 2F0YA 3HXDA 1N4RA 1LD7A 1LD8A 4GTQA 1S63A 1NL4A 1SA4A 3HXFA 1QBQA 1MZCA 1FPPA 3E37A 2IEJA 4GTVA 3Q73A 1TNZA 2R2LA 3Q7FA 1JCSA 3SFYA 3E33A 1SA5A 1O1SA 3DSSA 4GTMA 3EU5A 1N94A 4GTRA 4GTOA 1TNBA 1FT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSV A;  4GTS A;  1N95 A;  3EUV A;  1N4Q A;  3E30 A;  3E34 A;  1O5M A;  1TNU A;  1JCR A;  1NI1 A;  1TNY A;  1DCE A;  3C72 A;  3PZ1 A;  3DRA A;  1TNO A;  1TN8 A;  1KZO A;  1N4S A;  1N4P A;  1KZP A;  3KSL A;  3DST A;  4GTT A;  2H6I A;  1N9A A;  3Q7A A;  3KSQ A;  1O1T A;  4LNG A;  3HXC A;  2H6H A;  4GTP A;  2ZIR A;  3Q78 A;  3DSW A;  1S64 A;  1D8E A;  3PZ4 A;  2ZIS A;  1X81 A;  1LTX A;  2H6G A;  4MBG A;  3DSX A;  1D8D A;  3HXE A;  3HXB A;  3E32 A;  1FT2 A;  3Q75 A;  3DSU A;  3Q79 A;  4L9P A;  2H6F A;  4YDE A;  2BED A;  3SFX A;  4EHM A;  1O1R A;  1TN6 A;  3DPY A;  1TN7 A;  4YDO A;  4LNB A;  1JCQ A;  3PZ2 A;  3PZ3 A;  2F0Y A;  3HXD A;  1N4R A;  1LD7 A;  1LD8 A;  4GTQ A;  1S63 A;  1NL4 A;  1SA4 A;  3HXF A;  1QBQ A;  1MZC A;  1FPP A;  3E37 A;  2IEJ A;  4GTV A;  3Q73 A;  1TNZ A;  2R2L A;  3Q7F A;  1JCS A;  3SFY A;  3E33 A;  1SA5 A;  1O1S A;  3DSS A;  4GTM A;  3EU5 A;  1N94 A;  4GTR A;  4GTO A;  1TNB A;  1FT1 A; 
#chains in the Genus database with same CATH topology
 1Q2Z A;  4JVS A;  4GTS A;  2XHE A;  2CG3 A;  4J8D A;  1N4Q A;  3MV2 B;  3QAQ A;  1WM5 A;  2WXN A;  4HNA D;  1SW6 A;  3CVW A;  3IXE A;  1K1B A;  2GGF A;  4GTT A;  1N9A A;  3GZS A;  1Z5S C;  1N54 A;  4WNE A;  4TXP A;  2ZIR A;  5CED B;  3ZGQ A;  5KNH D;  4ANV A;  3UKR G;  2VSX E;  1A5E A;  3DSX A;  4KVO A;  3JXI A;  2JAB A;  2KM4 A;  5HI7 A;  3P1U A;  3BU8 A;  5FZS A;  2QYU A;  4CT4 A;  3C3R A;  5E75 A;  3NB2 A;  5JJ6 A;  3UT4 A;  4HI9 A;  2F0Y A;  2MHK A;  5DIZ A;  2DIW A;  5CEA A;  4DX7 D;  1E8Y A;  3CQG B;  5LFA A;  4RLY A;  3Q73 A;  4A1S A;  2RG8 A;  5M72 A;  3MCX A;  3FUE A;  4JEH A;  4E85 A;  2MRI A;  4FLH A;  4I1A A;  1FT1 A;  3J5Q B;  2P9S G;  4LEU A;  3DSV A;  3T5V A;  1QYM A;  3PS6 A;  1RW2 A;  2WQ7 A;  2ETA A;  2LO6 A;  3LDZ A;  2V4H C;  3DRA A;  4LRZ A;  2GRR B;  3DPD A;  2IFU A;  3Q4A B;  2PQN A;  4MKT A;  2BKG A;  5EN5 D;  3R9A B;  2Q7F A;  2EIJ E;  5B1A E;  1H2T C;  1S70 B;  2HR2 A;  4I6E A;  3MX3 A;  4U0Z A;  2FO7 A;  3PZ4 A;  2GRN B;  3MZL B;  3EIJ A;  3AJI A;  3PNT B;  3JYS A;  2X6F A;  2XCB A;  3V30 A;  1XNF A;  3CIA A;  1FCH A;  2AXZ A;  3NQP A;  5LCW C;  4UWL A;  3D9I A;  2GRO B;  4HLE A;  3IV0 A;  3RO3 A;  2KXP C;  2WXH A;  4G25 A;  3ZRH A;  2FBN A;  4WAF A;  3L9T A;  2KBX A;  3SNX A;  3URZ A;  3EDT B;  2BTD A;  3GZ2 A;  3ZHE B;  3S7J A;  5FQ6 A;  3B95 A;  3CKB A;  1UOH A;  4UWG A;  3DSS A;  3B7R L;  1U3D A;  3CVY A;  2UY1 A;  1NP7 A;  2LSV A;  2FI7 A;  1UW4 B;  2WXF A;  5ENO D;  3D9N A;  2LUH A;  4ACL A;  3ZYM A;  5LCW J;  2CFZ A;  1N0R A;  3QC1 A;  4XIF A;  3SBT B;  3HYM B;  4G11 A;  2R03 A;  4KYO B;  2P9P G;  2J9Q A;  3KSQ A;  4UWF A;  1KT0 A;  2LAI A;  1O1T A;  3MJW A;  4MRU A;  3AAA C;  3APF A;  3CLJ A;  2WXL A;  1D8E A;  3PNL B;  4I1M A;  3X2Q E;  4B0Z A;  3HVE A;  3FU6 A;  4JHJ A;  4LER A;  3I3N A;  3QJZ A;  2OCC E;  2KC7 A;  4F6R D;  5EX0 A;  3SO8 A;  2KZT B;  3GW4 A;  4I6J A;  1HS6 A;  2EIL E;  2KCK A;  1N4R A;  3LS8 A;  4HQD A;  3PEV B;  3D9J A;  3SQV A;  3OAW A;  3MGB A;  3QK0 A;  2WVI A;  1YA0 A;  4HXI A;  2R2L A;  4FU3 A;  4PDX A;  3RAU A;  4AXH A;  4GZ3 A;  2LXM A;  4G8K A;  4GA2 A;  4IRU A;  1MX6 A;  4UI9 C;  3FU5 A;  2P9K G;  2XRY A;  3RKV A;  3HHM A;  2A5U A;  2KCV A;  2I6H A;  2OV8 A;  4UQX A;  3SBS A;  3ZNG A;  5CCM A;  4FUL A;  4RG6 A;  4XE0 A;  5BPP A;  5AQB A;  4NIK A;  4Y6C A;  2F8X K;  4F1P A;  1ZB1 A;  3LVQ E;  4BFR A;  5BV0 A;  1A17 A;  2IY0 C;  2Y69 E;  4GCN A;  3ASF A;  3EU9 A;  3QDN A;  2BKK B;  2DYR E;  4AY6 A;  3JUI A;  4GPK A;  4I2W A;  3FUM A;  4KZ0 A;  3ENE A;  2VGE A;  3L13 A;  3D9P A;  2R5S A;  4FP7 A;  3MEK A;  3FTS A;  1FT2 A;  2P9I G;  4K5C A;  3PUK A;  3RRN B;  4CDM A;  4MS6 A;  3P2B A;  3FEY A;  3BG1 B;  4I43 A;  1MJ0 A;  3KD7 A;  4MLP A;  1OWL A;  3IKO B;  4U07 A;  2X6H A;  4DI4 A;  3D9L A;  3B13 A;  2R59 A;  1SA4 A;  1VDY A;  4BX8 A;  2WXP A;  3I4G A;  3JQ1 A;  3LJN A;  4WWO A;  5CMW A;  4EQF A;  2FUL A;  2IEJ A;  3J5P A;  2XPZ A;  5BUZ A;  2QYJ A;  1HU3 A;  5IY5 E;  3ASG A;  3U4T A;  4AY5 A;  4GTR A;  3D3M A;  2FEZ A;  3CHM A;  3EHN A;  2XPY A;  3G2W A;  1N11 A;  1H6K A;  3ZFW A;  2CHZ A;  4PH4 B;  1NZN A;  4TV3 A;  1DCE A;  3JUE A;  4FHJ A;  3ASN E;  1IYG A;  3FUN A;  2E2E A;  2P58 C;  4DX2 A;  4ZFH A;  3NBN B;  2XEH A;  4U0S A;  3LYA A;  1E8X A;  2OEV A;  3O48 A;  2R02 A;  3G2S A;  4G2V A;  4EBA G;  3TWQ A;  2H6G A;  2CHW A;  1PC2 A;  2L6B A;  4AOF A;  3DBS A;  1MYO A;  2IOS A;  5AIJ A;  5D66 A;  4JL0 A;  1TJC A;  2P9N G;  4U8Y D;  1DVP A;  4JC8 A;  1G3N B;  2AXU A;  4U04 A;  2J4D A;  4HRM B;  4QFV A;  3SFX A;  4EHM A;  1TN7 A;  4TUM A;  2L6J A;  3CR3 A;  3ULQ A;  3V79 K;  1HX8 A;  1LD8 A;  1XGW A;  3ESK A;  3HXF A;  2WQ6 A;  3CEQ A;  1BPO A;  4I1O B;  4DX1 A;  3SD5 A;  3AS8 A;  2LNI A;  2IOL A;  3AG3 E;  2CFU A;  2XEN A;  4BTB A;  3IBE A;  1TNZ A;  1YMP A;  4X8Q A;  2AW6 A;  2DZN A;  5G05 J;  2X6I A;  4GPM A;  5CRV A;  3UM1 A;  1KLX A;  2UWJ G;  4NUR A;  4XI0 A;  3FH8 A;  4U8V D;  4BSX A;  3CVN A;  4LSZ E;  1AP7 A;  2WXM A;  2Y4U A;  2XS1 A;  4GCO A;  4A3T A;  3LXU X;  4JZY A;  3UTM A;  1JPL A;  3TWU A;  5BT1 A;  2H6H A;  3G2T A;  3FU3 A;  4AV7 A;  2VSN A;  3LKU A;  3RRM B;  5ENP D;  4FA6 A;  4OVU A;  3ZUV B;  5CRU A;  5CHE E;  4U95 D;  3UM2 A;  4ANU A;  2WXI A;  3UT7 A;  2IO2 C;  5CEC B;  3SF4 A;  4RG9 A;  5CBN A;  4TXR A;  3IHV A;  2MOW A;  4HFG A;  5ANL A;  4GZD A;  3DEO A;  2C0M A;  4J8Y A;  3PH0 C;  1NA0 A;  5ANR A;  5HRY A;  4UI9 K;  3TJP A;  2C0L A;  2XQ0 A;  3ESL A;  3VTY A;  4HBD A;  4HRL A;  5LX8 A;  4GTV A;  1WDY A;  4DK5 A;  3D9M A;  3UI2 A;  1BI7 B;  3UUX A;  5E76 A;  4TRQ A;  3MKQ A;  1KPS B;  4K0R A;  3EIQ C;  2NSZ A;  4KBQ A;  4GTO A;  1TNB A;  4EZL A;  5JA4 D;  1BD8 A;  4AP2 A;  3TAX A;  4ILG A;  4KXK B;  4DUI A;  3SZ7 A;  3UIP C;  2ZGD A;  4N3A A;  4GYW A;  4XKB A;  5HS0 A;  2H6I A;  3Q7A A;  1OCZ E;  4Q94 A;  5HKP A;  2Y4T A;  2WXJ A;  4GTP A;  5EX3 A;  3APD A;  4N3C A;  3B7U X;  3D9H A;  2DBA A;  3KEA A;  2P2C P;  4HVB A;  4MBG A;  1D8D A;  3APC A;  3E32 A;  5B1B E;  2LAH A;  2Y1L E;  3Q79 A;  4L9P A;  1K3Z D;  4PS3 A;  5CMY A;  3CK7 A;  1UN8 A;  2Y0B G;  3LJ3 A;  2BUG A;  5KBA A;  1FVF A;  4V3I A;  4GML A;  2ETC A;  4L2Y A;  1EF1 C;  1Z3Y A;  3PVL A;  3LY7 A;  2NXP A;  4DRX E;  4JW1 A;  3UKU G;  5A7D B;  2XPI A;  3SHF A;  3VLD A;  4Y6W A;  2CHX A;  1BU9 A;  4G24 A;  3K9I A;  3ZN3 A;  1U2V G;  3R7Q A;  3TWS A;  4UQY A;  2XGM A;  2R17 C;  1IQR A;  4CDN A;  4AVX A;  1TJF A;  4L1B A;  5JHA A;  3EUV A;  3FUL A;  4C0M A;  3RK6 A;  3AS5 A;  1E96 B;  1TNY A;  1MX2 A;  5FQ7 A;  3PZ1 A;  4A63 B;  4XI9 A;  2FO1 E;  1N4S A;  5FIO A;  4JHK A;  3Q9N C;  1YYH A;  5FZR A;  3FTV A;  4BT9 A;  2ZGG A;  3HXC A;  1OXJ A;  1HXI A;  3FTX A;  3ASH A;  1Z6T A;  3DSW A;  4PS8 A;  4WWN A;  5T8I A;  1LTX A;  4JEU A;  3WG7 E;  3O4Z A;  4XX5 A;  1SZA A;  1DNP A;  2J09 A;  5EYP F;  3FDH A;  2RD0 A;  3JCK C;  4HS2 A;  4H7Y A;  3PRE A;  4RQI A;  4GZC A;  3LVR E;  2H6F A;  2B6C A;  1ELW A;  4YND A;  2DCP A;  3KS2 A;  2XRZ A;  3NOG D;  2WXG A;  3FP3 A;  3PZ3 A;  2WXO A;  3ZVV A;  3OXF A;  4BET A;  3PE4 A;  4GTQ A;  2V5F A;  5D0O D;  2KAT A;  4U7E B;  2Y3A A;  4LNU D;  1RZ4 A;  4CEM A;  3RO2 A;  5FQ8 A;  3MKQ B;  3BEE A;  4BY6 A;  1OCO E;  4TUU A;  3SY2 A;  3LY8 A;  3ASO E;  3FUI A;  3L54 A;  3F6Q A;  3DEP A;  4JHR A;  4D10 C;  4FLB A;  4A1G A;  2AJA A;  1INZ A;  4HRN A;  3ZYQ A;  3Q49 B;  4APF A;  5H7P A;  3FUK A;  3ONK A;  3RU0 A;  2RFM A;  5AAO A;  3U64 A;  2PNN A;  3PRZ A;  3QWV A;  4CZ2 D;  4HLL A;  4U0U A;  3FUH A;  3B7B A;  3QAR A;  4HOR A;  2YHC A;  2AXV A;  1IHB A;  1EDU A;  2OND A;  3TXN A;  2XEE A;  1N4P A;  4JXT A;  4Q69 A;  2C2L A;  1P5Q A;  1K1A A;  5KCM A;  2AWI A;  3FWV A;  2PZI A;  2VTB A;  3OXG A;  2XEV A;  3HIZ A;  2DWZ A;  3LPZ A;  3CVQ A;  2RFA A;  4IN3 B;  2VJ8 A;  1SVX A;  3LEW A;  3ZXS A;  2YQ8 A;  2VGY A;  5FJY A;  1BI8 B;  4WNG A;  5EIL A;  4OVV A;  4G1T A;  3ABL E;  3ONL A;  3DSU A;  4N39 A;  4NAC A;  2WB2 A;  2BED A;  2YHE A;  1O1R A;  5ITZ F;  5J90 A;  4LNB A;  3TG4 A;  3BG0 B;  2XS8 A;  5BV1 A;  1KT1 A;  5AJD A;  5EYL A;  2JEK A;  3CVL A;  4UI9 J;  2V5Q C;  3MV3 B;  1JWF A;  3L08 A;  2J08 A;  4I6G A;  1ZBP A;  3S7B A;  1SA5 A;  3LY9 A;  4CGW A;  3TWV A;  4A3V A;  4GTM A;  4FAD A;  3ZXP A;  4YDW A;  3L6A A;  1NFI E;  5DBK A;  2IF4 A;  3C3Q A;  4R7L A;  4L2L A;  4KVM A;  3ZKJ A;  4J8F A;  4B8A A;  2UY1 B;  3FFL A;  4XZ4 A;  3VTX A;  2WXK A;  2NYJ A;  3ML9 A;  3MYV A;  2I2O A;  3KSL A;  3CGH A;  2QFC A;  3FTY A;  1HG5 A;  1E8W A;  5CCL A;  4LNG A;  1WG0 A;  4CT0 A;  2OOE A;  2VGX A;  3S7D A;  3L82 A;  1ELK A;  5FWQ A;  2EQX A;  4BEP A;  4J0U A;  3HXE A;  2QC9 A;  3HXB A;  2PL2 A;  3QKY A;  4OAU C;  3CHO A;  3TGO A;  4J6I A;  3TWT A;  2EIM E;  3NOC D;  4ABN A;  5C1D A;  2FF4 A;  5G04 C;  5BXO A;  3HVE B;  1HF8 A;  1IKN D;  3MKR A;  4O1O A;  5JJ7 A;  2A4Z A;  2GRL A;  4GYY A;  4FHK A;  3C5R A;  1ZU2 A;  1E7V A;  4B94 A;  4EEC A;  1TYQ G;  4W9R A;  1MZC A;  4CDR A;  3E37 A;  5ENS D;  5AQ9 A;  2A5E A;  5FZQ A;  3DWL G;  3RIB A;  3T8K A;  4HI8 A;  3S7F A;  3N71 A;  4BT8 A;  2WMN A;  1IXV A;  4URK A;  4N2Q A;  3TWR A;  1S0P A;  5JJT A;  1JUQ A;  5JMN D;  3QWW A;  5AYW D;  1O5M A;  4BX9 A;  1PAQ A;  5FT9 A;  2HO1 A;  3ULE G;  2HYZ A;  3DXK G;  5J08 A;  4GA1 A;  5G04 J;  4JD2 G;  3ZEF A;  3C98 A;  1OWO A;  3HRA A;  1H19 A;  1YCS B;  5AN8 A;  5EIB E;  3W9F A;  2X6K A;  4N5C A;  3CK8 A;  2QY7 A;  5G2N A;  5ENT D;  1HE8 A;  1H6O A;  4KMO A;  4L23 A;  3B7S A;  4P29 A;  4ME2 A;  4C0E A;  3EHR A;  1N52 A;  1HG2 A;  2ZIS A;  2I1K A;  1MX4 A;  3B7T A;  4I2Z A;  4N2S A;  2IQC A;  4GAA A;  3CVP A;  1Y6I A;  3D9O A;  1HFA A;  3UM0 A;  2X38 A;  3ZHE A;  2IU1 A;  3ZPJ A;  1JCQ A;  3QB2 A;  1X5B A;  4RVB A;  4XKC A;  1S63 A;  3CK9 A;  4JA7 A;  3ML8 A;  2XZD G;  5KJK A;  5D0Q D;  4O1P A;  1U3C A;  1OY3 D;  3PE3 A;  2NC9 A;  4HB5 A;  4UQZ A;  2EIK E;  2J07 A;  2PM7 A;  1OWN A;  3SFY A;  3NZS A;  1IHG A;  1O1S A;  3QOU A;  4ILH B;  3EU5 A;  3ISM C;  2VSO E;  3W9G A;  2PM6 A;  4HOQ A;  3UPV A;  3FH5 A;  1MQS A;  1OCR E;  3L16 A;  2F8Y A;  1Z3X A;  4ANX A;  5G55 A;  3HDX A;  1HO8 A;  3C72 A;  5T3R A;  1SZ9 A;  2VQ2 A;  1TNO A;  3VLF A;  5B3S E;  2VSY A;  1TN8 A;  2WPV A;  4GU5 A;  4BTA A;  1H0A A;  3KAE A;  4H7X A;  4APO A;  4DX5 D;  2VGX B;  1UN9 A;  2GRQ B;  3JQ0 A;  5BW8 C;  4KZC A;  2V8S E;  2WQH A;  2KZT A;  3CV0 A;  3UM3 A;  4DI3 A;  3CKC A;  5LOZ A;  3TL5 A;  4G23 A;  4Z68 A;  2J49 A;  3ZW3 A;  1H6P A;  5KJN A;  5C2Y A;  2V0P A;  1HH8 A;  4J8E A;  4I9C A;  1FVH A;  3EJN A;  3UMV A;  4DLO A;  3D9K A;  5EKQ D;  1HZ4 A;  3OXL A;  1TN6 A;  3CVV A;  3CHR A;  1Y8M A;  3HXD A;  4PUC A;  1N0Q A;  4DLQ A;  1FPP A;  1D9S A;  1PY1 A;  4G8L A;  4DJA A;  3NZU A;  4F53 A;  4BWR A;  3ABM E;  3FHE A;  3FY4 A;  5AEN A;  5AJL A;  5HQ8 A;  3I5P A;  5ARG A;  5A23 A;  4CGV A;  4U8H A;  3CST A;  3CHQ A;  1WY6 A;  2EIN E;  2J4B A;  1OUV A;  1TEZ A;  4ACK A;  2R05 A;  1OWM A;  4C9B B;  2GRP B;  3T9K A;  3FEX A;  3QWP A;  5CER B;  1UJJ A;  1QQE A;  3UIN C;  5KNG A;  4A55 A;  2B0O E;  4EPZ A;  3T5X A;  5BXU A;  4TXQ A;  4E6H A;  3AU4 A;  2DVW A;  2X6J A;  4ANW A;  4M3O A;  1NA3 A;  3IEG A;  4OAV B;  1JWG A;  3C3O A;  4B93 B;  3ZIM A;  3FUF A;  2WXQ A;  3GZ1 A;  5KJM A;  1AWC B;  1K8K G;  2AVP A;  3CVU A;  3Q75 A;  3Q5M A;  3FTU A;  3BQO A;  4LCT A;  4GA0 A;  2LSU A;  1OT8 A;  2WM9 A;  2XGO A;  4OYS A;  3U3W A;  3NAW A;  3WXX A;  4F1S A;  4N5Q A;  1NL4 A;  3ZYL A;  1TR4 A;  4HOT A;  3U9W A;  5ENQ D;  5CBO A;  2J8S D;  2MYO A;  4UWK A;  4WWP A;  1JCS A;  3PDN A;  4U96 D;  3E33 A;  4NQ0 A;  4FJZ A;  1DC2 A;  3EHQ A;  2HM8 A;  5FIN A;  3R9M A;  3MA5 A;  3E30 A;  1TNU A;  3FH7 A;  3TWW A;  5D2M C;  1IQU A;  3V31 A;  4DX6 D;  2LXL A;  3ULY A;  4LG6 A;  4UUC A;  3L22 A;  2YNQ A;  3DST A;  4WND A;  2DYS E;  2YIN A;  3T8M A;  3FTW A;  3UT8 A;  4IYP A;  1H2V C;  4HOU A;  2GW1 A;  3SGH A;  4BER A;  4B89 A;  2CG2 A;  2WMO A;  3RJV A;  4KT6 B;  4ILI A;  3FTZ A;  1QZ2 A;  3UX4 A;  2ILR A;  5LP0 A;  3Q15 A;  1GW6 A;  3JXJ A;  1EYH A;  2QZA A;  3AG4 E;  4ZHB A;  4YDE A;  4CRW A;  2HE0 A;  3PEU B;  4YDO A;  3CSF A;  4G26 A;  4GMJ A;  3Q9U C;  2XZT G;  1L5J A;  2ION A;  4DPR A;  4ATG A;  1QBQ A;  1V55 E;  4N3B A;  3BUA A;  4J8S A;  3G2V A;  4LUN U;  2OVB A;  4O60 A;  3Q7F A;  4JA9 A;  1V54 E;  3AU5 A;  4EBA A;  4EZJ A;  4YVO A;  3SI5 A;  2GRM A;  3FUJ A;  3SFZ A;  2JLB A;  4K03 A;  3OTN A;  4AEZ C;  1N95 A;  5KWD A;  3ASD A;  1QNF A;  4FJY A;  4BSZ B;  4O6F A;  2PQR A;  2XCC A;  3AS4 A;  5JHB A;  2OVF A;  3EHM A;  1KZO A;  4CCA A;  1B89 A;  3ABK E;  5KJL A;  3NF1 A;  3TXM A;  4K5B A;  4EZK A;  4GB9 A;  4GMR A;  1S64 A;  2ZU6 B;  3LCA A;  4B8C B;  2BF0 X;  4PS7 A;  4NRH B;  3G2U A;  3DXM G;  5ENN A;  2VYI A;  4M7C A;  1E90 A;  3Q47 B;  3L17 A;  5EDS A;  4GZ5 A;  1BLX B;  4GZ6 A;  2V4L A;  3FUD A;  3PZD A;  2RKK A;  4WUY A;  1UJK A;  1W3B A;  1H2U A;  5AQ7 A;  3ZU7 B;  2L0T B;  5FQ4 A;  4ATZ D;  2L9B A;  4XEI G;  2E0I A;  3TG5 A;  1E8Z A;  1OCC E;  3AG2 E;  1MHQ A;  4AIF A;  2OEW A;  3E34 A;  4WNF A;  1JCR A;  2P9L G;  3CHP A;  1NI1 A;  2DZO A;  2ETB A;  5G05 C;  5AQA A;  4F7A A;  1OWP A;  2I9C A;  4F3V A;  3RRU A;  1KZP A;  3CQC B;  4JB8 P;  4AM9 A;  1WAO 1;  3RSE G;  5ARF A;  4YVQ C;  4I9E A;  3Q78 A;  3TWX A;  3ZYK A;  3PUJ A;  4RSY A;  2L0I A;  3E4B A;  1ELR A;  5T4Y A;  4AJW A;  4C48 B;  1X81 A;  3UXG A;  3KEZ A;  2KCL A;  4JPS A;  2IJG X;  2X3M A;  4Q96 A;  1LF8 A;  3FU0 A;  2WXR A;  3CVX A;  4YDY A;  2VTB B;  2F37 A;  5ENR D;  5FTP A;  3V2X A;  3VLE A;  4J7W A;  3UIO C;  3I4R B;  4I17 A;  3DPY A;  3IHY A;  3PZ2 A;  3S2A A;  5AAR A;  1LD7 A;  1DCQ A;  2XGS A;  4QQI A;  4IUL A;  4FC8 A;  3GYZ A;  5EID A;  4L7T A;  3U66 A;  5BNW A;  4U63 A;  2ZXW E;  4CYM D;  2I1J A;  1UG3 A;  3R7R A;  5A6C A;  4K5A B;  1EPU A;  4GYO A;  3AG1 E;  1E7U A;  2P9U G;  3QNK A;  3UQ3 A;  1SQM A;  3CHS A;  3HG0 D;  4BES A;  1N94 A;  3V2O A;  2M63 A;  2IO3 C;  4UWH A;  4HOS A; 
#chains in the Genus database with same CATH homology
 3DSV A;  4GTS A;  1N95 A;  3EUV A;  1N4Q A;  3E30 A;  3E34 A;  1O5M A;  1TNU A;  1JCR A;  1NI1 A;  1TNY A;  1DCE A;  3C72 A;  3PZ1 A;  3DRA A;  1TNO A;  1TN8 A;  1KZO A;  1N4S A;  1N4P A;  1KZP A;  3KSL A;  3DST A;  4GTT A;  2H6I A;  1N9A A;  3Q7A A;  3KSQ A;  1O1T A;  4LNG A;  3HXC A;  2H6H A;  4GTP A;  2ZIR A;  3Q78 A;  3DSW A;  1S64 A;  1D8E A;  3PZ4 A;  2ZIS A;  1X81 A;  1LTX A;  2H6G A;  4MBG A;  3DSX A;  1D8D A;  3HXE A;  3HXB A;  3E32 A;  1FT2 A;  3Q75 A;  3DSU A;  3Q79 A;  4L9P A;  2H6F A;  4YDE A;  2BED A;  3SFX A;  4EHM A;  1O1R A;  1TN6 A;  3DPY A;  1TN7 A;  4YDO A;  4LNB A;  1JCQ A;  3PZ2 A;  3PZ3 A;  2F0Y A;  3HXD A;  1N4R A;  1LD7 A;  1LD8 A;  4GTQ A;  1S63 A;  1NL4 A;  1SA4 A;  3HXF A;  1QBQ A;  1MZC A;  1FPP A;  3E37 A;  2IEJ A;  4GTV A;  3Q73 A;  1TNZ A;  2R2L A;  3Q7F A;  1JCS A;  3SFY A;  3E33 A;  1SA5 A;  1O1S A;  3DSS A;  4GTM A;  3EU5 A;  1N94 A;  4GTR A;  4GTO A;  1TNB A;  1FT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...