3EUVA

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10, w102t, y154t) in complex with biotingpp
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 132
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3euvA00
3PZ1A 1JCRA 2R2LA 4YDOA 3DRAA 1NL4A 3SFXA 1N4SA 2IEJA 1QBQA 1TN8A 1S64A 3HXCA 1N9AA 1SA5A 3DSSA 4LNGA 4GTTA 1O5MA 1MZCA 3HXDA 1TNOA 3DSVA 2ZISA 1KZPA 4LNBA 3DSTA 3DSWA 2F0YA 3KSQA 1FT2A 3Q7AA 4YDEA 1N95A 1O1SA 1N4RA 4L9PA 3HXBA 1TNYA 3SFYA 3EUVA 2H6GA 1LTXA 2BEDA 3E33A 1NI1A 3E32A 4GTMA 3C72A 1N4PA 3E30A 2H6IA 3E37A 4GTOA 4EHMA 1TN6A 3DSXA 3HXEA 1JCSA 3KSLA 3PZ3A 4GTPA 3Q79A 1TNBA 1DCEA 3PZ2A 1D8EA 1D8DA 1S63A 4GTQA 1KZOA 3Q73A 1O1TA 1FT1A 1TNUA 3Q75A 2ZIRA 1N94A 1TN7A 3Q7FA 1FPPA 4GTRA 4MBGA 3EU5A 1X81A 1SA4A 3HXFA 4GTSA 4GTVA 1LD7A 1O1RA 1JCQA 1LD8A 3Q78A 1N4QA 3E34A 3DSUA 3PZ4A 2H6FA 1TNZA 3DPYA 2H6HA
chains in the Genus database with same CATH superfamily
4GZDA 5LFAA 3RK6A 2VQ2A 3ZKJA 4Q96A 3CVXA 4K5BA 4WAFA 3B7BA 4D10C 5CEDB 3FTZA 3ULEG 3FHEA 2WXIA 1MYOA 2IJGX 1H6OA 2ZGDA 2FBNA 1OCOE 1VDYA 2JABA 3LJNA 2ZGGA 1ZBPA 2DZNA 4DLQA 3NBNB 2WQ7A 3CVPA 1QZ2A 3OXGA 4O60A 3CHOA 2JEKA 5CHEE 4APFA 1JPLA 3CVVA 4I43A 5BW8C 5HQ8A 3TG5A 1NI1A 2GRRB 3C72A 4GZ6A 5AN8A 2H6IA 3J5QB 3QAQA 3L6AA 3BG0B 4JVSA 3C3OA 3B95A 1RW2A 1D8EA 3FTVA 1S63A 3SNXA 3UTMA 3Q75A 1V54E 3DEPA 5JJ6A 4GCNA 3QWVA 1UN8A 3EU5A 3UQ3A 4GYYA 4DI3A 3WXXA 3AU5A 4L1BA 4F53A 3PEVB 4GA2A 3X2QE 4JW1A 2WXKA 4BEPA 2XRZA 2V8SE 1MX6A 4RLYA 2JLBA 4YNDA 4WUYA 1HG5A 3I5PA 3NF1A 4U0UA 2P58C 2PZIA 3TWWA 5EX3A 1UN9A 3CV0A 3CK9A 5E76A 3SFZA 1MHQA 3FTUA 2AXUA 4GZ5A 3BG1B 3PE3A 4GTTA 4CDRA 1MX4A 4HLEA 2J4BA 2CG3A 2I1JA 1KZPA 4DX1A 3CKCA 4E6HA 4N3CA 3Q7AA 1K1AA 2PL2A 3UKRG 4HQDA 1Z3YA 3HXBA 1WAO1 3VLFA 2XS8A 4ACKA 4A3TA 1EYHA 3ONKA 4N2SA 5CBNA 3EIJA 4J8YA 3MKQB 2XEHA 3UM3A 5LX8A 1DCQA 4MKTA 4G8LA 4EZJA 3WG7E 3UIPC 2P9KG 2CHZA 1PY1A 3MCXA 1H6KA 3FUNA 4PUCA 1XGWA 3G2TA 4JXTA 2XRYA 3LY8A 3MV3B 3I3NA 4WNGA 2Y3AA 3CSTA 4JPSA 3LPZA 5ENRD 4DJAA 3ZXSA 3OAWA 3PNTB 2V4HC 1HS6A 2LXMA 3AAAC 1WDYA 2RFAA 2BKKB 2DVWA 4AP2A 2EILE 1E90A 5CERB 4AY5A 3FDHA 3ZYLA 1U3DA 2GRNB 4J7WA 5EILA 2DWZA 3RIBA 4E85A 1TEZA 4BX8A 2IEJA 1P5QA 1ELKA 3ZVVA 2V5FA 4WNFA 2HM8A 4NACA 3NB2A 1JWGA 3N71A 4YDYA 1OWNA 4BERA 4BFRA 3ZGQA 2CHXA 1OXJA 3JQ0A 3E4BA 3FWVA 4LRZA 2LXLA 1QNFA 3VTYA 4UI9C 3E33A 2OOEA 4KT6B 3E32A 4GTMA 3FULA 4UWKA 1E7UA 1NP7A 3SZ7A 5KJMA 1Y6IA 4U63A 4GZ3A 5DIZA 4HB5A 5DBKA 2I2OA 2XHEA 4O6FA 4GZCA 3ASFA 4GTRA 3DXMG 3Q49B 3DBSA 1DVPA 4UWHA 1KPSB 4J6IA 2P9PG 4N5CA 5H7PA 4DX2A 5EKQD 2J07A 3K9IA 3ZN3A 3JXJA 3PZ4A 1HO8A 3GZ2A 3OXFA 4FHJA 2R02A 2C0MA 4DRXE 4HLLA 3CVWA 4ANUA 1ZB1A 4YVQC 4LCTA 5AIJA 2L6BA 4HRMB 3AJIA 3UT4A 3GZSA 5HI7A 3UX4A 2F8YA 2Y0BG 5E75A 5HRYA 2R17C 3ASGA 3EUVA 3PH0C 1N0QA 1HZ4A 1E8XA 2FF4A 3TWUA 3JXIA 2HYZA 4C48B 4I2WA 1AWCB 2FEZA 3FUHA 3R9AB 2EINE 4G23A 3G2WA 3APDA 1JCSA 4Y6WA 4C9BB 3TXMA 4I1OB 4Q94A 4U95D 3ZPJA 4DX7D 5ANLA 3KEAA 4DX6D 3NOCD 4LNUD 3SBTB 4YVOA 4GTVA 2VYIA 3IHVA 4ANWA 3ZYKA 3L16A 3VLDA 1LD8A 3T8MA 5AJDA 4IRUA 2PM7A 3BEEA 4J8EA 4BETA 3ASOE 3I4RB 4ACLA 1MJ0A 2WXGA 2P9IG 2DYRE 4PDXA 4BTBA 4EBAA 3R7QA 3CK7A 4FP7A 2OVFA 4I6EA 5D2MC 4HVBA 4G24A 4KXKB 2Y4TA 3MA5A 4LNBA 3DPDA 5ENNA 3FU3A 4G26A 3FU5A 4HOUA 2WXPA 3CVYA 2P9NG 1RZ4A 3HYMB 4ABNA 4ATGA 4JHKA 4URKA 3HG0D 4GPKA 2P9UG 3D9JA 5T4YA 3GZ1A 3UI2A 4IYPA 4U8HA 3QNKA 2AXZA 5FQ8A 1TN6A 5LP0A 3PUKA 3VTXA 2I1KA 2ZXWE 2AVPA 2LSUA 2EIME 2X6HA 1MQSA 3SBSA 5J08A 3D9NA 4IN3B 3FUDA 4GYOA 5BV1A 2V4LA 3C5RA 4A1GA 5BT1A 2WQ6A 1E8WA 4FJZA 4NIKA 5JJ7A 2B6CA 3B7RL 4JD2G 3ABLE 3EU9A 3SO8A 1IHGA 2DZOA 3EHNA 3FEYA 2R2LA 4A63B 5CRVA 2OV8A 2FI7A 1Z5SC 2IO2C 4NRHB 1H0AA 3FUJA 2I9CA 1HX8A 1N9AA 1H2TC 3DSVA 3QB2A 3O48A 4FLHA 3DSWA 2IFUA 5ANRA 4BX9A 4JHJA 4JEUA 3S7JA 1WY6A 2LNIA 1TJFA 2VTBA 2YQ8A 5LOZA 3ESLA 3L17A 4I1AA 4N5QA 4KVMA 2UY1A 4FULA 4CCAA 2L9BA 4NQ0A 3MEKA 4A1SA 3ASNE 3HHMA 4ME2A 4KVOA 5ENTD 4R7LA 4B89A 3RRUA 1ZU2A 2GROB 3BU8A 5CECB 1OWLA 1B89A 3LY9A 3D9KA 5KJKA 3PZDA 4NURA 3QK0A 3UMVA 2RKKA 1FCHA 5BXUA 1NA0A 3TG4A 2RFMA 3QOUA 2RD0A 5KCMA 1N54A 5G05J 1DC2A 4I6GA 4LSZE 1N11A 4FLBA 1N4SA 2YHCA 4C0EA 4OVVA 5ARFA 2WQHA 3Q4AB 3CGHA 5KJNA 3L22A 3CHRA 2PQNA 2NYJA 4HS2A 5A7DB 1FVFA 3Q9UC 5B1AE 1MZCA 5G2NA 3AS4A 4MS6A 3ZHEB 5J90A 1BI7B 4LEUA 1BD8A 2XQ0A 3DSTA 1HU3A 4HXIA 3CVNA 2F0YA 2A5EA 1FT2A 4OAVB 4AY6A 1JWFA 4N3BA 3IV0A 4L2YA 4L9PA 4J0UA 3RRMB 2ETCA 3L82A 3HRAA 2X6JA 4WWOA 2QFCA 1OY3D 1HFAA 4ATZD 3JQ1A 2MYOA 1AP7A 5C2YA 2IY0C 1K8KG 5FZRA 4WWPA 5AQAA 1WM5A 4G1TA 3UM0A 4J8SA 4CYMD 4CGVA 1OWMA 4WWNA 4KZCA 2ILRA 2X38A 4AVXA 2XGSA 2HE0A 3ENEA 1O1TA 1TNUA 4J8DA 1TN7A 4JC8A 4MLPA 3MX3A 1FPPA 2WXJA 2KCVA 3MJWA 4K5CA 1KT0A 3L13A 4ILGA 5BNWA 3ZRHA 5KNHD 2KZTB 4BESA 1N4QA 2QY7A 4LUNU 2FO1E 4ZFHA 1K1BA 2H6HA 4CT0A 4DUIA 4BT8A 1JCRA 1BU9A 2VJ8A 2PM6A 4L23A 2KZTA 1OCRE 3JCKC 4O1OA 3AU4A 5ITZF 3Q47B 3UM2A 3T5XA 3Q15A 2M63A 4XKBA 5FJYA 1N4RA 5EYPF 3T5VA 2FULA 3L9TA 4OAUC 4CZ2D 2MHKA 5D0QD 3W9GA 3QC1A 3PS6A 5BUZA 2LAIA 3E37A 3FFLA 4TXPA 4EHMA 5LCWC 3TWXA 2GW1A 4KYOB 2X6KA 4O1PA 2F37A 3APCA 4WNDA 5FT9A 4HI8A 1H19A 4AOFA 4YDWA 1WG0A 1YYHA 4GTPA 4BT9A 5D0OD 3NZUA 3SHFA 1Z3XA 4UQYA 2LUHA 4A55A 2Y69E 2A4ZA 3P1UA 4F6RD 4GTSA 3HXFA 4U07A 4B0ZA 1OCZE 3HIZA 5IY5E 2CFUA 2BUGA 5CMWA 2YNQA 4K5AB 4XX5A 4MRUA 5BPPA 3TAXA 3B7UX 3RKVA 4K0RA 4DX5D 1TYQG 4GB9A 3D9MA 3DRAA 3FTWA 3FTYA 5EDSA 4RVBA 3CQGB 4OVUA 3MYVA 1PC2A 4L7TA 5ENOD 1IKND 4PS8A 2VGXB 1IHBA 4LNGA 4UI9J 4HOSA 2VSOE 2ETBA 1X5BA 5HS0A 4V3IA 3U3WA 1BI8B 1N95A 2NSZA 2XZTG 2XCBA 1HE8A 3LY7A 4U0SA 4UWGA 3SD5A 4AM9A 3LCAA 3UT8A 3FH7A 2H6GA 5CEAA 3IHYA 1LTXA 4DK5A 3EJNA 3Q5MA 3W9FA 1OCCE 1OWOA 4DI4A 5ENPD 3FH8A 3V2XA 4RG9A 3OTNA 3KAEA 2R03A 3LS8A 4J8FA 1TNBA 3V2OA 3OXLA 3S2AA 2DCPA 5CCLA 4FADA 4HFGA 1KT1A 3FUKA 2ONDA 4EQFA 5JJTA 4U7EB 5KBAA 3SF4A 2WPVA 4KZ0A 2VTBB 3FP3A 1PAQA 4BSZB 3ULYA 5T3RA 3O4ZA 5EX0A 3T8KA 2AJAA 4X8QA 3V79K 4CGWA 4GAAA 5EN5D 2EIKE 3QWWA 2WM9A 1Z6TA 2J4DA 3HXDA 3U9WA 3FU0A 4M7CA 2XGMA 4HRLA 2WXHA 3UXGA 3CQCB 1E7VA 2XENA 1YMPA 2J08A 3UPVA 3F6QA 5ENQD 5LCWJ 2KBXA 4C0MA 3EHQA 3S7FA 3APFA 3CHPA 3PUJA 3T9KA 5FINA 5HKPA 4Q69A 4I9CA 3D9IA 1E96B 4I1MA 3KD7A 2R5SA 5FWQA 1IQRA 1IXVA 3ESKA 2VGYA 3PDNA 4GA0A 5AENA 3FUMA 4FU3A 2WXFA 5FTPA 3LVQE 3PE4A 4P29A 3KSLA 2XZDG 3KEZA 3RJVA 3UT7A 4UQXA 3SGHA 3LKUA 2E0IA 3LJ3A 4MBGA 3D9LA 3B7TA 3QDNA 1UOHA 5EIDA 4N2QA 4ANVA 5AQBA 2X3MA 3HVEA 3E34A 3FEXA 3UINC 2Y1LE 4ILHB 3L08A 3GYZA 4RQIA 2AXVA 3CR3A 3RO3A 3S7BA 4I17A 4JB8P 4QFVA 1TN8A 4I9EA 3HXCA 1ELWA 5G04J 2GRLA 3BUAA 2L0TB 4CT4A 2Q7FA 1O5MA 1SW6A 1IQUA 3CHQA 2CFZA 2WXQA 4XE0A 2WMOA 3J5PA 3ULQA 3PVLA 2KXPC 3DEOA 4HOTA 1A17A 4F1SA 3NAWA 5KJLA 4AXHA 3E30A 2KM4A 3AG4E 3ONLA 4RSYA 4TXQA 4FA6A 2IF4A 3PREA 1SZAA 2B0OE 1QQEA 2BTDA 2KCKA 3HDXA 3C98A 2VGEA 1UJKA 4XZ4A 4UWFA 3PZ2A 1D8DA 5A6CA 2GGFA 4PS3A 1EF1C 3QJZA 4HRNA 4BY6A 3RRNB 4XEIG 2XEVA 5FQ6A 4XI0A 3FTXA 3MV2B 4QQIA 1G3NB 3JUIA 2H6FA 3U64A 4EZKA 3TWVA 3PNLB 4YDOA 3D3MA 4U8YD 3ZEFA 1OWPA 4K03A 2P2CP 4UQZA 3TWRA 5G55A 4AIFA 1A5EA 4GYWA 1HXIA 2FO7A 2F8XK 3JYSA 5CMYA 4PH4B 5CBOA 3KSQA 3LVRE 5KNGA 4LG6A 4YDEA 3URZA 4XKCA 4XIFA 2EIJE 1U3CA 4G25A 4TXRA 3JUEA 2IU1A 2XPYA 3PRZA 1W3BA 2AWIA 1D9SA 5T8IA 4CDMA 2J09A 3FY4A 3RO2A 3EHMA 2LAHA 3FUFA 3ZNGA 1N4PA 3EDTB 3RSEG 1N0RA 3RU0A 3SI5A 5FQ4A 3CSFA 4L2LA 4G11A 4GMJA 3Q79A 1S0PA 1KZOA 5CRUA 4HORA 1H2UA 3Q7FA 3ZU7B 5BXOA 2YHEA 3EHRA 4OYSA 1OT8A 2QC9A 5ENSD 2KCLA 3QKYA 3ABME 4DLOA 2V0PA 1U2VG 2QYJA 2OCCE 2IO3C 2XCCA 3AG1E 5G05C 4GMLA 1YCSB 3IEGA 2I6HA 3KS2A 3ZUVB 1NZNA 3IKOB 4IULA 3LEWA 4H7YA 2XEEA 4G2VA 3BQOA 3MKRA 3P2BA 4FHKA 1L5JA 5BV0A 3ZIMA 3TWSA 3CVLA 3CLJA 3ASDA 1HH8A 2BKGA 3ML8A 4U04A 4TUUA 2NC9A 2ETAA 2CHWA 5AQ9A 4Y6CA 1E8YA 4GTOA 1KLXA 3B13A 3HXEA 3DSXA 2X6FA 4F1PA 3SY2A 4ZHBA 5A23A 5FIOA 2WVIA 5FQ7A 3SQVA 5C1DA 3S7DA 4GTQA 3MKQA 3LXUX 2OEWA 1K3ZD 1X81A 1QYMA 3CHMA 1UW4B 1Y8MA 2OVBA 2WMNA 3ZXPA 4FJYA 3L54A 4U0ZA 1YA0A 3TWQA 4HOQA 3G2UA 3PZ1A 4UI9K 2GRMA 2X6IA 2WXRA 4RG6A 3R9MA 4A3VA 3V31A 2C2LA 3UKUG 4APOA 1TNOA 4CDNA 3ZYQA 1INZA 1IYGA 2EQXA 3CK8A 3MZLB 2DBAA 3TWTA 2ZU6B 2Y4UA 5FZQA 5EYLA 3RAUA 3UIOC 1SZ9A 3D9PA 2WXLA 1MX2A 4GA1A 4EBAG 2J49A 2PNNA 4M3OA 2MOWA 3ZW3A 1DNPA 4XI9A 2MRIA 2KATA 2XPZA 4B93B 4FC8A 1UJJA 1UG3A 2R05A 4JA9A 3R7RA 4U96D 3G2VA 4TRQA 1N52A 5JHAA 2QZAA 3LYAA 3GW4A 4TV3A 4AEZC 3PEUB 3LDZA 4JL0A 1DCEA 2WB2A 4JEHA 3FU6A 4EECA 1TR4A 1FT1A 4GCOA 3FH5A 2IOLA 2LO6A 2E2EA 3ISMC 2HR2A 1SVXA 3NZSA 1O1RA 1OUVA 3FUEA 1FVHA 4LERA 2IQCA 1JCQA 3TXNA 5CCMA 5JHBA 5D66A 4EPZA 3UUXA 2P9SG 1NFIE 1TNZA 1LF8A 1BLXB 5AARA 4DPRA 3SFXA 2IONA 5G04C 2XS1A 5EIBE 2OEVA 2YINA 3ZYMA 2J9QA 3CIAA 4KBQA 5JMND 1JUQA 2RG8A 3DWLG 3DSSA 5FZSA 3CHSA 4WNEA 3QARA 4CRWA 4HNAD 3ABKE 3CKBA 3C3QA 3G2SA 2WXMA 4BWRA 5KWDA 4W9RA 3D9OA 2NXPA 3HVEB 1O1SA 5AAOA 1SQMA 4GU5A 1HG2A 2PQRA 2UWJG 3ZHEA 1TNYA 3SFYA 4B94A 4BTAA 2VSYA 2J8SD 1TJCA 3I4GA 4PS7A 2GRQB 3AG2E 3PZ3A 1EDUA 4I2ZA 2QYUA 1XNFA 1S70B 3Q73A 5M72A 4CEMA 3EIQC 2VGXA 1EPUA 4ILIA 2GRPB 2KC7A 3FUIA 4N3AA 1SA4A 1LD7A 3U66A 4JHRA 3TL5A 2CG2A 5AQ7A 4HBDA 2UY1B 2L0IA 3IXEA 4UUCA 3DPYA 4AJWA 5B1BE 5JA4D 3CVQA 4F3VA 2DIWA 1NL4A 3D9HA 1QBQA 1ELRA 4JA7A 1S64A 4HI9A 3DXKG 2IOSA 4GMRA 1SA5A 4U8VD 2XPIA 5B3SE 2C0LA 4ANXA 2WXNA 2ZISA 4B8AA 1HF8A 4N39A 1BPOA 3ML9A 1V55E 5ARGA 3U4TA 1H2VC 3AG3E 2L6JA 3ZFWA 4UWLA 4H7XA 2BF0X 3QWPA 3B7SA 1GW6A 2AW6A 2HO1A 3C3RA 3V30A 2BEDA 4I6JA 4GPMA 3IBEA 4B8CB 4EZLA 3FTSA 1H6PA 3VLEA 2LSVA 3ASHA 4BSXA 2R59A 4KMOA 3AS8A 4AV7A 3CEQA 4Z68A 3NQPA 2V5QC 1NA3A 2DYSE 4TUMA 2ZIRA 1N94A 1Q2ZA 5AJLA 4G8KA 2VSNA 3MGBA 2P9LG 4F7AA 3Q9NC 3TGOA 2A5UA 3CVUA 2WXOA 3Q78A 5AYWD 2VSXE 3AS5A 3TJPA 3DSUA 3UM1A 2XGOA 1E8ZA 3NOGD 4JZYA
chains in the Genus database with same CATH topology
3PZ1A 1JCRA 2R2LA 4YDOA 3DRAA 1NL4A 3SFXA 1N4SA 2IEJA 1QBQA 1TN8A 1S64A 3HXCA 1N9AA 1SA5A 3DSSA 4LNGA 4GTTA 1O5MA 1MZCA 3HXDA 1TNOA 3DSVA 2ZISA 1KZPA 4LNBA 3DSTA 3DSWA 2F0YA 3KSQA 1FT2A 3Q7AA 4YDEA 1N95A 1O1SA 1N4RA 4L9PA 3HXBA 1TNYA 3SFYA 3EUVA 2H6GA 1LTXA 2BEDA 3E33A 1NI1A 3E32A 4GTMA 3C72A 1N4PA 3E30A 2H6IA 3E37A 4GTOA 4EHMA 1TN6A 3DSXA 3HXEA 1JCSA 3KSLA 3PZ3A 4GTPA 3Q79A 1TNBA 1DCEA 3PZ2A 1D8EA 1D8DA 1S63A 4GTQA 1KZOA 3Q73A 1O1TA 1FT1A 1TNUA 3Q75A 2ZIRA 1N94A 1TN7A 3Q7FA 1FPPA 4GTRA 4MBGA 3EU5A 1X81A 1SA4A 3HXFA 4GTSA 4GTVA 1LD7A 1O1RA 1JCQA 1LD8A 3Q78A 1N4QA 3E34A 3DSUA 3PZ4A 2H6FA 1TNZA 3DPYA 2H6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ1 A;  1JCR A;  2R2L A;  4YDO A;  3DRA A;  1NL4 A;  3SFX A;  1N4S A;  2IEJ A;  1QBQ A;  1TN8 A;  1S64 A;  3HXC A;  1N9A A;  1SA5 A;  3DSS A;  4LNG A;  4GTT A;  1O5M A;  1MZC A;  3HXD A;  1TNO A;  3DSV A;  2ZIS A;  1KZP A;  4LNB A;  3DST A;  3DSW A;  2F0Y A;  3KSQ A;  1FT2 A;  3Q7A A;  4YDE A;  1N95 A;  1O1S A;  1N4R A;  4L9P A;  3HXB A;  1TNY A;  3SFY A;  3EUV A;  2H6G A;  1LTX A;  2BED A;  3E33 A;  1NI1 A;  3E32 A;  4GTM A;  3C72 A;  1N4P A;  3E30 A;  2H6I A;  3E37 A;  4GTO A;  4EHM A;  1TN6 A;  3DSX A;  3HXE A;  1JCS A;  3KSL A;  3PZ3 A;  4GTP A;  3Q79 A;  1TNB A;  1DCE A;  3PZ2 A;  1D8E A;  1D8D A;  1S63 A;  4GTQ A;  1KZO A;  3Q73 A;  1O1T A;  1FT1 A;  1TNU A;  3Q75 A;  2ZIR A;  1N94 A;  1TN7 A;  3Q7F A;  1FPP A;  4GTR A;  4MBG A;  3EU5 A;  1X81 A;  1SA4 A;  3HXF A;  4GTS A;  4GTV A;  1LD7 A;  1O1R A;  1JCQ A;  1LD8 A;  3Q78 A;  1N4Q A;  3E34 A;  3DSU A;  3PZ4 A;  2H6F A;  1TNZ A;  3DPY A;  2H6H A; 
#chains in the Genus database with same CATH topology
 4GZD A;  5LFA A;  3RK6 A;  2VQ2 A;  3ZKJ A;  4Q96 A;  3CVX A;  4K5B A;  4WAF A;  3B7B A;  4D10 C;  5CED B;  3FTZ A;  3ULE G;  3FHE A;  2WXI A;  1MYO A;  2IJG X;  1H6O A;  2ZGD A;  2FBN A;  1OCO E;  1VDY A;  2JAB A;  3LJN A;  2ZGG A;  1ZBP A;  2DZN A;  4DLQ A;  3NBN B;  2WQ7 A;  3CVP A;  1QZ2 A;  3OXG A;  4O60 A;  3CHO A;  2JEK A;  5CHE E;  4APF A;  1JPL A;  3CVV A;  4I43 A;  5BW8 C;  5HQ8 A;  3TG5 A;  1NI1 A;  2GRR B;  3C72 A;  4GZ6 A;  5AN8 A;  2H6I A;  3J5Q B;  3QAQ A;  3L6A A;  3BG0 B;  4JVS A;  3C3O A;  3B95 A;  1RW2 A;  1D8E A;  3FTV A;  1S63 A;  3SNX A;  3UTM A;  3Q75 A;  1V54 E;  3DEP A;  5JJ6 A;  4GCN A;  3QWV A;  1UN8 A;  3EU5 A;  3UQ3 A;  4GYY A;  4DI3 A;  3WXX A;  3AU5 A;  4L1B A;  4F53 A;  3PEV B;  4GA2 A;  3X2Q E;  4JW1 A;  2WXK A;  4BEP A;  2XRZ A;  2V8S E;  1MX6 A;  4RLY A;  2JLB A;  4YND A;  4WUY A;  1HG5 A;  3I5P A;  3NF1 A;  4U0U A;  2P58 C;  2PZI A;  3TWW A;  5EX3 A;  1UN9 A;  3CV0 A;  3CK9 A;  5E76 A;  3SFZ A;  1MHQ A;  3FTU A;  2AXU A;  4GZ5 A;  3BG1 B;  3PE3 A;  4GTT A;  4CDR A;  1MX4 A;  4HLE A;  2J4B A;  2CG3 A;  2I1J A;  1KZP A;  4DX1 A;  3CKC A;  4E6H A;  4N3C A;  3Q7A A;  1K1A A;  2PL2 A;  3UKR G;  4HQD A;  1Z3Y A;  3HXB A;  1WAO 1;  3VLF A;  2XS8 A;  4ACK A;  4A3T A;  1EYH A;  3ONK A;  4N2S A;  5CBN A;  3EIJ A;  4J8Y A;  3MKQ B;  2XEH A;  3UM3 A;  5LX8 A;  1DCQ A;  4MKT A;  4G8L A;  4EZJ A;  3WG7 E;  3UIP C;  2P9K G;  2CHZ A;  1PY1 A;  3MCX A;  1H6K A;  3FUN A;  4PUC A;  1XGW A;  3G2T A;  4JXT A;  2XRY A;  3LY8 A;  3MV3 B;  3I3N A;  4WNG A;  2Y3A A;  3CST A;  4JPS A;  3LPZ A;  5ENR D;  4DJA A;  3ZXS A;  3OAW A;  3PNT B;  2V4H C;  1HS6 A;  2LXM A;  3AAA C;  1WDY A;  2RFA A;  2BKK B;  2DVW A;  4AP2 A;  2EIL E;  1E90 A;  5CER B;  4AY5 A;  3FDH A;  3ZYL A;  1U3D A;  2GRN B;  4J7W A;  5EIL A;  2DWZ A;  3RIB A;  4E85 A;  1TEZ A;  4BX8 A;  2IEJ A;  1P5Q A;  1ELK A;  3ZVV A;  2V5F A;  4WNF A;  2HM8 A;  4NAC A;  3NB2 A;  1JWG A;  3N71 A;  4YDY A;  1OWN A;  4BER A;  4BFR A;  3ZGQ A;  2CHX A;  1OXJ A;  3JQ0 A;  3E4B A;  3FWV A;  4LRZ A;  2LXL A;  1QNF A;  3VTY A;  4UI9 C;  3E33 A;  2OOE A;  4KT6 B;  3E32 A;  4GTM A;  3FUL A;  4UWK A;  1E7U A;  1NP7 A;  3SZ7 A;  5KJM A;  1Y6I A;  4U63 A;  4GZ3 A;  5DIZ A;  4HB5 A;  5DBK A;  2I2O A;  2XHE A;  4O6F A;  4GZC A;  3ASF A;  4GTR A;  3DXM G;  3Q49 B;  3DBS A;  1DVP A;  4UWH A;  1KPS B;  4J6I A;  2P9P G;  4N5C A;  5H7P A;  4DX2 A;  5EKQ D;  2J07 A;  3K9I A;  3ZN3 A;  3JXJ A;  3PZ4 A;  1HO8 A;  3GZ2 A;  3OXF A;  4FHJ A;  2R02 A;  2C0M A;  4DRX E;  4HLL A;  3CVW A;  4ANU A;  1ZB1 A;  4YVQ C;  4LCT A;  5AIJ A;  2L6B A;  4HRM B;  3AJI A;  3UT4 A;  3GZS A;  5HI7 A;  3UX4 A;  2F8Y A;  2Y0B G;  5E75 A;  5HRY A;  2R17 C;  3ASG A;  3EUV A;  3PH0 C;  1N0Q A;  1HZ4 A;  1E8X A;  2FF4 A;  3TWU A;  3JXI A;  2HYZ A;  4C48 B;  4I2W A;  1AWC B;  2FEZ A;  3FUH A;  3R9A B;  2EIN E;  4G23 A;  3G2W A;  3APD A;  1JCS A;  4Y6W A;  4C9B B;  3TXM A;  4I1O B;  4Q94 A;  4U95 D;  3ZPJ A;  4DX7 D;  5ANL A;  3KEA A;  4DX6 D;  3NOC D;  4LNU D;  3SBT B;  4YVO A;  4GTV A;  2VYI A;  3IHV A;  4ANW A;  3ZYK A;  3L16 A;  3VLD A;  1LD8 A;  3T8M A;  5AJD A;  4IRU A;  2PM7 A;  3BEE A;  4J8E A;  4BET A;  3ASO E;  3I4R B;  4ACL A;  1MJ0 A;  2WXG A;  2P9I G;  2DYR E;  4PDX A;  4BTB A;  4EBA A;  3R7Q A;  3CK7 A;  4FP7 A;  2OVF A;  4I6E A;  5D2M C;  4HVB A;  4G24 A;  4KXK B;  2Y4T A;  3MA5 A;  4LNB A;  3DPD A;  5ENN A;  3FU3 A;  4G26 A;  3FU5 A;  4HOU A;  2WXP A;  3CVY A;  2P9N G;  1RZ4 A;  3HYM B;  4ABN A;  4ATG A;  4JHK A;  4URK A;  3HG0 D;  4GPK A;  2P9U G;  3D9J A;  5T4Y A;  3GZ1 A;  3UI2 A;  4IYP A;  4U8H A;  3QNK A;  2AXZ A;  5FQ8 A;  1TN6 A;  5LP0 A;  3PUK A;  3VTX A;  2I1K A;  2ZXW E;  2AVP A;  2LSU A;  2EIM E;  2X6H A;  1MQS A;  3SBS A;  5J08 A;  3D9N A;  4IN3 B;  3FUD A;  4GYO A;  5BV1 A;  2V4L A;  3C5R A;  4A1G A;  5BT1 A;  2WQ6 A;  1E8W A;  4FJZ A;  4NIK A;  5JJ7 A;  2B6C A;  3B7R L;  4JD2 G;  3ABL E;  3EU9 A;  3SO8 A;  1IHG A;  2DZO A;  3EHN A;  3FEY A;  2R2L A;  4A63 B;  5CRV A;  2OV8 A;  2FI7 A;  1Z5S C;  2IO2 C;  4NRH B;  1H0A A;  3FUJ A;  2I9C A;  1HX8 A;  1N9A A;  1H2T C;  3DSV A;  3QB2 A;  3O48 A;  4FLH A;  3DSW A;  2IFU A;  5ANR A;  4BX9 A;  4JHJ A;  4JEU A;  3S7J A;  1WY6 A;  2LNI A;  1TJF A;  2VTB A;  2YQ8 A;  5LOZ A;  3ESL A;  3L17 A;  4I1A A;  4N5Q A;  4KVM A;  2UY1 A;  4FUL A;  4CCA A;  2L9B A;  4NQ0 A;  3MEK A;  4A1S A;  3ASN E;  3HHM A;  4ME2 A;  4KVO A;  5ENT D;  4R7L A;  4B89 A;  3RRU A;  1ZU2 A;  2GRO B;  3BU8 A;  5CEC B;  1OWL A;  1B89 A;  3LY9 A;  3D9K A;  5KJK A;  3PZD A;  4NUR A;  3QK0 A;  3UMV A;  2RKK A;  1FCH A;  5BXU A;  1NA0 A;  3TG4 A;  2RFM A;  3QOU A;  2RD0 A;  5KCM A;  1N54 A;  5G05 J;  1DC2 A;  4I6G A;  4LSZ E;  1N11 A;  4FLB A;  1N4S A;  2YHC A;  4C0E A;  4OVV A;  5ARF A;  2WQH A;  3Q4A B;  3CGH A;  5KJN A;  3L22 A;  3CHR A;  2PQN A;  2NYJ A;  4HS2 A;  5A7D B;  1FVF A;  3Q9U C;  5B1A E;  1MZC A;  5G2N A;  3AS4 A;  4MS6 A;  3ZHE B;  5J90 A;  1BI7 B;  4LEU A;  1BD8 A;  2XQ0 A;  3DST A;  1HU3 A;  4HXI A;  3CVN A;  2F0Y A;  2A5E A;  1FT2 A;  4OAV B;  4AY6 A;  1JWF A;  4N3B A;  3IV0 A;  4L2Y A;  4L9P A;  4J0U A;  3RRM B;  2ETC A;  3L82 A;  3HRA A;  2X6J A;  4WWO A;  2QFC A;  1OY3 D;  1HFA A;  4ATZ D;  3JQ1 A;  2MYO A;  1AP7 A;  5C2Y A;  2IY0 C;  1K8K G;  5FZR A;  4WWP A;  5AQA A;  1WM5 A;  4G1T A;  3UM0 A;  4J8S A;  4CYM D;  4CGV A;  1OWM A;  4WWN A;  4KZC A;  2ILR A;  2X38 A;  4AVX A;  2XGS A;  2HE0 A;  3ENE A;  1O1T A;  1TNU A;  4J8D A;  1TN7 A;  4JC8 A;  4MLP A;  3MX3 A;  1FPP A;  2WXJ A;  2KCV A;  3MJW A;  4K5C A;  1KT0 A;  3L13 A;  4ILG A;  5BNW A;  3ZRH A;  5KNH D;  2KZT B;  4BES A;  1N4Q A;  2QY7 A;  4LUN U;  2FO1 E;  4ZFH A;  1K1B A;  2H6H A;  4CT0 A;  4DUI A;  4BT8 A;  1JCR A;  1BU9 A;  2VJ8 A;  2PM6 A;  4L23 A;  2KZT A;  1OCR E;  3JCK C;  4O1O A;  3AU4 A;  5ITZ F;  3Q47 B;  3UM2 A;  3T5X A;  3Q15 A;  2M63 A;  4XKB A;  5FJY A;  1N4R A;  5EYP F;  3T5V A;  2FUL A;  3L9T A;  4OAU C;  4CZ2 D;  2MHK A;  5D0Q D;  3W9G A;  3QC1 A;  3PS6 A;  5BUZ A;  2LAI A;  3E37 A;  3FFL A;  4TXP A;  4EHM A;  5LCW C;  3TWX A;  2GW1 A;  4KYO B;  2X6K A;  4O1P A;  2F37 A;  3APC A;  4WND A;  5FT9 A;  4HI8 A;  1H19 A;  4AOF A;  4YDW A;  1WG0 A;  1YYH A;  4GTP A;  4BT9 A;  5D0O D;  3NZU A;  3SHF A;  1Z3X A;  4UQY A;  2LUH A;  4A55 A;  2Y69 E;  2A4Z A;  3P1U A;  4F6R D;  4GTS A;  3HXF A;  4U07 A;  4B0Z A;  1OCZ E;  3HIZ A;  5IY5 E;  2CFU A;  2BUG A;  5CMW A;  2YNQ A;  4K5A B;  4XX5 A;  4MRU A;  5BPP A;  3TAX A;  3B7U X;  3RKV A;  4K0R A;  4DX5 D;  1TYQ G;  4GB9 A;  3D9M A;  3DRA A;  3FTW A;  3FTY A;  5EDS A;  4RVB A;  3CQG B;  4OVU A;  3MYV A;  1PC2 A;  4L7T A;  5ENO D;  1IKN D;  4PS8 A;  2VGX B;  1IHB A;  4LNG A;  4UI9 J;  4HOS A;  2VSO E;  2ETB A;  1X5B A;  5HS0 A;  4V3I A;  3U3W A;  1BI8 B;  1N95 A;  2NSZ A;  2XZT G;  2XCB A;  1HE8 A;  3LY7 A;  4U0S A;  4UWG A;  3SD5 A;  4AM9 A;  3LCA A;  3UT8 A;  3FH7 A;  2H6G A;  5CEA A;  3IHY A;  1LTX A;  4DK5 A;  3EJN A;  3Q5M A;  3W9F A;  1OCC E;  1OWO A;  4DI4 A;  5ENP D;  3FH8 A;  3V2X A;  4RG9 A;  3OTN A;  3KAE A;  2R03 A;  3LS8 A;  4J8F A;  1TNB A;  3V2O A;  3OXL A;  3S2A A;  2DCP A;  5CCL A;  4FAD A;  4HFG A;  1KT1 A;  3FUK A;  2OND A;  4EQF A;  5JJT A;  4U7E B;  5KBA A;  3SF4 A;  2WPV A;  4KZ0 A;  2VTB B;  3FP3 A;  1PAQ A;  4BSZ B;  3ULY A;  5T3R A;  3O4Z A;  5EX0 A;  3T8K A;  2AJA A;  4X8Q A;  3V79 K;  4CGW A;  4GAA A;  5EN5 D;  2EIK E;  3QWW A;  2WM9 A;  1Z6T A;  2J4D A;  3HXD A;  3U9W A;  3FU0 A;  4M7C A;  2XGM A;  4HRL A;  2WXH A;  3UXG A;  3CQC B;  1E7V A;  2XEN A;  1YMP A;  2J08 A;  3UPV A;  3F6Q A;  5ENQ D;  5LCW J;  2KBX A;  4C0M A;  3EHQ A;  3S7F A;  3APF A;  3CHP A;  3PUJ A;  3T9K A;  5FIN A;  5HKP A;  4Q69 A;  4I9C A;  3D9I A;  1E96 B;  4I1M A;  3KD7 A;  2R5S A;  5FWQ A;  1IQR A;  1IXV A;  3ESK A;  2VGY A;  3PDN A;  4GA0 A;  5AEN A;  3FUM A;  4FU3 A;  2WXF A;  5FTP A;  3LVQ E;  3PE4 A;  4P29 A;  3KSL A;  2XZD G;  3KEZ A;  3RJV A;  3UT7 A;  4UQX A;  3SGH A;  3LKU A;  2E0I A;  3LJ3 A;  4MBG A;  3D9L A;  3B7T A;  3QDN A;  1UOH A;  5EID A;  4N2Q A;  4ANV A;  5AQB A;  2X3M A;  3HVE A;  3E34 A;  3FEX A;  3UIN C;  2Y1L E;  4ILH B;  3L08 A;  3GYZ A;  4RQI A;  2AXV A;  3CR3 A;  3RO3 A;  3S7B A;  4I17 A;  4JB8 P;  4QFV A;  1TN8 A;  4I9E A;  3HXC A;  1ELW A;  5G04 J;  2GRL A;  3BUA A;  2L0T B;  4CT4 A;  2Q7F A;  1O5M A;  1SW6 A;  1IQU A;  3CHQ A;  2CFZ A;  2WXQ A;  4XE0 A;  2WMO A;  3J5P A;  3ULQ A;  3PVL A;  2KXP C;  3DEO A;  4HOT A;  1A17 A;  4F1S A;  3NAW A;  5KJL A;  4AXH A;  3E30 A;  2KM4 A;  3AG4 E;  3ONL A;  4RSY A;  4TXQ A;  4FA6 A;  2IF4 A;  3PRE A;  1SZA A;  2B0O E;  1QQE A;  2BTD A;  2KCK A;  3HDX A;  3C98 A;  2VGE A;  1UJK A;  4XZ4 A;  4UWF A;  3PZ2 A;  1D8D A;  5A6C A;  2GGF A;  4PS3 A;  1EF1 C;  3QJZ A;  4HRN A;  4BY6 A;  3RRN B;  4XEI G;  2XEV A;  5FQ6 A;  4XI0 A;  3FTX A;  3MV2 B;  4QQI A;  1G3N B;  3JUI A;  2H6F A;  3U64 A;  4EZK A;  3TWV A;  3PNL B;  4YDO A;  3D3M A;  4U8Y D;  3ZEF A;  1OWP A;  4K03 A;  2P2C P;  4UQZ A;  3TWR A;  5G55 A;  4AIF A;  1A5E A;  4GYW A;  1HXI A;  2FO7 A;  2F8X K;  3JYS A;  5CMY A;  4PH4 B;  5CBO A;  3KSQ A;  3LVR E;  5KNG A;  4LG6 A;  4YDE A;  3URZ A;  4XKC A;  4XIF A;  2EIJ E;  1U3C A;  4G25 A;  4TXR A;  3JUE A;  2IU1 A;  2XPY A;  3PRZ A;  1W3B A;  2AWI A;  1D9S A;  5T8I A;  4CDM A;  2J09 A;  3FY4 A;  3RO2 A;  3EHM A;  2LAH A;  3FUF A;  3ZNG A;  1N4P A;  3EDT B;  3RSE G;  1N0R A;  3RU0 A;  3SI5 A;  5FQ4 A;  3CSF A;  4L2L A;  4G11 A;  4GMJ A;  3Q79 A;  1S0P A;  1KZO A;  5CRU A;  4HOR A;  1H2U A;  3Q7F A;  3ZU7 B;  5BXO A;  2YHE A;  3EHR A;  4OYS A;  1OT8 A;  2QC9 A;  5ENS D;  2KCL A;  3QKY A;  3ABM E;  4DLO A;  2V0P A;  1U2V G;  2QYJ A;  2OCC E;  2IO3 C;  2XCC A;  3AG1 E;  5G05 C;  4GML A;  1YCS B;  3IEG A;  2I6H A;  3KS2 A;  3ZUV B;  1NZN A;  3IKO B;  4IUL A;  3LEW A;  4H7Y A;  2XEE A;  4G2V A;  3BQO A;  3MKR A;  3P2B A;  4FHK A;  1L5J A;  5BV0 A;  3ZIM A;  3TWS A;  3CVL A;  3CLJ A;  3ASD A;  1HH8 A;  2BKG A;  3ML8 A;  4U04 A;  4TUU A;  2NC9 A;  2ETA A;  2CHW A;  5AQ9 A;  4Y6C A;  1E8Y A;  4GTO A;  1KLX A;  3B13 A;  3HXE A;  3DSX A;  2X6F A;  4F1P A;  3SY2 A;  4ZHB A;  5A23 A;  5FIO A;  2WVI A;  5FQ7 A;  3SQV A;  5C1D A;  3S7D A;  4GTQ A;  3MKQ A;  3LXU X;  2OEW A;  1K3Z D;  1X81 A;  1QYM A;  3CHM A;  1UW4 B;  1Y8M A;  2OVB A;  2WMN A;  3ZXP A;  4FJY A;  3L54 A;  4U0Z A;  1YA0 A;  3TWQ A;  4HOQ A;  3G2U A;  3PZ1 A;  4UI9 K;  2GRM A;  2X6I A;  2WXR A;  4RG6 A;  3R9M A;  4A3V A;  3V31 A;  2C2L A;  3UKU G;  4APO A;  1TNO A;  4CDN A;  3ZYQ A;  1INZ A;  1IYG A;  2EQX A;  3CK8 A;  3MZL B;  2DBA A;  3TWT A;  2ZU6 B;  2Y4U A;  5FZQ A;  5EYL A;  3RAU A;  3UIO C;  1SZ9 A;  3D9P A;  2WXL A;  1MX2 A;  4GA1 A;  4EBA G;  2J49 A;  2PNN A;  4M3O A;  2MOW A;  3ZW3 A;  1DNP A;  4XI9 A;  2MRI A;  2KAT A;  2XPZ A;  4B93 B;  4FC8 A;  1UJJ A;  1UG3 A;  2R05 A;  4JA9 A;  3R7R A;  4U96 D;  3G2V A;  4TRQ A;  1N52 A;  5JHA A;  2QZA A;  3LYA A;  3GW4 A;  4TV3 A;  4AEZ C;  3PEU B;  3LDZ A;  4JL0 A;  1DCE A;  2WB2 A;  4JEH A;  3FU6 A;  4EEC A;  1TR4 A;  1FT1 A;  4GCO A;  3FH5 A;  2IOL A;  2LO6 A;  2E2E A;  3ISM C;  2HR2 A;  1SVX A;  3NZS A;  1O1R A;  1OUV A;  3FUE A;  1FVH A;  4LER A;  2IQC A;  1JCQ A;  3TXN A;  5CCM A;  5JHB A;  5D66 A;  4EPZ A;  3UUX A;  2P9S G;  1NFI E;  1TNZ A;  1LF8 A;  1BLX B;  5AAR A;  4DPR A;  3SFX A;  2ION A;  5G04 C;  2XS1 A;  5EIB E;  2OEV A;  2YIN A;  3ZYM A;  2J9Q A;  3CIA A;  4KBQ A;  5JMN D;  1JUQ A;  2RG8 A;  3DWL G;  3DSS A;  5FZS A;  3CHS A;  4WNE A;  3QAR A;  4CRW A;  4HNA D;  3ABK E;  3CKB A;  3C3Q A;  3G2S A;  2WXM A;  4BWR A;  5KWD A;  4W9R A;  3D9O A;  2NXP A;  3HVE B;  1O1S A;  5AAO A;  1SQM A;  4GU5 A;  1HG2 A;  2PQR A;  2UWJ G;  3ZHE A;  1TNY A;  3SFY A;  4B94 A;  4BTA A;  2VSY A;  2J8S D;  1TJC A;  3I4G A;  4PS7 A;  2GRQ B;  3AG2 E;  3PZ3 A;  1EDU A;  4I2Z A;  2QYU A;  1XNF A;  1S70 B;  3Q73 A;  5M72 A;  4CEM A;  3EIQ C;  2VGX A;  1EPU A;  4ILI A;  2GRP B;  2KC7 A;  3FUI A;  4N3A A;  1SA4 A;  1LD7 A;  3U66 A;  4JHR A;  3TL5 A;  2CG2 A;  5AQ7 A;  4HBD A;  2UY1 B;  2L0I A;  3IXE A;  4UUC A;  3DPY A;  4AJW A;  5B1B E;  5JA4 D;  3CVQ A;  4F3V A;  2DIW A;  1NL4 A;  3D9H A;  1QBQ A;  1ELR A;  4JA7 A;  1S64 A;  4HI9 A;  3DXK G;  2IOS A;  4GMR A;  1SA5 A;  4U8V D;  2XPI A;  5B3S E;  2C0L A;  4ANX A;  2WXN A;  2ZIS A;  4B8A A;  1HF8 A;  4N39 A;  1BPO A;  3ML9 A;  1V55 E;  5ARG A;  3U4T A;  1H2V C;  3AG3 E;  2L6J A;  3ZFW A;  4UWL A;  4H7X A;  2BF0 X;  3QWP A;  3B7S A;  1GW6 A;  2AW6 A;  2HO1 A;  3C3R A;  3V30 A;  2BED A;  4I6J A;  4GPM A;  3IBE A;  4B8C B;  4EZL A;  3FTS A;  1H6P A;  3VLE A;  2LSV A;  3ASH A;  4BSX A;  2R59 A;  4KMO A;  3AS8 A;  4AV7 A;  3CEQ A;  4Z68 A;  3NQP A;  2V5Q C;  1NA3 A;  2DYS E;  4TUM A;  2ZIR A;  1N94 A;  1Q2Z A;  5AJL A;  4G8K A;  2VSN A;  3MGB A;  2P9L G;  4F7A A;  3Q9N C;  3TGO A;  2A5U A;  3CVU A;  2WXO A;  3Q78 A;  5AYW D;  2VSX E;  3AS5 A;  3TJP A;  3DSU A;  3UM1 A;  2XGO A;  1E8Z A;  3NOG D;  4JZY A; 
#chains in the Genus database with same CATH homology
 3PZ1 A;  1JCR A;  2R2L A;  4YDO A;  3DRA A;  1NL4 A;  3SFX A;  1N4S A;  2IEJ A;  1QBQ A;  1TN8 A;  1S64 A;  3HXC A;  1N9A A;  1SA5 A;  3DSS A;  4LNG A;  4GTT A;  1O5M A;  1MZC A;  3HXD A;  1TNO A;  3DSV A;  2ZIS A;  1KZP A;  4LNB A;  3DST A;  3DSW A;  2F0Y A;  3KSQ A;  1FT2 A;  3Q7A A;  4YDE A;  1N95 A;  1O1S A;  1N4R A;  4L9P A;  3HXB A;  1TNY A;  3SFY A;  3EUV A;  2H6G A;  1LTX A;  2BED A;  3E33 A;  1NI1 A;  3E32 A;  4GTM A;  3C72 A;  1N4P A;  3E30 A;  2H6I A;  3E37 A;  4GTO A;  4EHM A;  1TN6 A;  3DSX A;  3HXE A;  1JCS A;  3KSL A;  3PZ3 A;  4GTP A;  3Q79 A;  1TNB A;  1DCE A;  3PZ2 A;  1D8E A;  1D8D A;  1S63 A;  4GTQ A;  1KZO A;  3Q73 A;  1O1T A;  1FT1 A;  1TNU A;  3Q75 A;  2ZIR A;  1N94 A;  1TN7 A;  3Q7F A;  1FPP A;  4GTR A;  4MBG A;  3EU5 A;  1X81 A;  1SA4 A;  3HXF A;  4GTS A;  4GTV A;  1LD7 A;  1O1R A;  1JCQ A;  1LD8 A;  3Q78 A;  1N4Q A;  3E34 A;  3DSU A;  3PZ4 A;  2H6F A;  1TNZ A;  3DPY A;  2H6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...