3EUVA

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10, w102t, y154t) in complex with biotingpp
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
315
structure length
315
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 132
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3euvA00
1D8EA 3EUVA 1MZCA 1TNYA 4GTOA 4YDEA 1TN7A 1N4SA 3E33A 3Q73A 3PZ3A 1LTXA 3SFXA 1O1TA 1QBQA 1D8DA 2H6GA 3DSSA 1O5MA 2IEJA 2BEDA 1TNBA 1X81A 1TNUA 4YDOA 3HXDA 3HXFA 1SA5A 3Q7AA 3DSUA 3EU5A 3E30A 1SA4A 3PZ2A 2H6HA 4GTMA 1FT2A 3DSTA 1JCSA 2H6FA 1N4QA 3HXCA 3E34A 2ZIRA 1O1RA 4L9PA 1TNOA 3E37A 4LNBA 1TN8A 3Q75A 3DSVA 3E32A 3KSLA 3Q7FA 1DCEA 4GTPA 3DSXA 3KSQA 2ZISA 1N9AA 1N4RA 2R2LA 3PZ1A 3DSWA 3HXBA 4GTTA 2F0YA 1LD7A 1N4PA 1JCQA 3C72A 4LNGA 1N94A 1NI1A 3DRAA 1TN6A 1O1SA 4EHMA 1LD8A 1NL4A 4GTQA 4GTSA 1N95A 1TNZA 4GTVA 1S64A 1S63A 4GTRA 4MBGA 3HXEA 1KZPA 1KZOA 3Q79A 1JCRA 3DPYA 3SFYA 1FPPA 3Q78A 2H6IA 3PZ4A 1FT1A
chains in the Genus database with same CATH superfamily
3SFZA 3JQ1A 4GB9A 4GTOA 2CFZA 2XRYA 3EHMA 1LTXA 1QBQA 3GZ1A 1TNBA 4PUCA 2L6BA 3S2AA 1H6KA 4G23A 1UJKA 3DSTA 4J8SA 4W9RA 2OV8A 5G05J 4L9PA 4HOSA 3BEEA 4I6JA 3GYZA 3JXIA 4AJWA 3Q7FA 5JHBA 5AAOA 4EBAA 3UUXA 4N3CA 4ZHBA 4JD2G 3JUEA 5EKQD 4WUYA 1JCQA 3SI5A 4DX2A 2XPZA 3R9AB 4EHMA 2A5EA 1KT1A 2VSXE 2DZOA 2L0IA 1OWOA 4GCOA 1TJFA 1PAQA 4EECA 2KXPC 4IN3B 4HRMB 3SBSA 5LOZA 2WMNA 4GZ6A 5EIBE 2UWJG 4XKCA 3FTSA 3PNTB 1YA0A 3KD7A 5B1BE 3O48A 2Y1LE 1O1TA 3LYAA 4ACLA 3ZGQA 2IEJA 3D9PA 5A7DB 5EYPF 1SQMA 3HXDA 4L1BA 5J90A 1HXIA 1JWFA 2QY7A 3W9FA 1H2TC 3ZYLA 3E30A 3QC1A 5CBOA 4B8AA 3N71A 5CEDB 4BSZB 4OAUC 5CRVA 2P9UG 2VSYA 2ETBA 2WB2A 1OCZE 3HG0D 3TG4A 1Q2ZA 4HRLA 3LEWA 4WWPA 3AG4E 3RRMB 2KBXA 4N2QA 4B89A 4N5CA 2BF0X 4AIFA 1S70B 4G25A 2P9NG 4J8DA 1NZNA 1E8XA 2GGFA 4GTTA 4NQ0A 1S0PA 4ILHB 3R7RA 2GROB 3FTVA 1LD8A 4GTQA 3ULQA 2PZIA 2L0TB 2Y0BG 4XI0A 3F6QA 1N11A 2FI7A 2E2EA 2X6FA 4O1OA 1BI8B 1B89A 2I6HA 1S64A 5HRYA 4U0UA 5AENA 1P5QA 1V55E 2YINA 5G2NA 3FUEA 2WXOA 4C0EA 1FPPA 4PS8A 1E7VA 5E76A 4JXTA 2IOLA 2NC9A 3BU8A 3QWPA 5FINA 5BT1A 4LRZA 4Y6WA 1IHGA 4GMLA 5ANRA 1MZCA 3SD5A 1UJJA 1QYMA 1N54A 3SFXA 1HF8A 4I9CA 5KJKA 3CK7A 1EPUA 4Q96A 2YHEA 1WAO1 4BERA 3ZFWA 4NIKA 5CHEE 4DLOA 1MYOA 3NBNB 5CEAA 5EILA 4CGWA 3EIQC 2BKGA 3AAAC 2RD0A 3KS2A 5CBNA 1BLXB 4L2YA 4A1SA 5A23A 3ESLA 5ENOD 3V2OA 4Q94A 3DSXA 2XENA 3P1UA 2X3MA 3BQOA 5D0OD 4CEMA 4EQFA 5FWQA 2DIWA 5AJDA 5T3RA 2XPIA 1H6PA 2VTBA 3UPVA 3JQ0A 4EBAG 1E8YA 1TYQG 2LO6A 3ENEA 4I6EA 3G2WA 2V5FA 5AQBA 4U8HA 3UMVA 1UN8A 2XGSA 3L22A 2FEZA 4CZ2D 4TUMA 2GRRB 4HNAD 2KCKA 4GAAA 2LSVA 3L08A 3C3RA 3SFYA 4GZ3A 2WVIA 2WXFA 4ILIA 1ELRA 2WPVA 3TGOA 2P9IG 2OVFA 1MJ0A 3D9OA 2B0OE 4KZCA 3FUIA 3GW4A 3B7TA 3HVEA 3L17A 2X6JA 2V4LA 4G8LA 2EIME 2VGEA 3C5RA 2BEDA 3LJNA 2CHZA 1HZ4A 2MYOA 3Q7AA 3DSUA 2Y4UA 5EX3A 4NACA 2X6IA 2NSZA 1NFIE 1Z5SC 2GRQB 1ZB1A 4JHKA 2LXLA 3PVLA 5C1DA 5FZQA 1N52A 1WDYA 3RO3A 3QDNA 3CVYA 3MKRA 2Q7FA 2XS1A 3HXBA 3MEKA 3ONLA 2WXHA 1N4PA 4OVUA 2HYZA 2XCBA 4HLEA 4MKTA 3AU5A 3FDHA 1KPSB 5AJLA 2VTBB 1K1BA 2IO2C 5BXUA 4I6GA 3MX3A 3HXEA 3QKYA 4K5CA 1OY3D 5FZSA 4DK5A 3Q79A 1AWCB 3OXFA 1N0QA 2H6IA 5FIOA 2HO1A 2GRPB 2MOWA 3MGBA 3AG1E 3EUVA 4WNFA 3UX4A 3VLEA 3D9NA 1OWNA 3HVEB 3PUJA 3IEGA 3OTNA 3DSSA 3UM2A 3IBEA 3UKRG 3S7JA 1QNFA 3QK0A 5D2MC 3PEVB 4U8VD 4GTMA 4HS2A 3NF1A 4YDWA 2H6FA 2F8XK 5FZRA 3RK6A 3O4ZA 1ZBPA 4KVOA 2OCCE 2DZNA 2R05A 4EZLA 4KYOB 4I17A 3Q47B 3V30A 2P2CP 2IY0C 1LF8A 2XQ0A 3LDZA 3MA5A 2CHXA 2CG2A 2BUGA 4BFRA 4I43A 2WXKA 3CQGB 2DYRE 2KC7A 2XEVA 3T5VA 2X6HA 2ZXWE 5EN5D 4PS3A 3TWVA 3LVRE 3B13A 2J08A 4BTAA 2RFAA 4O1PA 5HQ8A 2XZDG 4ILGA 5HKPA 2FBNA 3I5PA 2HR2A 3ZEFA 2E0IA 5LCWJ 4RG6A 3DEPA 1UN9A 2R59A 4XZ4A 4LG6A 3FH7A 2HE0A 3URZA 5KNHD 4ATZD 4U95D 4BESA 2J4BA 4OYSA 3PZ3A 3QWWA 4DX1A 2JLBA 3CVQA 3DXMG 2H6GA 3SBTB 4N3AA 2FF4A 1IQRA 3APFA 4P29A 4YDOA 2LAIA 5FT9A 4BETA 4ABNA 3EJNA 3SGHA 1BPOA 1QZ2A 3DBSA 2BTDA 4FLHA 5DBKA 5BV1A 5EX0A 5G05C 1HS6A 2X6KA 2IO3C 4FJZA 4UUCA 4CT4A 1HU3A 1K8KG 2AWIA 3KSLA 4CDMA 3MJWA 3V79K 4EPZA 1E8ZA 1N4RA 4WNGA 3T5XA 1MQSA 4F3VA 3NAWA 5JHAA 4JZYA 3LVQE 2AJAA 4DX7D 4RQIA 4GZ5A 1O1SA 1NL4A 3VLFA 5KJMA 3RKVA 1U3CA 5B3SE 2L6JA 2NXPA 5B1AE 4FC8A 3APCA 3T9KA 1DVPA 4UWKA 3ASDA 2IQCA 4HXIA 3DPYA 4FADA 4UWFA 2YHCA 4QQIA 4URKA 1HFAA 4GZDA 4N39A 1HH8A 3G2SA 1TNYA 5T8IA 3CVUA 2L9BA 1ELKA 1TN7A 4TXRA 3ZYMA 3UXGA 5H7PA 3NZUA 3B95A 1OCRE 4GZCA 3CHPA 2R17C 2EILE 1SA5A 3SY2A 1PC2A 1WG0A 1Y8MA 3FHEA 1D9SA 2BKKB 2IONA 4U96D 4KMOA 4I1OB 3AS5A 4BT9A 3HXCA 1XNFA 1BU9A 2LXMA 4G11A 4CYMD 3VTYA 4YNDA 4H7XA 4C9BB 3FU5A 4D10C 3NZSA 4QFVA 4DJAA 1IHBA 1E8WA 3ASOE 4ACKA 2I9CA 3FWVA 1UW4B 3AS4A 3R9MA 2XRZA 3V31A 4GPKA 3UI2A 3RRNB 3JYSA 4U7EB 4JB8P 3LKUA 2VSNA 5FQ7A 5FJYA 1QQEA 3IXEA 3C3QA 3HDXA 4AM9A 4DRXE 2PL2A 1SVXA 3FUDA 4HOUA 2VGYA 3PH0C 3EHRA 1FVHA 2Y69E 3RSEG 4C48B 3IKOB 2XHEA 3D9HA 3ABKE 1TJCA 4YDEA 3FU0A 4DI4A 2QZAA 4UQYA 4JHRA 4AY5A 2EIKE 3K9IA 4KBQA 1HX8A 1RW2A 4J8FA 4DUIA 5FQ6A 4CGVA 2CFUA 3RRUA 3D9KA 4HOQA 3ASHA 4JHJA 3Q4AB 3FH8A 4HORA 3CEQA 5AQAA 4CT0A 3TXMA 4KXKB 3E37A 5D66A 2OOEA 4I9EA 2OEWA 3LY7A 1YCSB 3KEZA 2HM8A 1DCEA 4U8YD 4ANUA 1N0RA 3RIBA 3U64A 3FUHA 4HRNA 1SZAA 4I2WA 4EZJA 3R7QA 4OAVB 2VYIA 3ZXPA 1TN6A 3EU9A 3LCAA 1A17A 4M7CA 4LERA 4APFA 2FULA 3CHMA 4CDNA 4YVQC 2M63A 2FO1E 1Z3XA 2P58C 5BW8C 1OUVA 2I2OA 4OVVA 5FQ8A 2LUHA 4HOTA 2EINE 3WG7E 1IYGA 2AW6A 2WXLA 5AQ7A 4LCTA 3UQ3A 2MRIA 1BI7B 4TXQA 2J8SD 5ENTD 5AN8A 3AU4A 3ZU7B 4FHJA 1H6OA 2H6HA 4C0MA 4HVBA 3PE4A 2J07A 4ANWA 5CRUA 3CVPA 5CCMA 1OWPA 1FCHA 1N4QA 2ONDA 1Y6IA 5KJLA 1O1RA 3BG1B 3I4GA 3RAUA 2J9QA 4NRHB 5JJ7A 3SNXA 4UWHA 3GZSA 3E32A 3HIZA 1XGWA 2AXUA 1YMPA 4G24A 3LY9A 3S7BA 3CKCA 3L13A 4HB5A 2KZTA 3NQPA 3ULYA 3JCKC 3FFLA 3OXLA 3T8MA 3IV0A 3CKBA 3V2XA 2IJGX 4GYWA 4K5BA 4G26A 3BG0B 3CK8A 4GU5A 1S63A 4GTRA 4GMJA 4MBGA 1NP7A 4M3OA 3D3MA 4V3IA 3EHQA 3PEUB 2C2LA 2JABA 1HG2A 3HRAA 3APDA 4JA7A 4CRWA 4WWNA 5JA4D 5A6CA 3TWQA 3UTMA 4N5QA 5KCMA 3E33A 1MHQA 3CVNA 4MLPA 1D8DA 4PDXA 2WXMA 3Q9NC 3U3WA 1G3NB 2I1JA 4HI8A 4K5AB 1NA3A 5KBAA 2C0MA 3X2QE 3QB2A 4AV7A 2DBAA 2ZGGA 2XEEA 3IHYA 3ESKA 1EDUA 1TN8A 4RG9A 1YYHA 2ZU6B 4UWGA 1N9AA 2DYSE 1SZ9A 3G2TA 1DCQA 4IRUA 4L23A 4F1PA 3PREA 4HI9A 5EIDA 5KWDA 1Z6TA 3C72A 2KZTB 1IKND 3TWXA 2R03A 5HI7A 1FVFA 3FUKA 5HS0A 3ASNE 5ARGA 4I2ZA 2P9LG 2PNNA 3MYVA 4A3TA 2J4DA 5JJTA 4N3BA 1TNZA 4IYPA 3ZPJA 4GCNA 4ANVA 4AP2A 4DPRA 5CERB 1GW6A 2V4HC 2PM6A 3FU3A 2ETAA 2J49A 3L9TA 3PZ4A 5LCWC 1JPLA 2KCLA 3FU6A 4TRQA 2V0PA 3B7SA 4FJYA 1E90A 3P2BA 4H7YA 2GRNB 3CIAA 4WWOA 2XPYA 5IY5E 3UT7A 4LUNU 2CHWA 1TR4A 1UG3A 1Z3YA 2DWZA 2NYJA 2MHKA 3TJPA 1E7UA 3FEYA 4PS7A 3EDTB 4IULA 3CSTA 5ANLA 4G1TA 4BSXA 1OWLA 3FY4A 1JWGA 3PZDA 4B94A 3QWVA 3ZYQA 3G2UA 4K03A 3ZW3A 3DWLG 4KT6B 2QYUA 1MX4A 3ZN3A 3CVXA 5EYLA 1BD8A 5JMND 1UOHA 3LPZA 3TWUA 2KATA 2EQXA 5ARFA 2RFMA 2FO7A 4J6IA 2ZGDA 3ZXSA 2WXQA 2F37A 4B93B 2A4ZA 2V8SE 4O60A 2CG3A 3MV3B 3AS8A 1OCOE 2V5QC 3LJ3A 1KZOA 3BUAA 4Q69A 5ITZF 5KNGA 2WQ6A 5FQ4A 2DVWA 3B7RL 4B0ZA 1EF1C 5G04J 3MZLB 3ML9A 3Q49B 3S7FA 3LXUX 4TV3A 5CMYA 3FTZA 1PY1A 2ILRA 3Q73A 3FUFA 4JVSA 4WNDA 2KCVA 4CDRA 1O5MA 3AJIA 3PRZA 3CR3A 3FTXA 3CLJA 3CGHA 3FULA 1H2UA 3FUNA 4GYOA 2IOSA 2R02A 2R5SA 5AQ9A 2UY1A 3ZYKA 3TG5A 2C0LA 1L5JA 3OAWA 1H0AA 3LY8A 3HHMA 3ONKA 5CCLA 4GMRA 4UI9K 4BX8A 3DXKG 4LEUA 5M72A 3PZ1A 3DPDA 2F0YA 4YVOA 4E85A 3SF4A 1U3DA 3PUKA 5DIZA 3ML8A 3NB2A 4GTSA 2RKKA 2LSUA 3QNKA 1H2VC 1OT8A 4L7TA 4DI3A 3J5QB 4J8YA 1KZPA 3VLDA 5LP0A 3L54A 4A1GA 4R7LA 3RU0A 4APOA 3Q78A 4I1MA 1WM5A 2WXNA 4JEHA 2WM9A 2PQNA 4J8EA 4U63A 2AXVA 4AY6A 2GW1A 3ABME 2WXIA 1DNPA 4JEUA 3UT4A 5AIJA 2WXJA 3ZRHA 3B7BA 3SQVA 3ZKJA 4BTBA 3CK9A 1VDYA 2YQ8A 4E6HA 1MX2A 1A5EA 2B6CA 2GRLA 3ZNGA 2VJ8A 3UT8A 2ZIRA 3FEXA 1TNOA 1OWMA 4F1SA 4LNBA 2UY1B 3TWRA 4XIFA 4B8CB 2F8YA 2WQHA 3Q9UC 3CVWA 3MV2B 3KSQA 4JA9A 2WQ7A 2ZISA 5D0QD 4U07A 4UQXA 3CQCB 4BX9A 3FTWA 1SW6A 4BWRA 3ZVVA 4LNGA 3EHNA 4JPSA 4U0ZA 2XEHA 4GYYA 4HQDA 1OCCE 3C98A 3D9IA 4GTVA 3UINC 3FP3A 1KLXA 4XEIG 4RVBA 3IHVA 3L82A 3C3OA 4HLLA 5CMWA 1OXJA 4KZ0A 2XZTG 1JCRA 4LSZE 4XE0A 3VTXA 3TWTA 2P9SG 2A5UA 4F53A 2JEKA 3J5PA 3FTUA 2DCPA 3SZ7A 3QARA 3ULEG 5C2YA 1X5BA 2PM7A 1RZ4A 3FTYA 3CHQA 3D9JA 4JC8A 3CVLA 1TNUA 2VGXA 4YDYA 3HXFA 4AEZC 1IQUA 3QAQA 3SHFA 4A63B 4XI9A 4F7AA 3Q15A 3PZ2A 4XKBA 3TAXA 4BT8A 3I3NA 5LFAA 4FU3A 3UIOC 2QFCA 5BV0A 4WAFA 3GZ2A 4LNUD 4GTPA 1V54E 4MRUA 2R2LA 2AXZA 3G2VA 3ABLE 2VQ2A 4UWLA 1LD7A 1N94A 1NI1A 5BPPA 1HO8A 4JW1A 4CCAA 3UM0A 3Q5MA 1N95A 3JXJA 3UKUG 3PS6A 2Y3AA 4GA0A 3S7DA 4DLQA 5BXOA 4TXPA 4N2SA 1TEZA 3KAEA 3CSFA 3ZHEA 2WMOA 3T8KA 2LAHA 3NOGD 3ISMC 3B7UX 1D8EA 2EIJE 1HE8A 4GA2A 5AYWD 4DX5D 1N4SA 3E4BA 3FUMA 5J08A 2IF4A 1X81A 3D9LA 2X38A 3PE3A 2OVBA 1U2VG 2OEVA 4O6FA 2VGXB 3TXNA 4ANXA 2QYJA 1JCSA 3E34A 1KT0A 3DEOA 5KJNA 3U9WA 4U04A 5G55A 4HFGA 1E96B 2AVPA 3RJVA 3AG3E 3DSVA 2IU1A 5ENSD 4PH4B 3TWSA 3CHSA 2J09A 1ELWA 2WXRA 3QOUA 4ME2A 2GRMA 4G8KA 1DC2A 3OXGA 1W3BA 5ENPD 3MKQA 4L2LA 3DRAA 4GPMA 1IXVA 3EIJA 3RO2A 4J7WA 5BUZA 5BNWA 1K1AA 3JUIA 5AARA 3FUJA 3QJZA 2Y4TA 4ZFHA 1EYHA 2PQRA 4GA1A 3L16A 2LNIA 3D9MA 2KM4A 4AVXA 5EDSA 2XCCA 4UI9C 5CECB 4JL0A 3U66A 4KVMA 4X8QA 4F6RD 1FT1A 4DX6D 2VSOE 4Z68A 4A55A 3ZHEB 3TL5A 5FTPA 3PNLB 1K3ZD 3WXXA 1INZA 3NOCD 3SO8A 4RLYA 3ZUVB 3FH5A 1ZU2A 2QC9A 4UI9J 3CV0A 2RG8A 5ENQD 3W9GA 1H19A 5T4YA 3I4RB 4FLBA 3EU5A 4MS6A 5JJ6A 1SA4A 4BY6A 3ASFA 1FT2A 2P9KG 4UQZA 4K0RA 3UM3A 4AXHA 3CHOA 4EZKA 4U0SA 3ASGA 2I1KA 3Q75A 5LX8A 1HG5A 2XGMA 4RSYA 4FHKA 1NA0A 2XS8A 5ENNA 4A3VA 2P9PG 2XGOA 3DSWA 3TWWA 2ETCA 2YNQA 4WNEA 4XX5A 4G2VA 3CVVA 2IFUA 4HBDA 1AP7A 4AOFA 4Y6CA 4ATGA 3LS8A 1JUQA 2WXGA 3MKQB 4J0UA 3CHRA 3UIPC 1WY6A 4BEPA 4FULA 3U4TA 4TUUA 4FP7A 4NURA 3KEAA 3HYMB 3MCXA 3PDNA 4FA6A 3UM1A 5E75A 5ENRD 3AG2E 3L6AA 1MX6A 4I1AA 2WXPA 5G04C 3ZIMA
chains in the Genus database with same CATH topology
1D8EA 3EUVA 1MZCA 1TNYA 4GTOA 4YDEA 1TN7A 1N4SA 3E33A 3Q73A 3PZ3A 1LTXA 3SFXA 1O1TA 1QBQA 1D8DA 2H6GA 3DSSA 1O5MA 2IEJA 2BEDA 1TNBA 1X81A 1TNUA 4YDOA 3HXDA 3HXFA 1SA5A 3Q7AA 3DSUA 3EU5A 3E30A 1SA4A 3PZ2A 2H6HA 4GTMA 1FT2A 3DSTA 1JCSA 2H6FA 1N4QA 3HXCA 3E34A 2ZIRA 1O1RA 4L9PA 1TNOA 3E37A 4LNBA 1TN8A 3Q75A 3DSVA 3E32A 3KSLA 3Q7FA 1DCEA 4GTPA 3DSXA 3KSQA 2ZISA 1N9AA 1N4RA 2R2LA 3PZ1A 3DSWA 3HXBA 4GTTA 2F0YA 1LD7A 1N4PA 1JCQA 3C72A 4LNGA 1N94A 1NI1A 3DRAA 1TN6A 1O1SA 4EHMA 1LD8A 1NL4A 4GTQA 4GTSA 1N95A 1TNZA 4GTVA 1S64A 1S63A 4GTRA 4MBGA 3HXEA 1KZPA 1KZOA 3Q79A 1JCRA 3DPYA 3SFYA 1FPPA 3Q78A 2H6IA 3PZ4A 1FT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8E A;  3EUV A;  1MZC A;  1TNY A;  4GTO A;  4YDE A;  1TN7 A;  1N4S A;  3E33 A;  3Q73 A;  3PZ3 A;  1LTX A;  3SFX A;  1O1T A;  1QBQ A;  1D8D A;  2H6G A;  3DSS A;  1O5M A;  2IEJ A;  2BED A;  1TNB A;  1X81 A;  1TNU A;  4YDO A;  3HXD A;  3HXF A;  1SA5 A;  3Q7A A;  3DSU A;  3EU5 A;  3E30 A;  1SA4 A;  3PZ2 A;  2H6H A;  4GTM A;  1FT2 A;  3DST A;  1JCS A;  2H6F A;  1N4Q A;  3HXC A;  3E34 A;  2ZIR A;  1O1R A;  4L9P A;  1TNO A;  3E37 A;  4LNB A;  1TN8 A;  3Q75 A;  3DSV A;  3E32 A;  3KSL A;  3Q7F A;  1DCE A;  4GTP A;  3DSX A;  3KSQ A;  2ZIS A;  1N9A A;  1N4R A;  2R2L A;  3PZ1 A;  3DSW A;  3HXB A;  4GTT A;  2F0Y A;  1LD7 A;  1N4P A;  1JCQ A;  3C72 A;  4LNG A;  1N94 A;  1NI1 A;  3DRA A;  1TN6 A;  1O1S A;  4EHM A;  1LD8 A;  1NL4 A;  4GTQ A;  4GTS A;  1N95 A;  1TNZ A;  4GTV A;  1S64 A;  1S63 A;  4GTR A;  4MBG A;  3HXE A;  1KZP A;  1KZO A;  3Q79 A;  1JCR A;  3DPY A;  3SFY A;  1FPP A;  3Q78 A;  2H6I A;  3PZ4 A;  1FT1 A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  3JQ1 A;  4GB9 A;  4GTO A;  2CFZ A;  2XRY A;  3EHM A;  1LTX A;  1QBQ A;  3GZ1 A;  1TNB A;  4PUC A;  2L6B A;  3S2A A;  1H6K A;  4G23 A;  1UJK A;  3DST A;  4J8S A;  4W9R A;  2OV8 A;  5G05 J;  4L9P A;  4HOS A;  3BEE A;  4I6J A;  3GYZ A;  3JXI A;  4AJW A;  3Q7F A;  5JHB A;  5AAO A;  4EBA A;  3UUX A;  4N3C A;  4ZHB A;  4JD2 G;  3JUE A;  5EKQ D;  4WUY A;  1JCQ A;  3SI5 A;  4DX2 A;  2XPZ A;  3R9A B;  4EHM A;  2A5E A;  1KT1 A;  2VSX E;  2DZO A;  2L0I A;  1OWO A;  4GCO A;  1TJF A;  1PAQ A;  4EEC A;  2KXP C;  4IN3 B;  4HRM B;  3SBS A;  5LOZ A;  2WMN A;  4GZ6 A;  5EIB E;  2UWJ G;  4XKC A;  3FTS A;  3PNT B;  1YA0 A;  3KD7 A;  5B1B E;  3O48 A;  2Y1L E;  1O1T A;  3LYA A;  4ACL A;  3ZGQ A;  2IEJ A;  3D9P A;  5A7D B;  5EYP F;  1SQM A;  3HXD A;  4L1B A;  5J90 A;  1HXI A;  1JWF A;  2QY7 A;  3W9F A;  1H2T C;  3ZYL A;  3E30 A;  3QC1 A;  5CBO A;  4B8A A;  3N71 A;  5CED B;  4BSZ B;  4OAU C;  5CRV A;  2P9U G;  2VSY A;  2ETB A;  2WB2 A;  1OCZ E;  3HG0 D;  3TG4 A;  1Q2Z A;  4HRL A;  3LEW A;  4WWP A;  3AG4 E;  3RRM B;  2KBX A;  4N2Q A;  4B89 A;  4N5C A;  2BF0 X;  4AIF A;  1S70 B;  4G25 A;  2P9N G;  4J8D A;  1NZN A;  1E8X A;  2GGF A;  4GTT A;  4NQ0 A;  1S0P A;  4ILH B;  3R7R A;  2GRO B;  3FTV A;  1LD8 A;  4GTQ A;  3ULQ A;  2PZI A;  2L0T B;  2Y0B G;  4XI0 A;  3F6Q A;  1N11 A;  2FI7 A;  2E2E A;  2X6F A;  4O1O A;  1BI8 B;  1B89 A;  2I6H A;  1S64 A;  5HRY A;  4U0U A;  5AEN A;  1P5Q A;  1V55 E;  2YIN A;  5G2N A;  3FUE A;  2WXO A;  4C0E A;  1FPP A;  4PS8 A;  1E7V A;  5E76 A;  4JXT A;  2IOL A;  2NC9 A;  3BU8 A;  3QWP A;  5FIN A;  5BT1 A;  4LRZ A;  4Y6W A;  1IHG A;  4GML A;  5ANR A;  1MZC A;  3SD5 A;  1UJJ A;  1QYM A;  1N54 A;  3SFX A;  1HF8 A;  4I9C A;  5KJK A;  3CK7 A;  1EPU A;  4Q96 A;  2YHE A;  1WAO 1;  4BER A;  3ZFW A;  4NIK A;  5CHE E;  4DLO A;  1MYO A;  3NBN B;  5CEA A;  5EIL A;  4CGW A;  3EIQ C;  2BKG A;  3AAA C;  2RD0 A;  3KS2 A;  5CBN A;  1BLX B;  4L2Y A;  4A1S A;  5A23 A;  3ESL A;  5ENO D;  3V2O A;  4Q94 A;  3DSX A;  2XEN A;  3P1U A;  2X3M A;  3BQO A;  5D0O D;  4CEM A;  4EQF A;  5FWQ A;  2DIW A;  5AJD A;  5T3R A;  2XPI A;  1H6P A;  2VTB A;  3UPV A;  3JQ0 A;  4EBA G;  1E8Y A;  1TYQ G;  2LO6 A;  3ENE A;  4I6E A;  3G2W A;  2V5F A;  5AQB A;  4U8H A;  3UMV A;  1UN8 A;  2XGS A;  3L22 A;  2FEZ A;  4CZ2 D;  4TUM A;  2GRR B;  4HNA D;  2KCK A;  4GAA A;  2LSV A;  3L08 A;  3C3R A;  3SFY A;  4GZ3 A;  2WVI A;  2WXF A;  4ILI A;  1ELR A;  2WPV A;  3TGO A;  2P9I G;  2OVF A;  1MJ0 A;  3D9O A;  2B0O E;  4KZC A;  3FUI A;  3GW4 A;  3B7T A;  3HVE A;  3L17 A;  2X6J A;  2V4L A;  4G8L A;  2EIM E;  2VGE A;  3C5R A;  2BED A;  3LJN A;  2CHZ A;  1HZ4 A;  2MYO A;  3Q7A A;  3DSU A;  2Y4U A;  5EX3 A;  4NAC A;  2X6I A;  2NSZ A;  1NFI E;  1Z5S C;  2GRQ B;  1ZB1 A;  4JHK A;  2LXL A;  3PVL A;  5C1D A;  5FZQ A;  1N52 A;  1WDY A;  3RO3 A;  3QDN A;  3CVY A;  3MKR A;  2Q7F A;  2XS1 A;  3HXB A;  3MEK A;  3ONL A;  2WXH A;  1N4P A;  4OVU A;  2HYZ A;  2XCB A;  4HLE A;  4MKT A;  3AU5 A;  3FDH A;  1KPS B;  5AJL A;  2VTB B;  1K1B A;  2IO2 C;  5BXU A;  4I6G A;  3MX3 A;  3HXE A;  3QKY A;  4K5C A;  1OY3 D;  5FZS A;  4DK5 A;  3Q79 A;  1AWC B;  3OXF A;  1N0Q A;  2H6I A;  5FIO A;  2HO1 A;  2GRP B;  2MOW A;  3MGB A;  3AG1 E;  3EUV A;  4WNF A;  3UX4 A;  3VLE A;  3D9N A;  1OWN A;  3HVE B;  3PUJ A;  3IEG A;  3OTN A;  3DSS A;  3UM2 A;  3IBE A;  3UKR G;  3S7J A;  1QNF A;  3QK0 A;  5D2M C;  3PEV B;  4U8V D;  4GTM A;  4HS2 A;  3NF1 A;  4YDW A;  2H6F A;  2F8X K;  5FZR A;  3RK6 A;  3O4Z A;  1ZBP A;  4KVO A;  2OCC E;  2DZN A;  2R05 A;  4EZL A;  4KYO B;  4I17 A;  3Q47 B;  3V30 A;  2P2C P;  2IY0 C;  1LF8 A;  2XQ0 A;  3LDZ A;  3MA5 A;  2CHX A;  2CG2 A;  2BUG A;  4BFR A;  4I43 A;  2WXK A;  3CQG B;  2DYR E;  2KC7 A;  2XEV A;  3T5V A;  2X6H A;  2ZXW E;  5EN5 D;  4PS3 A;  3TWV A;  3LVR E;  3B13 A;  2J08 A;  4BTA A;  2RFA A;  4O1P A;  5HQ8 A;  2XZD G;  4ILG A;  5HKP A;  2FBN A;  3I5P A;  2HR2 A;  3ZEF A;  2E0I A;  5LCW J;  4RG6 A;  3DEP A;  1UN9 A;  2R59 A;  4XZ4 A;  4LG6 A;  3FH7 A;  2HE0 A;  3URZ A;  5KNH D;  4ATZ D;  4U95 D;  4BES A;  2J4B A;  4OYS A;  3PZ3 A;  3QWW A;  4DX1 A;  2JLB A;  3CVQ A;  3DXM G;  2H6G A;  3SBT B;  4N3A A;  2FF4 A;  1IQR A;  3APF A;  4P29 A;  4YDO A;  2LAI A;  5FT9 A;  4BET A;  4ABN A;  3EJN A;  3SGH A;  1BPO A;  1QZ2 A;  3DBS A;  2BTD A;  4FLH A;  5DBK A;  5BV1 A;  5EX0 A;  5G05 C;  1HS6 A;  2X6K A;  2IO3 C;  4FJZ A;  4UUC A;  4CT4 A;  1HU3 A;  1K8K G;  2AWI A;  3KSL A;  4CDM A;  3MJW A;  3V79 K;  4EPZ A;  1E8Z A;  1N4R A;  4WNG A;  3T5X A;  1MQS A;  4F3V A;  3NAW A;  5JHA A;  4JZY A;  3LVQ E;  2AJA A;  4DX7 D;  4RQI A;  4GZ5 A;  1O1S A;  1NL4 A;  3VLF A;  5KJM A;  3RKV A;  1U3C A;  5B3S E;  2L6J A;  2NXP A;  5B1A E;  4FC8 A;  3APC A;  3T9K A;  1DVP A;  4UWK A;  3ASD A;  2IQC A;  4HXI A;  3DPY A;  4FAD A;  4UWF A;  2YHC A;  4QQI A;  4URK A;  1HFA A;  4GZD A;  4N39 A;  1HH8 A;  3G2S A;  1TNY A;  5T8I A;  3CVU A;  2L9B A;  1ELK A;  1TN7 A;  4TXR A;  3ZYM A;  3UXG A;  5H7P A;  3NZU A;  3B95 A;  1OCR E;  4GZC A;  3CHP A;  2R17 C;  2EIL E;  1SA5 A;  3SY2 A;  1PC2 A;  1WG0 A;  1Y8M A;  3FHE A;  1D9S A;  2BKK B;  2ION A;  4U96 D;  4KMO A;  4I1O B;  3AS5 A;  4BT9 A;  3HXC A;  1XNF A;  1BU9 A;  2LXM A;  4G11 A;  4CYM D;  3VTY A;  4YND A;  4H7X A;  4C9B B;  3FU5 A;  4D10 C;  3NZS A;  4QFV A;  4DJA A;  1IHB A;  1E8W A;  3ASO E;  4ACK A;  2I9C A;  3FWV A;  1UW4 B;  3AS4 A;  3R9M A;  2XRZ A;  3V31 A;  4GPK A;  3UI2 A;  3RRN B;  3JYS A;  4U7E B;  4JB8 P;  3LKU A;  2VSN A;  5FQ7 A;  5FJY A;  1QQE A;  3IXE A;  3C3Q A;  3HDX A;  4AM9 A;  4DRX E;  2PL2 A;  1SVX A;  3FUD A;  4HOU A;  2VGY A;  3PH0 C;  3EHR A;  1FVH A;  2Y69 E;  3RSE G;  4C48 B;  3IKO B;  2XHE A;  3D9H A;  3ABK E;  1TJC A;  4YDE A;  3FU0 A;  4DI4 A;  2QZA A;  4UQY A;  4JHR A;  4AY5 A;  2EIK E;  3K9I A;  4KBQ A;  1HX8 A;  1RW2 A;  4J8F A;  4DUI A;  5FQ6 A;  4CGV A;  2CFU A;  3RRU A;  3D9K A;  4HOQ A;  3ASH A;  4JHJ A;  3Q4A B;  3FH8 A;  4HOR A;  3CEQ A;  5AQA A;  4CT0 A;  3TXM A;  4KXK B;  3E37 A;  5D66 A;  2OOE A;  4I9E A;  2OEW A;  3LY7 A;  1YCS B;  3KEZ A;  2HM8 A;  1DCE A;  4U8Y D;  4ANU A;  1N0R A;  3RIB A;  3U64 A;  3FUH A;  4HRN A;  1SZA A;  4I2W A;  4EZJ A;  3R7Q A;  4OAV B;  2VYI A;  3ZXP A;  1TN6 A;  3EU9 A;  3LCA A;  1A17 A;  4M7C A;  4LER A;  4APF A;  2FUL A;  3CHM A;  4CDN A;  4YVQ C;  2M63 A;  2FO1 E;  1Z3X A;  2P58 C;  5BW8 C;  1OUV A;  2I2O A;  4OVV A;  5FQ8 A;  2LUH A;  4HOT A;  2EIN E;  3WG7 E;  1IYG A;  2AW6 A;  2WXL A;  5AQ7 A;  4LCT A;  3UQ3 A;  2MRI A;  1BI7 B;  4TXQ A;  2J8S D;  5ENT D;  5AN8 A;  3AU4 A;  3ZU7 B;  4FHJ A;  1H6O A;  2H6H A;  4C0M A;  4HVB A;  3PE4 A;  2J07 A;  4ANW A;  5CRU A;  3CVP A;  5CCM A;  1OWP A;  1FCH A;  1N4Q A;  2OND A;  1Y6I A;  5KJL A;  1O1R A;  3BG1 B;  3I4G A;  3RAU A;  2J9Q A;  4NRH B;  5JJ7 A;  3SNX A;  4UWH A;  3GZS A;  3E32 A;  3HIZ A;  1XGW A;  2AXU A;  1YMP A;  4G24 A;  3LY9 A;  3S7B A;  3CKC A;  3L13 A;  4HB5 A;  2KZT A;  3NQP A;  3ULY A;  3JCK C;  3FFL A;  3OXL A;  3T8M A;  3IV0 A;  3CKB A;  3V2X A;  2IJG X;  4GYW A;  4K5B A;  4G26 A;  3BG0 B;  3CK8 A;  4GU5 A;  1S63 A;  4GTR A;  4GMJ A;  4MBG A;  1NP7 A;  4M3O A;  3D3M A;  4V3I A;  3EHQ A;  3PEU B;  2C2L A;  2JAB A;  1HG2 A;  3HRA A;  3APD A;  4JA7 A;  4CRW A;  4WWN A;  5JA4 D;  5A6C A;  3TWQ A;  3UTM A;  4N5Q A;  5KCM A;  3E33 A;  1MHQ A;  3CVN A;  4MLP A;  1D8D A;  4PDX A;  2WXM A;  3Q9N C;  3U3W A;  1G3N B;  2I1J A;  4HI8 A;  4K5A B;  1NA3 A;  5KBA A;  2C0M A;  3X2Q E;  3QB2 A;  4AV7 A;  2DBA A;  2ZGG A;  2XEE A;  3IHY A;  3ESK A;  1EDU A;  1TN8 A;  4RG9 A;  1YYH A;  2ZU6 B;  4UWG A;  1N9A A;  2DYS E;  1SZ9 A;  3G2T A;  1DCQ A;  4IRU A;  4L23 A;  4F1P A;  3PRE A;  4HI9 A;  5EID A;  5KWD A;  1Z6T A;  3C72 A;  2KZT B;  1IKN D;  3TWX A;  2R03 A;  5HI7 A;  1FVF A;  3FUK A;  5HS0 A;  3ASN E;  5ARG A;  4I2Z A;  2P9L G;  2PNN A;  3MYV A;  4A3T A;  2J4D A;  5JJT A;  4N3B A;  1TNZ A;  4IYP A;  3ZPJ A;  4GCN A;  4ANV A;  4AP2 A;  4DPR A;  5CER B;  1GW6 A;  2V4H C;  2PM6 A;  3FU3 A;  2ETA A;  2J49 A;  3L9T A;  3PZ4 A;  5LCW C;  1JPL A;  2KCL A;  3FU6 A;  4TRQ A;  2V0P A;  3B7S A;  4FJY A;  1E90 A;  3P2B A;  4H7Y A;  2GRN B;  3CIA A;  4WWO A;  2XPY A;  5IY5 E;  3UT7 A;  4LUN U;  2CHW A;  1TR4 A;  1UG3 A;  1Z3Y A;  2DWZ A;  2NYJ A;  2MHK A;  3TJP A;  1E7U A;  3FEY A;  4PS7 A;  3EDT B;  4IUL A;  3CST A;  5ANL A;  4G1T A;  4BSX A;  1OWL A;  3FY4 A;  1JWG A;  3PZD A;  4B94 A;  3QWV A;  3ZYQ A;  3G2U A;  4K03 A;  3ZW3 A;  3DWL G;  4KT6 B;  2QYU A;  1MX4 A;  3ZN3 A;  3CVX A;  5EYL A;  1BD8 A;  5JMN D;  1UOH A;  3LPZ A;  3TWU A;  2KAT A;  2EQX A;  5ARF A;  2RFM A;  2FO7 A;  4J6I A;  2ZGD A;  3ZXS A;  2WXQ A;  2F37 A;  4B93 B;  2A4Z A;  2V8S E;  4O60 A;  2CG3 A;  3MV3 B;  3AS8 A;  1OCO E;  2V5Q C;  3LJ3 A;  1KZO A;  3BUA A;  4Q69 A;  5ITZ F;  5KNG A;  2WQ6 A;  5FQ4 A;  2DVW A;  3B7R L;  4B0Z A;  1EF1 C;  5G04 J;  3MZL B;  3ML9 A;  3Q49 B;  3S7F A;  3LXU X;  4TV3 A;  5CMY A;  3FTZ A;  1PY1 A;  2ILR A;  3Q73 A;  3FUF A;  4JVS A;  4WND A;  2KCV A;  4CDR A;  1O5M A;  3AJI A;  3PRZ A;  3CR3 A;  3FTX A;  3CLJ A;  3CGH A;  3FUL A;  1H2U A;  3FUN A;  4GYO A;  2IOS A;  2R02 A;  2R5S A;  5AQ9 A;  2UY1 A;  3ZYK A;  3TG5 A;  2C0L A;  1L5J A;  3OAW A;  1H0A A;  3LY8 A;  3HHM A;  3ONK A;  5CCL A;  4GMR A;  4UI9 K;  4BX8 A;  3DXK G;  4LEU A;  5M72 A;  3PZ1 A;  3DPD A;  2F0Y A;  4YVO A;  4E85 A;  3SF4 A;  1U3D A;  3PUK A;  5DIZ A;  3ML8 A;  3NB2 A;  4GTS A;  2RKK A;  2LSU A;  3QNK A;  1H2V C;  1OT8 A;  4L7T A;  4DI3 A;  3J5Q B;  4J8Y A;  1KZP A;  3VLD A;  5LP0 A;  3L54 A;  4A1G A;  4R7L A;  3RU0 A;  4APO A;  3Q78 A;  4I1M A;  1WM5 A;  2WXN A;  4JEH A;  2WM9 A;  2PQN A;  4J8E A;  4U63 A;  2AXV A;  4AY6 A;  2GW1 A;  3ABM E;  2WXI A;  1DNP A;  4JEU A;  3UT4 A;  5AIJ A;  2WXJ A;  3ZRH A;  3B7B A;  3SQV A;  3ZKJ A;  4BTB A;  3CK9 A;  1VDY A;  2YQ8 A;  4E6H A;  1MX2 A;  1A5E A;  2B6C A;  2GRL A;  3ZNG A;  2VJ8 A;  3UT8 A;  2ZIR A;  3FEX A;  1TNO A;  1OWM A;  4F1S A;  4LNB A;  2UY1 B;  3TWR A;  4XIF A;  4B8C B;  2F8Y A;  2WQH A;  3Q9U C;  3CVW A;  3MV2 B;  3KSQ A;  4JA9 A;  2WQ7 A;  2ZIS A;  5D0Q D;  4U07 A;  4UQX A;  3CQC B;  4BX9 A;  3FTW A;  1SW6 A;  4BWR A;  3ZVV A;  4LNG A;  3EHN A;  4JPS A;  4U0Z A;  2XEH A;  4GYY A;  4HQD A;  1OCC E;  3C98 A;  3D9I A;  4GTV A;  3UIN C;  3FP3 A;  1KLX A;  4XEI G;  4RVB A;  3IHV A;  3L82 A;  3C3O A;  4HLL A;  5CMW A;  1OXJ A;  4KZ0 A;  2XZT G;  1JCR A;  4LSZ E;  4XE0 A;  3VTX A;  3TWT A;  2P9S G;  2A5U A;  4F53 A;  2JEK A;  3J5P A;  3FTU A;  2DCP A;  3SZ7 A;  3QAR A;  3ULE G;  5C2Y A;  1X5B A;  2PM7 A;  1RZ4 A;  3FTY A;  3CHQ A;  3D9J A;  4JC8 A;  3CVL A;  1TNU A;  2VGX A;  4YDY A;  3HXF A;  4AEZ C;  1IQU A;  3QAQ A;  3SHF A;  4A63 B;  4XI9 A;  4F7A A;  3Q15 A;  3PZ2 A;  4XKB A;  3TAX A;  4BT8 A;  3I3N A;  5LFA A;  4FU3 A;  3UIO C;  2QFC A;  5BV0 A;  4WAF A;  3GZ2 A;  4LNU D;  4GTP A;  1V54 E;  4MRU A;  2R2L A;  2AXZ A;  3G2V A;  3ABL E;  2VQ2 A;  4UWL A;  1LD7 A;  1N94 A;  1NI1 A;  5BPP A;  1HO8 A;  4JW1 A;  4CCA A;  3UM0 A;  3Q5M A;  1N95 A;  3JXJ A;  3UKU G;  3PS6 A;  2Y3A A;  4GA0 A;  3S7D A;  4DLQ A;  5BXO A;  4TXP A;  4N2S A;  1TEZ A;  3KAE A;  3CSF A;  3ZHE A;  2WMO A;  3T8K A;  2LAH A;  3NOG D;  3ISM C;  3B7U X;  1D8E A;  2EIJ E;  1HE8 A;  4GA2 A;  5AYW D;  4DX5 D;  1N4S A;  3E4B A;  3FUM A;  5J08 A;  2IF4 A;  1X81 A;  3D9L A;  2X38 A;  3PE3 A;  2OVB A;  1U2V G;  2OEV A;  4O6F A;  2VGX B;  3TXN A;  4ANX A;  2QYJ A;  1JCS A;  3E34 A;  1KT0 A;  3DEO A;  5KJN A;  3U9W A;  4U04 A;  5G55 A;  4HFG A;  1E96 B;  2AVP A;  3RJV A;  3AG3 E;  3DSV A;  2IU1 A;  5ENS D;  4PH4 B;  3TWS A;  3CHS A;  2J09 A;  1ELW A;  2WXR A;  3QOU A;  4ME2 A;  2GRM A;  4G8K A;  1DC2 A;  3OXG A;  1W3B A;  5ENP D;  3MKQ A;  4L2L A;  3DRA A;  4GPM A;  1IXV A;  3EIJ A;  3RO2 A;  4J7W A;  5BUZ A;  5BNW A;  1K1A A;  3JUI A;  5AAR A;  3FUJ A;  3QJZ A;  2Y4T A;  4ZFH A;  1EYH A;  2PQR A;  4GA1 A;  3L16 A;  2LNI A;  3D9M A;  2KM4 A;  4AVX A;  5EDS A;  2XCC A;  4UI9 C;  5CEC B;  4JL0 A;  3U66 A;  4KVM A;  4X8Q A;  4F6R D;  1FT1 A;  4DX6 D;  2VSO E;  4Z68 A;  4A55 A;  3ZHE B;  3TL5 A;  5FTP A;  3PNL B;  1K3Z D;  3WXX A;  1INZ A;  3NOC D;  3SO8 A;  4RLY A;  3ZUV B;  3FH5 A;  1ZU2 A;  2QC9 A;  4UI9 J;  3CV0 A;  2RG8 A;  5ENQ D;  3W9G A;  1H19 A;  5T4Y A;  3I4R B;  4FLB A;  3EU5 A;  4MS6 A;  5JJ6 A;  1SA4 A;  4BY6 A;  3ASF A;  1FT2 A;  2P9K G;  4UQZ A;  4K0R A;  3UM3 A;  4AXH A;  3CHO A;  4EZK A;  4U0S A;  3ASG A;  2I1K A;  3Q75 A;  5LX8 A;  1HG5 A;  2XGM A;  4RSY A;  4FHK A;  1NA0 A;  2XS8 A;  5ENN A;  4A3V A;  2P9P G;  2XGO A;  3DSW A;  3TWW A;  2ETC A;  2YNQ A;  4WNE A;  4XX5 A;  4G2V A;  3CVV A;  2IFU A;  4HBD A;  1AP7 A;  4AOF A;  4Y6C A;  4ATG A;  3LS8 A;  1JUQ A;  2WXG A;  3MKQ B;  4J0U A;  3CHR A;  3UIP C;  1WY6 A;  4BEP A;  4FUL A;  3U4T A;  4TUU A;  4FP7 A;  4NUR A;  3KEA A;  3HYM B;  3MCX A;  3PDN A;  4FA6 A;  3UM1 A;  5E75 A;  5ENR D;  3AG2 E;  3L6A A;  1MX6 A;  4I1A A;  2WXP A;  5G04 C;  3ZIM A; 
#chains in the Genus database with same CATH homology
 1D8E A;  3EUV A;  1MZC A;  1TNY A;  4GTO A;  4YDE A;  1TN7 A;  1N4S A;  3E33 A;  3Q73 A;  3PZ3 A;  1LTX A;  3SFX A;  1O1T A;  1QBQ A;  1D8D A;  2H6G A;  3DSS A;  1O5M A;  2IEJ A;  2BED A;  1TNB A;  1X81 A;  1TNU A;  4YDO A;  3HXD A;  3HXF A;  1SA5 A;  3Q7A A;  3DSU A;  3EU5 A;  3E30 A;  1SA4 A;  3PZ2 A;  2H6H A;  4GTM A;  1FT2 A;  3DST A;  1JCS A;  2H6F A;  1N4Q A;  3HXC A;  3E34 A;  2ZIR A;  1O1R A;  4L9P A;  1TNO A;  3E37 A;  4LNB A;  1TN8 A;  3Q75 A;  3DSV A;  3E32 A;  3KSL A;  3Q7F A;  1DCE A;  4GTP A;  3DSX A;  3KSQ A;  2ZIS A;  1N9A A;  1N4R A;  2R2L A;  3PZ1 A;  3DSW A;  3HXB A;  4GTT A;  2F0Y A;  1LD7 A;  1N4P A;  1JCQ A;  3C72 A;  4LNG A;  1N94 A;  1NI1 A;  3DRA A;  1TN6 A;  1O1S A;  4EHM A;  1LD8 A;  1NL4 A;  4GTQ A;  4GTS A;  1N95 A;  1TNZ A;  4GTV A;  1S64 A;  1S63 A;  4GTR A;  4MBG A;  3HXE A;  1KZP A;  1KZO A;  3Q79 A;  1JCR A;  3DPY A;  3SFY A;  1FPP A;  3Q78 A;  2H6I A;  3PZ4 A;  1FT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...