3EUVA

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10, w102t, y154t) in complex with biotingpp
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 132
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3euvA00
1O1RA 3DSUA 4LNGA 1N9AA 3E37A 1NI1A 1JCRA 1X81A 1O1TA 2BEDA 1TN7A 3HXDA 1TNOA 1TNYA 3HXFA 1O5MA 2F0YA 4GTOA 4GTTA 3Q7AA 3SFYA 3DSSA 1JCSA 3DPYA 1N4QA 1N4RA 2ZIRA 1NL4A 1MZCA 3Q73A 1LD8A 1FT1A 1N4PA 2R2LA 1QBQA 1TNZA 4GTQA 1FT2A 4YDOA 4EHMA 1TN8A 3DSWA 3Q75A 1O1SA 1KZOA 3DSXA 1N4SA 4YDEA 1S63A 3E34A 1N94A 4GTSA 4L9PA 1TN6A 3PZ3A 3EUVA 3SFXA 4GTPA 2H6FA 3DRAA 2H6HA 2ZISA 1D8EA 3HXEA 1LTXA 3Q79A 1D8DA 2H6GA 3PZ2A 1FPPA 1TNUA 3E30A 3DSVA 1SA5A 3DSTA 3Q78A 2IEJA 3HXBA 1KZPA 4GTMA 1N95A 1JCQA 3HXCA 1S64A 2H6IA 3C72A 1DCEA 3E33A 3EU5A 3Q7FA 3PZ4A 3KSLA 3E32A 1SA4A 4GTRA 4MBGA 4GTVA 3KSQA 1LD7A 3PZ1A 4LNBA 1TNBA
chains in the Genus database with same CATH superfamily
2UY1A 2XENA 5G55A 3RO2A 4FJZA 5G04J 5B1AE 1DNPA 3I3NA 4AY5A 3FDHA 1TNOA 4ANUA 2X6KA 1MX2A 4DUIA 2OEVA 2JLBA 4RLYA 4AVXA 2YHEA 4EHMA 1XNFA 1TN8A 2JEKA 1OWOA 2I1JA 3MKRA 1SW6A 1NP7A 3E34A 4ME2A 4O60A 4U8YD 1TN6A 1Z6TA 2V8SE 3W9FA 2J9QA 4HRMB 4K5CA 3IEGA 1HE8A 4XI9A 3UXGA 5EYPF 4UQXA 2WXIA 4RVBA 3CHMA 3UIPC 2LXLA 3TWSA 2KCKA 3RAUA 3LY7A 2CHZA 3D9LA 1OCCE 1IXVA 3HXBA 3CK9A 2C0LA 5CMWA 5BPPA 3C72A 1N52A 4UI9C 4CDNA 5ENPD 3KSLA 3EHMA 2GRNB 4A1GA 4FHJA 3B7UX 3EIJA 3PREA 2VYIA 1TNBA 5HS0A 1HS6A 4Q69A 3KD7A 1BI7B 2IOLA 3UUXA 3CVVA 3T9KA 4DI4A 4O1PA 2XCBA 3E37A 3RSEG 3TWXA 2L6JA 3VLFA 3O4ZA 4HFGA 3JUIA 1TNYA 2AXVA 2WXHA 3QB2A 3ZN3A 4FJYA 3NOGD 3SFYA 3ABKE 5JA4D 2VGEA 3FEXA 1FT1A 2X3MA 4NIKA 3C3OA 4GTQA 2DZOA 3NAWA 2FO1E 4NRHB 2CHWA 3BU8A 1Y6IA 4YDWA 3LVRE 2GRQB 5A7DB 1NA3A 4LUNU 4O1OA 1OY3D 1E8YA 5JMND 5EIDA 4GMJA 4HXIA 5EIBE 3U64A 3CKBA 4WNEA 3O48A 1RW2A 3ZRHA 3TWWA 1H6KA 4JC8A 4A3VA 1TJFA 2R17C 2AWIA 3UM1A 1D8DA 4RQIA 3Q47B 3UI2A 4OYSA 3ZPJA 3TXMA 1TNUA 5BT1A 4B93B 3FUEA 1QZ2A 4QQIA 3HIZA 4UI9K 4I17A 4DLQA 3UM0A 3L82A 3GYZA 2XZTG 3BG1B 4TXRA 3MV2B 4OVUA 3TWQA 3NZSA 1LD7A 2X6JA 3ZIMA 3MKQA 1DC2A 5EYLA 3L17A 2KCVA 1TN7A 2RKKA 2OCCE 3PUJA 1TYQG 1O5MA 4GPMA 2VGXA 5ENQD 2WVIA 2OEWA 2J4DA 2WXFA 1N0QA 2XGOA 4DX7D 4G26A 4X8QA 5KBAA 3ISMC 1G3NB 3OXGA 2L9BA 4GMRA 2MYOA 2X6HA 1BD8A 3CKCA 3QOUA 3DPDA 3TL5A 5C1DA 3SBTB 1OWLA 1KT1A 5KCMA 5EN5D 2LAHA 4G23A 3DRAA 4J8SA 5T8IA 3RRMB 3LJNA 4FLHA 4BFRA 3Q79A 4K5AB 2GW1A 3OXFA 2KZTA 2PL2A 1HG5A 3UM2A 4BTAA 2IOSA 2IF4A 4N5CA 3L54A 4BT8A 3FU6A 3DXMG 4WWNA 3MCXA 3FP3A 4LNBA 4N39A 4AJWA 4LNUD 4Q96A 1N11A 3UKRG 4FLBA 5ENTD 5G04C 3L6AA 4U96D 4I1OB 2A5UA 3R9AB 3Q73A 5DIZA 3L9TA 4HB5A 4I9EA 1OWMA 4XX5A 3ZYQA 3VLEA 3MGBA 1ZU2A 3EJNA 4U0SA 4F1SA 1YA0A 4I9CA 2OVBA 3ML9A 1N4SA 3UM3A 3NB2A 4BY6A 3D9IA 3B7SA 3L16A 3IHVA 3ZYKA 2LO6A 3ZHEB 3EHRA 4H7YA 3V2OA 5D0QD 4CDMA 4Q94A 4CT4A 4UWGA 4GMLA 3CQCB 4W9RA 1D8EA 3WG7E 1IKND 3IV0A 4F6RD 3LKUA 3NQPA 4G1TA 3ZEFA 4HOTA 2FBNA 3APCA 2PM7A 3PVLA 1IYGA 3J5PA 2QZAA 3KEZA 4WNFA 1QQEA 3PEVB 5AJLA 3FEYA 3UMVA 4C0EA 1UN9A 5G05J 1OWPA 3UT8A 2P9UG 4Z68A 2XGMA 2P9SG 4L2YA 3HHMA 1HZ4A 3BUAA 4EZKA 2NYJA 2R5SA 4WNGA 3UTMA 5B3SE 2FF4A 2BTDA 2F8YA 4I6JA 2HO1A 2R05A 5E76A 3TGOA 5BXUA 1D9SA 1HG2A 2AW6A 4JXTA 3G2WA 4RSYA 1WAO1 4GCOA 1OCRE 3Q7AA 5ENSD 5LOZA 3KS2A 3QWWA 3D3MA 3CHOA 3ZNGA 1OT8A 2V0PA 2JABA 3RKVA 1SZ9A 4KZCA 3APDA 2WXOA 3T5XA 3OXLA 2GRRB 4GTSA 1OCZE 3PNTB 2IQCA 3B7TA 1NA0A 2P9IG 3HDXA 4I1AA 4U0ZA 2H6HA 3BQOA 4G8LA 4B8CB 4G24A 2BF0X 4BTBA 4EECA 1NFIE 4XI0A 4BEPA 4B94A 1K8KG 3AG1E 4ANXA 3UINC 1TEZA 1TR4A 2AXZA 4DLOA 1OXJA 3GZ2A 3S7DA 3HRAA 3P1UA 1DCQA 2CG2A 5ENOD 3GW4A 3TG5A 4PS3A 3E33A 3QK0A 2XRZA 4RG6A 2C0MA 4TV3A 4HOSA 3ASGA 3IXEA 4NQ0A 2DCPA 3AAAC 2EIKE 1SA4A 3HVEB 2A5EA 5HI7A 5E75A 3E4BA 3SNXA 4N2SA 3ULQA 3ML8A 3DSUA 2XZDG 4LNGA 2F8XK 1HH8A 1KPSB 4KXKB 4WAFA 1H2UA 3RJVA 4EZJA 2WXLA 3VTYA 5KJNA 3SD5A 2IO3C 2ZIRA 2XEHA 1A5EA 3V30A 1QBQA 1TNZA 4JHJA 3CSTA 3AG2E 4MS6A 2LAIA 4JHRA 5AYWD 3EUVA 5LCWJ 1V54E 1AP7A 3HXEA 5HKPA 5BUZA 2QYUA 4KVMA 1Z3XA 4GZCA 5FTPA 2HYZA 4TUUA 5CECB 1IQRA 5A6CA 1YCSB 1N95A 4KZ0A 3FU5A 3PNLB 2KATA 3RK6A 3S7JA 1IQUA 5KNGA 1DCEA 4DPRA 3ULEG 3UPVA 2IFUA 3JXJA 4U8VD 3QC1A 5CCMA 2HM8A 3JUEA 5IY5E 1Z5SC 4GTRA 1FVFA 2J4BA 2ZU6B 2LNIA 2WXPA 1N54A 4AM9A 1N9AA 4GB9A 4UQYA 4H7XA 5D2MC 4APOA 4CDRA 2WM9A 4XIFA 5ITZF 4BESA 3LY8A 1WDYA 4RG9A 4KVOA 3FTZA 3B7BA 2R03A 3QAQA 2P9KG 2XRYA 1UN8A 3DPYA 3FTWA 1Z3YA 3FUFA 2IONA 1N4PA 4JA7A 5AQAA 3P2BA 3IBEA 4YDOA 1P5QA 2L0TB 3AU4A 4JHKA 3CEQA 3LYAA 2DWZA 4DRXE 1PC2A 1JWFA 4F3VA 1OWNA 4FA6A 3D9MA 4CZ2D 4GZ5A 2P2CP 3EIQC 2XS8A 3JYSA 3LEWA 1LF8A 3SY2A 1Q2ZA 5JJ6A 4C9BB 3CHQA 2PZIA 3AJIA 4ATGA 2V5QC 1FPPA 3G2TA 4ATZD 2R59A 2X38A 1TJCA 4IN3B 1KZPA 2CFZA 3DWLG 3MX3A 4DI3A 2Y1LE 2GROB 2EIME 2E0IA 2EIJE 2DYSE 5T4YA 5G05C 4GZDA 5B1BE 4N3CA 2GRPB 3KSQA 3NF1A 4ZHBA 4NACA 1H6PA 4HLLA 2WMNA 2GRLA 4JA9A 5JJ7A 1GW6A 4JB8P 5ANRA 2RFMA 4GTOA 1OUVA 2ETCA 3Q9NC 3R9MA 3AS4A 3CIAA 2RG8A 2RD0A 1MJ0A 1MZCA 4M3OA 5BV0A 1MX6A 3KEAA 3QARA 3L13A 3KAEA 4I1MA 3PE3A 3DEPA 4HI8A 4K5BA 1HXIA 3CVPA 4OAVB 4LCTA 1L5JA 2VTBA 4GTPA 3CGHA 2XEEA 5JJTA 3ZKJA 5AQ7A 3W9GA 4CGWA 1PAQA 2WQ6A 4AEZC 4PS8A 2XS1A 2VGYA 3C3RA 4UWHA 3JCKC 3U3WA 1Y8MA 3T8MA 3DSTA 2J09A 1OCOE 1SQMA 3S7FA 3JXIA 4R7LA 1HFAA 3R7RA 5CEAA 3SHFA 1AWCB 4J8EA 4U07A 1K3ZD 4FULA 3Q15A 4U0UA 4BT9A 4F7AA 3ZFWA 4CYMD 1SVXA 4GA1A 4HRNA 2GRMA 3SGHA 2FI7A 5G2NA 2OV8A 1JCRA 2NSZA 3HXDA 4TXQA 3ONLA 5EDSA 1E8XA 2F37A 4GA0A 4TUMA 2BKGA 4EBAG 2P58C 3Q4AB 4APFA 5AENA 2KC7A 3FTVA 1LD8A 3DXKG 3T5VA 3TWTA 1HF8A 4TRQA 2XQ0A 5EX3A 1EDUA 4AY6A 1S63A 4AV7A 2Y3AA 3Q9UC 5J90A 3ASHA 4ANWA 5BNWA 3I5PA 1BPOA 4TXPA 3B13A 5FQ4A 2EILE 3CK8A 4KBQA 5LCWC 3EDTB 2CG3A 2IU1A 3V79K 3FY4A 3K9IA 2J8SD 3G2VA 2WXJA 2ETAA 4J8FA 3G2SA 3C98A 4JEUA 4AXHA 1JCQA 3HXCA 2WQHA 4MRUA 4UWFA 2J08A 2XPZA 4Y6WA 5T3RA 3SBSA 2Q7FA 4GA2A 2WXQA 4MBGA 3MV3B 2PQRA 5CERB 2HE0A 4WNDA 2Y0BG 4BX8A 5M72A 1BLXB 5KJMA 4G8KA 4F1PA 1U2VG 2B0OE 1KT0A 4HORA 3QWVA 3I4GA 3TAXA 2Y4TA 4J7WA 4BERA 2R2LA 4MKTA 2DBAA 4M7CA 3NOCD 4BSXA 3CHRA 1JUQA 3PE4A 1V55E 2HR2A 2EQXA 2XEVA 3Q75A 3ZXPA 4HVBA 2ZGDA 4HI9A 3TWRA 3EHNA 4ILHB 3MA5A 4LEUA 4JEHA 1BI8B 4C0MA 3ESKA 2FULA 2E2EA 3ASDA 4EPZA 4HRLA 4HNAD 4LG6A 1MQSA 4URKA 3CHSA 2OVFA 5AN8A 3R7QA 5LX8A 2WXRA 3DSVA 5JHBA 1SA5A 3NBNB 2VSNA 3MKQB 3G2UA 3UQ3A 5AJDA 4GTMA 4E6HA 4AIFA 2H6IA 3J5QB 2YNQA 4WWOA 5BW8C 3RRUA 4IYPA 5CRUA 2VGXB 5J08A 1A17A 5D66A 4EBAA 3CLJA 4E85A 1PY1A 3D9NA 3GZ1A 3IHYA 3LPZA 2V5FA 3PEUB 1HU3A 2P9PG 2Y4UA 4XZ4A 3LCAA 1O1TA 2BEDA 3AS5A 3ABME 4KMOA 5EILA 5AQ9A 5KNHD 1JCSA 2J49A 3ZU7B 3D9PA 4A3TA 3MJWA 2LXMA 1QNFA 2VSYA 2EINE 3VTXA 4L2LA 1K1BA 5FQ6A 2KXPC 2GGFA 5AQBA 1WG0A 2DYRE 3ASFA 4L9PA 4PS7A 3ASOE 3TWUA 1ZB1A 1IHBA 1N0RA 3FWVA 3ESLA 1H19A 2H6GA 2RFAA 3GZSA 3HYMB 3LDZA 3PRZA 3OTNA 3Q78A 3FH7A 4JZYA 4D10C 3U66A 4L1BA 2IJGX 2LSUA 4XKCA 3EU5A 3CQGB 3FH8A 2AVPA 3CR3A 4XE0A 3FUKA 1U3CA 3CV0A 3S7BA 2DVWA 4ILIA 3Q7FA 1O1RA 5FJYA 1JPLA 3UKUG 4J8DA 1KLXA 4JW1A 1H2VC 3FUIA 4G2VA 1H0AA 2P9NG 2DIWA 3ENEA 4GU5A 3ZXSA 5LFAA 1N4RA 5CBOA 3FH5A 3V31A 2XGSA 3SZ7A 2YQ8A 1ELWA 1MX4A 4GAAA 3LJ3A 3FHEA 3L08A 1H6OA 4ANVA 4DK5A 2ETBA 2I1KA 5C2YA 4U95D 3FTSA 3LY9A 2YHCA 1S0PA 4C48B 4DX1A 2L0IA 2LSVA 3MYVA 4HLEA 3SFXA 5LP0A 4A1SA 1K1AA 2CHXA 3CVWA 4HS2A 5DBKA 1LTXA 4A63B 2FEZA 1QYMA 1ZBPA 3FULA 4JD2G 2PNNA 3WXXA 3EHQA 5CCLA 3FUHA 2WXNA 5FZRA 3V2XA 3VLDA 4A55A 3B7RL 3CVLA 5ENNA 3CSFA 1INZA 2BUGA 3ZHEA 4FP7A 3PDNA 4FC8A 3CVQA 3FUNA 3LS8A 4AP2A 3T8KA 5BXOA 4I2WA 3CVYA 3UIOC 4Y6CA 1UW4B 2ZGGA 1E96B 4UUCA 5KJLA 4GTTA 5JHAA 4JPSA 2QFCA 1N4QA 1WY6A 3FUDA 1NL4A 2V4HC 4B89A 4LRZA 5FQ8A 2LUHA 3SF4A 5FWQA 2XCCA 3ZVVA 3DSWA 3AG3E 3SFZA 3AS8A 1KZOA 4GYWA 3QWPA 4YDEA 1X5BA 1SZAA 3FUMA 2X6FA 4PH4B 3CVXA 2VSXE 4CEMA 4V3IA 3MEKA 3JQ1A 4OVVA 4GYYA 2QC9A 2VJ8A 2WXGA 3E30A 3UT7A 2I2OA 1U3DA 3Q5MA 4JVSA 3OAWA 2KCLA 2ZXWE 1YYHA 1DVPA 1UJKA 4ILGA 3ZYMA 1HX8A 3D9JA 4O6FA 3ONKA 4ACLA 3C5RA 4DJAA 2XHEA 3S2AA 2M63A 3E32A 2B6CA 2WB2A 1E7VA 5AAOA 2UY1B 3U4TA 5ARGA 3FTXA 1ELKA 3BG0B 3TJPA 4HBDA 4ACKA 3URZA 2NC9A 4UWKA 2X6IA 2PM6A 3U9WA 3HVEA 4KYOB 2KBXA 4L23A 5H7PA 1UG3A 2IY0C 1B89A 4NURA 1FCHA 3FFLA 4WUYA 1E8ZA 1S70B 4YVOA 3DSXA 3AU5A 4BX9A 4UWLA 1N94A 4OAUC 4F53A 4IULA 1ELRA 3I4RB 3TWVA 5A23A 3PS6A 2ZISA 2J07A 4U8HA 2VSOE 4K0RA 3CVNA 4B0ZA 4L7TA 1EF1C 5CMYA 3CVUA 5ENRD 1MHQA 2XPYA 2ILRA 3ABLE 3D9OA 4CGVA 4GCNA 3TG4A 3HG0D 2VQ2A 2MOWA 4UI9J 1S64A 1WM5A 3PUKA 1BU9A 3RRNB 1EPUA 3FU3A 3PZDA 5CRVA 4YNDA 3QDNA 1HO8A 4GTVA 3LXUX 1YMPA 4N5QA 3PZ1A 4YDYA 4CRWA 2WMOA 2A4ZA 5FINA 5KJKA 4HOQA 2MRIA 4KT6B 1X81A 4DX6D 5FZQA 3ZW3A 1H2TC 5HRYA 4J8YA 5AARA 5EKQD 4FADA 5FIOA 3HXFA 3QJZA 3LVQE 3FTYA 2CFUA 4N2QA 4G25A 3JQ0A 1FT2A 4EZLA 1O1SA 4MLPA 3D9KA 4CT0A 5D0OD 4ABNA 3ZUVB 5ANLA 4U04A 2R02A 1E7UA 3PZ3A 4AOFA 1RZ4A 4I43A 1EYHA 3X2QE 5BV1A 2H6FA 4YVQC 5FZSA 3N71A 2V4LA 4HOUA 4FU3A 3CK7A 5AIJA 3PZ2A 3L22A 3TXNA 4BSZB 2WXKA 2QYJA 5KWDA 4G11A 3DBSA 3BEEA 3UX4A 2IEJA 4FHKA 4XKBA 2YINA 1E8WA 4B8AA 2WXMA 5FQ7A 2I9CA 4GZ3A 3PZ4A 3RIBA 1JWGA 2AXUA 4HQDA 1FVHA 4IRUA 1IHGA 1UJJA 1W3BA 4I6GA 2C2LA 4ZFHA 4DX2A 3QKYA 3Q49B 4I2ZA 1NI1A 2WQ7A 5ARFA 3C3QA 3AG4E 3NZUA 3SO8A 3SQVA 2L6BA 3ASNE 3RU0A 2DZNA 2F0YA 3DSSA 5CEDB 4LSZE 3DEOA 1VDYA 5CHEE 2Y69E 2VTBB 4U63A 4BETA 4I6EA 4GPKA 2PQNA 1MYOA 3ZYLA 4CCAA 4WWPA 4N3BA 2IO2C 2FO7A 4JL0A 4EQFA 4K03A 2KM4A 3ZGQA 3MZLB 2ONDA 4J6IA 3FTUA 4P29A 5CBNA 2P9LG 3SI5A 2WPVA 3EU9A 4J0UA 2AJAA 4UQZA 4BWRA 3FU0A 2KZTB 3F6QA 4PUCA 2QY7A 2MHKA 5EX0A 5HQ8A 3UT4A 3CHPA 3D9HA 2OOEA 4GZ6A 1UOHA 4PDXA 4XEIG 2NXPA 3QNKA 3B95A 1XGWA 1E90A 2BKKB 4LERA 2I6HA 3RO3A 4DX5D 2UWJG 4QFVA 2XPIA 3PH0C 4N3AA 3ULYA 4U7EB 3IKOB 3APFA 1NZNA 5FT9A 4GYOA 3FUJA
chains in the Genus database with same CATH topology
1O1RA 3DSUA 4LNGA 1N9AA 3E37A 1NI1A 1JCRA 1X81A 1O1TA 2BEDA 1TN7A 3HXDA 1TNOA 1TNYA 3HXFA 1O5MA 2F0YA 4GTOA 4GTTA 3Q7AA 3SFYA 3DSSA 1JCSA 3DPYA 1N4QA 1N4RA 2ZIRA 1NL4A 1MZCA 3Q73A 1LD8A 1FT1A 1N4PA 2R2LA 1QBQA 1TNZA 4GTQA 1FT2A 4YDOA 4EHMA 1TN8A 3DSWA 3Q75A 1O1SA 1KZOA 3DSXA 1N4SA 4YDEA 1S63A 3E34A 1N94A 4GTSA 4L9PA 1TN6A 3PZ3A 3EUVA 3SFXA 4GTPA 2H6FA 3DRAA 2H6HA 2ZISA 1D8EA 3HXEA 1LTXA 3Q79A 1D8DA 2H6GA 3PZ2A 1FPPA 1TNUA 3E30A 3DSVA 1SA5A 3DSTA 3Q78A 2IEJA 3HXBA 1KZPA 4GTMA 1N95A 1JCQA 3HXCA 1S64A 2H6IA 3C72A 1DCEA 3E33A 3EU5A 3Q7FA 3PZ4A 3KSLA 3E32A 1SA4A 4GTRA 4MBGA 4GTVA 3KSQA 1LD7A 3PZ1A 4LNBA 1TNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1R A;  3DSU A;  4LNG A;  1N9A A;  3E37 A;  1NI1 A;  1JCR A;  1X81 A;  1O1T A;  2BED A;  1TN7 A;  3HXD A;  1TNO A;  1TNY A;  3HXF A;  1O5M A;  2F0Y A;  4GTO A;  4GTT A;  3Q7A A;  3SFY A;  3DSS A;  1JCS A;  3DPY A;  1N4Q A;  1N4R A;  2ZIR A;  1NL4 A;  1MZC A;  3Q73 A;  1LD8 A;  1FT1 A;  1N4P A;  2R2L A;  1QBQ A;  1TNZ A;  4GTQ A;  1FT2 A;  4YDO A;  4EHM A;  1TN8 A;  3DSW A;  3Q75 A;  1O1S A;  1KZO A;  3DSX A;  1N4S A;  4YDE A;  1S63 A;  3E34 A;  1N94 A;  4GTS A;  4L9P A;  1TN6 A;  3PZ3 A;  3EUV A;  3SFX A;  4GTP A;  2H6F A;  3DRA A;  2H6H A;  2ZIS A;  1D8E A;  3HXE A;  1LTX A;  3Q79 A;  1D8D A;  2H6G A;  3PZ2 A;  1FPP A;  1TNU A;  3E30 A;  3DSV A;  1SA5 A;  3DST A;  3Q78 A;  2IEJ A;  3HXB A;  1KZP A;  4GTM A;  1N95 A;  1JCQ A;  3HXC A;  1S64 A;  2H6I A;  3C72 A;  1DCE A;  3E33 A;  3EU5 A;  3Q7F A;  3PZ4 A;  3KSL A;  3E32 A;  1SA4 A;  4GTR A;  4MBG A;  4GTV A;  3KSQ A;  1LD7 A;  3PZ1 A;  4LNB A;  1TNB A; 
#chains in the Genus database with same CATH topology
 2UY1 A;  2XEN A;  5G55 A;  3RO2 A;  4FJZ A;  5G04 J;  5B1A E;  1DNP A;  3I3N A;  4AY5 A;  3FDH A;  1TNO A;  4ANU A;  2X6K A;  1MX2 A;  4DUI A;  2OEV A;  2JLB A;  4RLY A;  4AVX A;  2YHE A;  4EHM A;  1XNF A;  1TN8 A;  2JEK A;  1OWO A;  2I1J A;  3MKR A;  1SW6 A;  1NP7 A;  3E34 A;  4ME2 A;  4O60 A;  4U8Y D;  1TN6 A;  1Z6T A;  2V8S E;  3W9F A;  2J9Q A;  4HRM B;  4K5C A;  3IEG A;  1HE8 A;  4XI9 A;  3UXG A;  5EYP F;  4UQX A;  2WXI A;  4RVB A;  3CHM A;  3UIP C;  2LXL A;  3TWS A;  2KCK A;  3RAU A;  3LY7 A;  2CHZ A;  3D9L A;  1OCC E;  1IXV A;  3HXB A;  3CK9 A;  2C0L A;  5CMW A;  5BPP A;  3C72 A;  1N52 A;  4UI9 C;  4CDN A;  5ENP D;  3KSL A;  3EHM A;  2GRN B;  4A1G A;  4FHJ A;  3B7U X;  3EIJ A;  3PRE A;  2VYI A;  1TNB A;  5HS0 A;  1HS6 A;  4Q69 A;  3KD7 A;  1BI7 B;  2IOL A;  3UUX A;  3CVV A;  3T9K A;  4DI4 A;  4O1P A;  2XCB A;  3E37 A;  3RSE G;  3TWX A;  2L6J A;  3VLF A;  3O4Z A;  4HFG A;  3JUI A;  1TNY A;  2AXV A;  2WXH A;  3QB2 A;  3ZN3 A;  4FJY A;  3NOG D;  3SFY A;  3ABK E;  5JA4 D;  2VGE A;  3FEX A;  1FT1 A;  2X3M A;  4NIK A;  3C3O A;  4GTQ A;  2DZO A;  3NAW A;  2FO1 E;  4NRH B;  2CHW A;  3BU8 A;  1Y6I A;  4YDW A;  3LVR E;  2GRQ B;  5A7D B;  1NA3 A;  4LUN U;  4O1O A;  1OY3 D;  1E8Y A;  5JMN D;  5EID A;  4GMJ A;  4HXI A;  5EIB E;  3U64 A;  3CKB A;  4WNE A;  3O48 A;  1RW2 A;  3ZRH A;  3TWW A;  1H6K A;  4JC8 A;  4A3V A;  1TJF A;  2R17 C;  2AWI A;  3UM1 A;  1D8D A;  4RQI A;  3Q47 B;  3UI2 A;  4OYS A;  3ZPJ A;  3TXM A;  1TNU A;  5BT1 A;  4B93 B;  3FUE A;  1QZ2 A;  4QQI A;  3HIZ A;  4UI9 K;  4I17 A;  4DLQ A;  3UM0 A;  3L82 A;  3GYZ A;  2XZT G;  3BG1 B;  4TXR A;  3MV2 B;  4OVU A;  3TWQ A;  3NZS A;  1LD7 A;  2X6J A;  3ZIM A;  3MKQ A;  1DC2 A;  5EYL A;  3L17 A;  2KCV A;  1TN7 A;  2RKK A;  2OCC E;  3PUJ A;  1TYQ G;  1O5M A;  4GPM A;  2VGX A;  5ENQ D;  2WVI A;  2OEW A;  2J4D A;  2WXF A;  1N0Q A;  2XGO A;  4DX7 D;  4G26 A;  4X8Q A;  5KBA A;  3ISM C;  1G3N B;  3OXG A;  2L9B A;  4GMR A;  2MYO A;  2X6H A;  1BD8 A;  3CKC A;  3QOU A;  3DPD A;  3TL5 A;  5C1D A;  3SBT B;  1OWL A;  1KT1 A;  5KCM A;  5EN5 D;  2LAH A;  4G23 A;  3DRA A;  4J8S A;  5T8I A;  3RRM B;  3LJN A;  4FLH A;  4BFR A;  3Q79 A;  4K5A B;  2GW1 A;  3OXF A;  2KZT A;  2PL2 A;  1HG5 A;  3UM2 A;  4BTA A;  2IOS A;  2IF4 A;  4N5C A;  3L54 A;  4BT8 A;  3FU6 A;  3DXM G;  4WWN A;  3MCX A;  3FP3 A;  4LNB A;  4N39 A;  4AJW A;  4LNU D;  4Q96 A;  1N11 A;  3UKR G;  4FLB A;  5ENT D;  5G04 C;  3L6A A;  4U96 D;  4I1O B;  2A5U A;  3R9A B;  3Q73 A;  5DIZ A;  3L9T A;  4HB5 A;  4I9E A;  1OWM A;  4XX5 A;  3ZYQ A;  3VLE A;  3MGB A;  1ZU2 A;  3EJN A;  4U0S A;  4F1S A;  1YA0 A;  4I9C A;  2OVB A;  3ML9 A;  1N4S A;  3UM3 A;  3NB2 A;  4BY6 A;  3D9I A;  3B7S A;  3L16 A;  3IHV A;  3ZYK A;  2LO6 A;  3ZHE B;  3EHR A;  4H7Y A;  3V2O A;  5D0Q D;  4CDM A;  4Q94 A;  4CT4 A;  4UWG A;  4GML A;  3CQC B;  4W9R A;  1D8E A;  3WG7 E;  1IKN D;  3IV0 A;  4F6R D;  3LKU A;  3NQP A;  4G1T A;  3ZEF A;  4HOT A;  2FBN A;  3APC A;  2PM7 A;  3PVL A;  1IYG A;  3J5P A;  2QZA A;  3KEZ A;  4WNF A;  1QQE A;  3PEV B;  5AJL A;  3FEY A;  3UMV A;  4C0E A;  1UN9 A;  5G05 J;  1OWP A;  3UT8 A;  2P9U G;  4Z68 A;  2XGM A;  2P9S G;  4L2Y A;  3HHM A;  1HZ4 A;  3BUA A;  4EZK A;  2NYJ A;  2R5S A;  4WNG A;  3UTM A;  5B3S E;  2FF4 A;  2BTD A;  2F8Y A;  4I6J A;  2HO1 A;  2R05 A;  5E76 A;  3TGO A;  5BXU A;  1D9S A;  1HG2 A;  2AW6 A;  4JXT A;  3G2W A;  4RSY A;  1WAO 1;  4GCO A;  1OCR E;  3Q7A A;  5ENS D;  5LOZ A;  3KS2 A;  3QWW A;  3D3M A;  3CHO A;  3ZNG A;  1OT8 A;  2V0P A;  2JAB A;  3RKV A;  1SZ9 A;  4KZC A;  3APD A;  2WXO A;  3T5X A;  3OXL A;  2GRR B;  4GTS A;  1OCZ E;  3PNT B;  2IQC A;  3B7T A;  1NA0 A;  2P9I G;  3HDX A;  4I1A A;  4U0Z A;  2H6H A;  3BQO A;  4G8L A;  4B8C B;  4G24 A;  2BF0 X;  4BTB A;  4EEC A;  1NFI E;  4XI0 A;  4BEP A;  4B94 A;  1K8K G;  3AG1 E;  4ANX A;  3UIN C;  1TEZ A;  1TR4 A;  2AXZ A;  4DLO A;  1OXJ A;  3GZ2 A;  3S7D A;  3HRA A;  3P1U A;  1DCQ A;  2CG2 A;  5ENO D;  3GW4 A;  3TG5 A;  4PS3 A;  3E33 A;  3QK0 A;  2XRZ A;  4RG6 A;  2C0M A;  4TV3 A;  4HOS A;  3ASG A;  3IXE A;  4NQ0 A;  2DCP A;  3AAA C;  2EIK E;  1SA4 A;  3HVE B;  2A5E A;  5HI7 A;  5E75 A;  3E4B A;  3SNX A;  4N2S A;  3ULQ A;  3ML8 A;  3DSU A;  2XZD G;  4LNG A;  2F8X K;  1HH8 A;  1KPS B;  4KXK B;  4WAF A;  1H2U A;  3RJV A;  4EZJ A;  2WXL A;  3VTY A;  5KJN A;  3SD5 A;  2IO3 C;  2ZIR A;  2XEH A;  1A5E A;  3V30 A;  1QBQ A;  1TNZ A;  4JHJ A;  3CST A;  3AG2 E;  4MS6 A;  2LAI A;  4JHR A;  5AYW D;  3EUV A;  5LCW J;  1V54 E;  1AP7 A;  3HXE A;  5HKP A;  5BUZ A;  2QYU A;  4KVM A;  1Z3X A;  4GZC A;  5FTP A;  2HYZ A;  4TUU A;  5CEC B;  1IQR A;  5A6C A;  1YCS B;  1N95 A;  4KZ0 A;  3FU5 A;  3PNL B;  2KAT A;  3RK6 A;  3S7J A;  1IQU A;  5KNG A;  1DCE A;  4DPR A;  3ULE G;  3UPV A;  2IFU A;  3JXJ A;  4U8V D;  3QC1 A;  5CCM A;  2HM8 A;  3JUE A;  5IY5 E;  1Z5S C;  4GTR A;  1FVF A;  2J4B A;  2ZU6 B;  2LNI A;  2WXP A;  1N54 A;  4AM9 A;  1N9A A;  4GB9 A;  4UQY A;  4H7X A;  5D2M C;  4APO A;  4CDR A;  2WM9 A;  4XIF A;  5ITZ F;  4BES A;  3LY8 A;  1WDY A;  4RG9 A;  4KVO A;  3FTZ A;  3B7B A;  2R03 A;  3QAQ A;  2P9K G;  2XRY A;  1UN8 A;  3DPY A;  3FTW A;  1Z3Y A;  3FUF A;  2ION A;  1N4P A;  4JA7 A;  5AQA A;  3P2B A;  3IBE A;  4YDO A;  1P5Q A;  2L0T B;  3AU4 A;  4JHK A;  3CEQ A;  3LYA A;  2DWZ A;  4DRX E;  1PC2 A;  1JWF A;  4F3V A;  1OWN A;  4FA6 A;  3D9M A;  4CZ2 D;  4GZ5 A;  2P2C P;  3EIQ C;  2XS8 A;  3JYS A;  3LEW A;  1LF8 A;  3SY2 A;  1Q2Z A;  5JJ6 A;  4C9B B;  3CHQ A;  2PZI A;  3AJI A;  4ATG A;  2V5Q C;  1FPP A;  3G2T A;  4ATZ D;  2R59 A;  2X38 A;  1TJC A;  4IN3 B;  1KZP A;  2CFZ A;  3DWL G;  3MX3 A;  4DI3 A;  2Y1L E;  2GRO B;  2EIM E;  2E0I A;  2EIJ E;  2DYS E;  5T4Y A;  5G05 C;  4GZD A;  5B1B E;  4N3C A;  2GRP B;  3KSQ A;  3NF1 A;  4ZHB A;  4NAC A;  1H6P A;  4HLL A;  2WMN A;  2GRL A;  4JA9 A;  5JJ7 A;  1GW6 A;  4JB8 P;  5ANR A;  2RFM A;  4GTO A;  1OUV A;  2ETC A;  3Q9N C;  3R9M A;  3AS4 A;  3CIA A;  2RG8 A;  2RD0 A;  1MJ0 A;  1MZC A;  4M3O A;  5BV0 A;  1MX6 A;  3KEA A;  3QAR A;  3L13 A;  3KAE A;  4I1M A;  3PE3 A;  3DEP A;  4HI8 A;  4K5B A;  1HXI A;  3CVP A;  4OAV B;  4LCT A;  1L5J A;  2VTB A;  4GTP A;  3CGH A;  2XEE A;  5JJT A;  3ZKJ A;  5AQ7 A;  3W9G A;  4CGW A;  1PAQ A;  2WQ6 A;  4AEZ C;  4PS8 A;  2XS1 A;  2VGY A;  3C3R A;  4UWH A;  3JCK C;  3U3W A;  1Y8M A;  3T8M A;  3DST A;  2J09 A;  1OCO E;  1SQM A;  3S7F A;  3JXI A;  4R7L A;  1HFA A;  3R7R A;  5CEA A;  3SHF A;  1AWC B;  4J8E A;  4U07 A;  1K3Z D;  4FUL A;  3Q15 A;  4U0U A;  4BT9 A;  4F7A A;  3ZFW A;  4CYM D;  1SVX A;  4GA1 A;  4HRN A;  2GRM A;  3SGH A;  2FI7 A;  5G2N A;  2OV8 A;  1JCR A;  2NSZ A;  3HXD A;  4TXQ A;  3ONL A;  5EDS A;  1E8X A;  2F37 A;  4GA0 A;  4TUM A;  2BKG A;  4EBA G;  2P58 C;  3Q4A B;  4APF A;  5AEN A;  2KC7 A;  3FTV A;  1LD8 A;  3DXK G;  3T5V A;  3TWT A;  1HF8 A;  4TRQ A;  2XQ0 A;  5EX3 A;  1EDU A;  4AY6 A;  1S63 A;  4AV7 A;  2Y3A A;  3Q9U C;  5J90 A;  3ASH A;  4ANW A;  5BNW A;  3I5P A;  1BPO A;  4TXP A;  3B13 A;  5FQ4 A;  2EIL E;  3CK8 A;  4KBQ A;  5LCW C;  3EDT B;  2CG3 A;  2IU1 A;  3V79 K;  3FY4 A;  3K9I A;  2J8S D;  3G2V A;  2WXJ A;  2ETA A;  4J8F A;  3G2S A;  3C98 A;  4JEU A;  4AXH A;  1JCQ A;  3HXC A;  2WQH A;  4MRU A;  4UWF A;  2J08 A;  2XPZ A;  4Y6W A;  5T3R A;  3SBS A;  2Q7F A;  4GA2 A;  2WXQ A;  4MBG A;  3MV3 B;  2PQR A;  5CER B;  2HE0 A;  4WND A;  2Y0B G;  4BX8 A;  5M72 A;  1BLX B;  5KJM A;  4G8K A;  4F1P A;  1U2V G;  2B0O E;  1KT0 A;  4HOR A;  3QWV A;  3I4G A;  3TAX A;  2Y4T A;  4J7W A;  4BER A;  2R2L A;  4MKT A;  2DBA A;  4M7C A;  3NOC D;  4BSX A;  3CHR A;  1JUQ A;  3PE4 A;  1V55 E;  2HR2 A;  2EQX A;  2XEV A;  3Q75 A;  3ZXP A;  4HVB A;  2ZGD A;  4HI9 A;  3TWR A;  3EHN A;  4ILH B;  3MA5 A;  4LEU A;  4JEH A;  1BI8 B;  4C0M A;  3ESK A;  2FUL A;  2E2E A;  3ASD A;  4EPZ A;  4HRL A;  4HNA D;  4LG6 A;  1MQS A;  4URK A;  3CHS A;  2OVF A;  5AN8 A;  3R7Q A;  5LX8 A;  2WXR A;  3DSV A;  5JHB A;  1SA5 A;  3NBN B;  2VSN A;  3MKQ B;  3G2U A;  3UQ3 A;  5AJD A;  4GTM A;  4E6H A;  4AIF A;  2H6I A;  3J5Q B;  2YNQ A;  4WWO A;  5BW8 C;  3RRU A;  4IYP A;  5CRU A;  2VGX B;  5J08 A;  1A17 A;  5D66 A;  4EBA A;  3CLJ A;  4E85 A;  1PY1 A;  3D9N A;  3GZ1 A;  3IHY A;  3LPZ A;  2V5F A;  3PEU B;  1HU3 A;  2P9P G;  2Y4U A;  4XZ4 A;  3LCA A;  1O1T A;  2BED A;  3AS5 A;  3ABM E;  4KMO A;  5EIL A;  5AQ9 A;  5KNH D;  1JCS A;  2J49 A;  3ZU7 B;  3D9P A;  4A3T A;  3MJW A;  2LXM A;  1QNF A;  2VSY A;  2EIN E;  3VTX A;  4L2L A;  1K1B A;  5FQ6 A;  2KXP C;  2GGF A;  5AQB A;  1WG0 A;  2DYR E;  3ASF A;  4L9P A;  4PS7 A;  3ASO E;  3TWU A;  1ZB1 A;  1IHB A;  1N0R A;  3FWV A;  3ESL A;  1H19 A;  2H6G A;  2RFA A;  3GZS A;  3HYM B;  3LDZ A;  3PRZ A;  3OTN A;  3Q78 A;  3FH7 A;  4JZY A;  4D10 C;  3U66 A;  4L1B A;  2IJG X;  2LSU A;  4XKC A;  3EU5 A;  3CQG B;  3FH8 A;  2AVP A;  3CR3 A;  4XE0 A;  3FUK A;  1U3C A;  3CV0 A;  3S7B A;  2DVW A;  4ILI A;  3Q7F A;  1O1R A;  5FJY A;  1JPL A;  3UKU G;  4J8D A;  1KLX A;  4JW1 A;  1H2V C;  3FUI A;  4G2V A;  1H0A A;  2P9N G;  2DIW A;  3ENE A;  4GU5 A;  3ZXS A;  5LFA A;  1N4R A;  5CBO A;  3FH5 A;  3V31 A;  2XGS A;  3SZ7 A;  2YQ8 A;  1ELW A;  1MX4 A;  4GAA A;  3LJ3 A;  3FHE A;  3L08 A;  1H6O A;  4ANV A;  4DK5 A;  2ETB A;  2I1K A;  5C2Y A;  4U95 D;  3FTS A;  3LY9 A;  2YHC A;  1S0P A;  4C48 B;  4DX1 A;  2L0I A;  2LSV A;  3MYV A;  4HLE A;  3SFX A;  5LP0 A;  4A1S A;  1K1A A;  2CHX A;  3CVW A;  4HS2 A;  5DBK A;  1LTX A;  4A63 B;  2FEZ A;  1QYM A;  1ZBP A;  3FUL A;  4JD2 G;  2PNN A;  3WXX A;  3EHQ A;  5CCL A;  3FUH A;  2WXN A;  5FZR A;  3V2X A;  3VLD A;  4A55 A;  3B7R L;  3CVL A;  5ENN A;  3CSF A;  1INZ A;  2BUG A;  3ZHE A;  4FP7 A;  3PDN A;  4FC8 A;  3CVQ A;  3FUN A;  3LS8 A;  4AP2 A;  3T8K A;  5BXO A;  4I2W A;  3CVY A;  3UIO C;  4Y6C A;  1UW4 B;  2ZGG A;  1E96 B;  4UUC A;  5KJL A;  4GTT A;  5JHA A;  4JPS A;  2QFC A;  1N4Q A;  1WY6 A;  3FUD A;  1NL4 A;  2V4H C;  4B89 A;  4LRZ A;  5FQ8 A;  2LUH A;  3SF4 A;  5FWQ A;  2XCC A;  3ZVV A;  3DSW A;  3AG3 E;  3SFZ A;  3AS8 A;  1KZO A;  4GYW A;  3QWP A;  4YDE A;  1X5B A;  1SZA A;  3FUM A;  2X6F A;  4PH4 B;  3CVX A;  2VSX E;  4CEM A;  4V3I A;  3MEK A;  3JQ1 A;  4OVV A;  4GYY A;  2QC9 A;  2VJ8 A;  2WXG A;  3E30 A;  3UT7 A;  2I2O A;  1U3D A;  3Q5M A;  4JVS A;  3OAW A;  2KCL A;  2ZXW E;  1YYH A;  1DVP A;  1UJK A;  4ILG A;  3ZYM A;  1HX8 A;  3D9J A;  4O6F A;  3ONK A;  4ACL A;  3C5R A;  4DJA A;  2XHE A;  3S2A A;  2M63 A;  3E32 A;  2B6C A;  2WB2 A;  1E7V A;  5AAO A;  2UY1 B;  3U4T A;  5ARG A;  3FTX A;  1ELK A;  3BG0 B;  3TJP A;  4HBD A;  4ACK A;  3URZ A;  2NC9 A;  4UWK A;  2X6I A;  2PM6 A;  3U9W A;  3HVE A;  4KYO B;  2KBX A;  4L23 A;  5H7P A;  1UG3 A;  2IY0 C;  1B89 A;  4NUR A;  1FCH A;  3FFL A;  4WUY A;  1E8Z A;  1S70 B;  4YVO A;  3DSX A;  3AU5 A;  4BX9 A;  4UWL A;  1N94 A;  4OAU C;  4F53 A;  4IUL A;  1ELR A;  3I4R B;  3TWV A;  5A23 A;  3PS6 A;  2ZIS A;  2J07 A;  4U8H A;  2VSO E;  4K0R A;  3CVN A;  4B0Z A;  4L7T A;  1EF1 C;  5CMY A;  3CVU A;  5ENR D;  1MHQ A;  2XPY A;  2ILR A;  3ABL E;  3D9O A;  4CGV A;  4GCN A;  3TG4 A;  3HG0 D;  2VQ2 A;  2MOW A;  4UI9 J;  1S64 A;  1WM5 A;  3PUK A;  1BU9 A;  3RRN B;  1EPU A;  3FU3 A;  3PZD A;  5CRV A;  4YND A;  3QDN A;  1HO8 A;  4GTV A;  3LXU X;  1YMP A;  4N5Q A;  3PZ1 A;  4YDY A;  4CRW A;  2WMO A;  2A4Z A;  5FIN A;  5KJK A;  4HOQ A;  2MRI A;  4KT6 B;  1X81 A;  4DX6 D;  5FZQ A;  3ZW3 A;  1H2T C;  5HRY A;  4J8Y A;  5AAR A;  5EKQ D;  4FAD A;  5FIO A;  3HXF A;  3QJZ A;  3LVQ E;  3FTY A;  2CFU A;  4N2Q A;  4G25 A;  3JQ0 A;  1FT2 A;  4EZL A;  1O1S A;  4MLP A;  3D9K A;  4CT0 A;  5D0O D;  4ABN A;  3ZUV B;  5ANL A;  4U04 A;  2R02 A;  1E7U A;  3PZ3 A;  4AOF A;  1RZ4 A;  4I43 A;  1EYH A;  3X2Q E;  5BV1 A;  2H6F A;  4YVQ C;  5FZS A;  3N71 A;  2V4L A;  4HOU A;  4FU3 A;  3CK7 A;  5AIJ A;  3PZ2 A;  3L22 A;  3TXN A;  4BSZ B;  2WXK A;  2QYJ A;  5KWD A;  4G11 A;  3DBS A;  3BEE A;  3UX4 A;  2IEJ A;  4FHK A;  4XKB A;  2YIN A;  1E8W A;  4B8A A;  2WXM A;  5FQ7 A;  2I9C A;  4GZ3 A;  3PZ4 A;  3RIB A;  1JWG A;  2AXU A;  4HQD A;  1FVH A;  4IRU A;  1IHG A;  1UJJ A;  1W3B A;  4I6G A;  2C2L A;  4ZFH A;  4DX2 A;  3QKY A;  3Q49 B;  4I2Z A;  1NI1 A;  2WQ7 A;  5ARF A;  3C3Q A;  3AG4 E;  3NZU A;  3SO8 A;  3SQV A;  2L6B A;  3ASN E;  3RU0 A;  2DZN A;  2F0Y A;  3DSS A;  5CED B;  4LSZ E;  3DEO A;  1VDY A;  5CHE E;  2Y69 E;  2VTB B;  4U63 A;  4BET A;  4I6E A;  4GPK A;  2PQN A;  1MYO A;  3ZYL A;  4CCA A;  4WWP A;  4N3B A;  2IO2 C;  2FO7 A;  4JL0 A;  4EQF A;  4K03 A;  2KM4 A;  3ZGQ A;  3MZL B;  2OND A;  4J6I A;  3FTU A;  4P29 A;  5CBN A;  2P9L G;  3SI5 A;  2WPV A;  3EU9 A;  4J0U A;  2AJA A;  4UQZ A;  4BWR A;  3FU0 A;  2KZT B;  3F6Q A;  4PUC A;  2QY7 A;  2MHK A;  5EX0 A;  5HQ8 A;  3UT4 A;  3CHP A;  3D9H A;  2OOE A;  4GZ6 A;  1UOH A;  4PDX A;  4XEI G;  2NXP A;  3QNK A;  3B95 A;  1XGW A;  1E90 A;  2BKK B;  4LER A;  2I6H A;  3RO3 A;  4DX5 D;  2UWJ G;  4QFV A;  2XPI A;  3PH0 C;  4N3A A;  3ULY A;  4U7E B;  3IKO B;  3APF A;  1NZN A;  5FT9 A;  4GYO A;  3FUJ A; 
#chains in the Genus database with same CATH homology
 1O1R A;  3DSU A;  4LNG A;  1N9A A;  3E37 A;  1NI1 A;  1JCR A;  1X81 A;  1O1T A;  2BED A;  1TN7 A;  3HXD A;  1TNO A;  1TNY A;  3HXF A;  1O5M A;  2F0Y A;  4GTO A;  4GTT A;  3Q7A A;  3SFY A;  3DSS A;  1JCS A;  3DPY A;  1N4Q A;  1N4R A;  2ZIR A;  1NL4 A;  1MZC A;  3Q73 A;  1LD8 A;  1FT1 A;  1N4P A;  2R2L A;  1QBQ A;  1TNZ A;  4GTQ A;  1FT2 A;  4YDO A;  4EHM A;  1TN8 A;  3DSW A;  3Q75 A;  1O1S A;  1KZO A;  3DSX A;  1N4S A;  4YDE A;  1S63 A;  3E34 A;  1N94 A;  4GTS A;  4L9P A;  1TN6 A;  3PZ3 A;  3EUV A;  3SFX A;  4GTP A;  2H6F A;  3DRA A;  2H6H A;  2ZIS A;  1D8E A;  3HXE A;  1LTX A;  3Q79 A;  1D8D A;  2H6G A;  3PZ2 A;  1FPP A;  1TNU A;  3E30 A;  3DSV A;  1SA5 A;  3DST A;  3Q78 A;  2IEJ A;  3HXB A;  1KZP A;  4GTM A;  1N95 A;  1JCQ A;  3HXC A;  1S64 A;  2H6I A;  3C72 A;  1DCE A;  3E33 A;  3EU5 A;  3Q7F A;  3PZ4 A;  3KSL A;  3E32 A;  1SA4 A;  4GTR A;  4MBG A;  4GTV A;  3KSQ A;  1LD7 A;  3PZ1 A;  4LNB A;  1TNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...