4BETA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein (inactive h229a mutant) in complex with cytidine-diphosphate-choline
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
480
structure length
480
Chain Sequence
MPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLAPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELISAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Transferase
total genus 160
structure length 480
sequence length 480
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4betA02
4HRMB 4CYMD 5JA4D 3T9KA 2DZNA 5FIOA 2XZTG 4BEPA 4JB8P 2F37A 4O1PA 1MX6A 2DVWA 3TWWA 3B7BA 4HQDA 1BLXB 4CZ2D 5KNHD 4UUCA 5ENTD 3V30A 1MYOA 1K1BA 3F6QA 5AAOA 2FO1E 1UOHA 3V2XA 3UXGA 4RLYA 3D9HA 1BI8B 1K1AA 3JXJA 3TWUA 5KWDA 3ZUVB 4YDYA 2XEHA 5CBOA 1NFIE 2JABA 4U8YD 5BXOA 2F8XK 4YDWA 3ZU7B 1YMPA 2BKGA 4U96D 2VGEA 5ENQD 2DWZA 4C48B 5CEAA 1SVXA 4HI9A 2DZOA 2V4HC 1DCQA 4ZFHA 2XEEA 4QQIA 4OAVB 1SW6A 2ETCA 1TR4A 3TWSA 1N0QA 1A5EA 2KXPC 4OAUC 3EU9A 4DX5D 4DX2A 3EHQA 1AWCB 3J5PA 3C5RA 4BETA 1D9SA 4HRLA 5EYLA 3UI2A 4LG6A 3V31A 3AJIA 3HRAA 1BD8A 5EIDA 2KBXA 5AQ7A 3V2OA 1MX2A 1QYMA 5FINA 5AQBA 2B0OE 4O1OA 1BI7B 5AN8A 3V79K 3EHRA 4J8YA 5ENSD 2V5QC 4U8VD 4ATZD 1IHBA 2NYJA 4BESA 5JMND 5HS0A 1MX4A 2A5EA 1DC2A 1WDYA 1OT8A 4K5BA 4DX7D 3Q9NC 3TWQA 1AP7A 4Z68A 5KNGA 5EIBE 4DRXE 3W9FA 5EN5D 3W9GA 2HE0A 3TWXA 1S70B 4J7WA 4K5AB 3JXIA 2RFAA 3DEPA 4HB5A 4NIKA 2ZGGA 5D66A 4HNAD 3UTMA 2P2CP 3LJNA 4HI8A 4B93B 4O60A 3SO8A 3DEOA 2RFMA 2QC9A 3IXEA 3J5QB 5ENPD 3T8KA 3TWTA 2J8SD 4ZHBA 3NOCD 1N0RA 4BSZB 4GMRA 2ZGDA 4LNUD 3KEAA 3NBNB 5KBAA 5CERB 5CEDB 5BXUA 4DUIA 1MJ0A 4U95D 1BU9A 4K5CA 3ZKJA 4HRNA 2PNNA 2L6BA 5HKPA 4G8LA 5ENRD 5EYPF 5ITZF 5CBNA 3B95A 2MYOA 4A63B 5AQ9A 2Y0BG 3JUEA 4N5QA 3ZNGA 4TUMA 4F6RD 1IXVA 1G3NB 5CECB 1IKND 4GPMA 2F8YA 3Q9UC 4DX1A 1YYHA 1N11A 1OY3D 5HRYA 5ENOD 5EILA 2Y1LE 4G8KA 3TWVA 4HBDA 4BERA 4F1PA 5AARA 2ETAA 2ETBA 4QFVA 3TWRA 2QYJA 4DX6D 3HG0D 2XZDG 3NOGD 2BKKB 4LSZE 1YCSB 5AQAA 1WG0A 3AAAC 4HLLA 1K3ZD 2AJAA 2XENA
chains in the Genus database with same CATH superfamily
3U9WA 4XKBA 5CRUA 2XS8A 1UN9A 4BT8A 3UKRG 1TJFA 1JCSA 3OXFA 4UUCA 1K1BA 2C2LA 3D9PA 2EIJE 2DYRE 2LUHA 3EHMA 5G04C 5BXOA 2GRQB 2DYSE 2BKGA 2LXLA 4KMOA 4GZ6A 3MX3A 5T3RA 5CCMA 4AOFA 4I17A 1HFAA 2IF4A 5IY5E 3HRAA 2XHEA 4MRUA 4KYOB 5AQ7A 4B0ZA 3DSUA 1QYMA 3FUFA 3WXXA 1N4RA 3BU8A 4J8YA 2R17C 4DLOA 3TG4A 1IYGA 5HS0A 1LF8A 1GW6A 2A5EA 2MRIA 3L54A 3U64A 5EN5D 3PNTB 5JJ6A 3ONKA 2XGOA 4K5AB 5LOZA 4A1SA 4XE0A 3ASDA 2J4BA 3BEEA 2XS1A 2OEWA 4EQFA 5DBKA 1JWFA 4GZ5A 1KT0A 3FDHA 3FTZA 2XEVA 4PH4B 4GA1A 3MKQB 4G2VA 2VGYA 4HOUA 3L17A 1EYHA 1WG0A 3UM0A 3GZ2A 4J0UA 2XENA 4PS3A 3VLEA 4L2LA 4BEPA 4JB8P 1X5BA 4AM9A 3PUJA 1KLXA 4NRHB 4BSXA 3JXJA 3CVXA 4O6FA 2WQ6A 4C0MA 2V4LA 1Q2ZA 4A3TA 3CSFA 2CHZA 3QNKA 2I9CA 3PRZA 4L23A 4I6EA 3IKOB 3S7JA 1EDUA 1DCQA 2I1JA 2I6HA 4A3VA 5J90A 3TXNA 4N3AA 4DX2A 2WMNA 3RJVA 5M72A 4UWGA 2OV8A 4KVOA 4JZYA 4N2QA 4TXQA 2VSNA 3HXEA 1OWOA 2VJ8A 1D8EA 3W9FA 2X6IA 3UUXA 5FQ6A 2IU1A 1S70B 4U63A 2R2LA 3FP3A 1NP7A 1TEZA 2P2CP 1Z5SC 1RZ4A 3LPZA 4DPRA 3EU5A 2J8SD 5FZRA 2Y4UA 3KEAA 2L6JA 3B7RL 4PS8A 3QC1A 1FPPA 2L6BA 2AXZA 1HF8A 2Y0BG 3ML8A 3G2TA 4J8DA 3QJZA 4KBQA 3UPVA 3QB2A 3OXGA 5G2NA 2P9SG 1IQRA 3D9MA 3MV3B 4C9BB 4APOA 1JWGA 5JA4D 3ASOE 4O1PA 5B3SE 5KNHD 2IO2C 2DBAA 4LERA 4EHMA 4GYWA 1IHGA 4WWNA 4L1BA 3MEKA 2LAIA 2DCPA 1DNPA 3LYAA 1TNYA 2FBNA 4ABNA 4C48B 2XEEA 2WB2A 1SW6A 2UWJG 2MHKA 1N0QA 2ZIRA 5EX3A 3CHOA 5CHEE 2V5QC 4XKCA 3MA5A 3LY7A 2LSUA 2MOWA 3PZDA 3ASHA 3TWQA 4M3OA 4A55A 1HG2A 3SD5A 3QWWA 2OOEA 3DRAA 2VGXA 4W9RA 3JUIA 5LCWJ 2PQRA 3DEOA 3OTNA 2AXUA 1N95A 2CFUA 2QC9A 3FUHA 5ENPD 4AEZC 4RQIA 3SQVA 1PY1A 4KXKB 2J09A 3G2VA 4GCNA 2LSVA 5AJDA 4V3IA 3JUEA 4F6RD 2FULA 5B1AE 2XPIA 2H6IA 5ENOD 4U07A 3C3OA 2AW6A 2Y1LE 3LS8A 2C0MA 2XZDG 4GZDA 2KM4A 4BTAA 2LAHA 3NZUA 2QZAA 3FUKA 3DSVA 4CZ2D 1N9AA 3AS4A 5C2YA 4I9CA 1Z6TA 2BTDA 3DSSA 5FWQA 2VSYA 4GAAA 1QQEA 1U3CA 3MJWA 4N2SA 1IQUA 5ENQD 1H19A 3E33A 3U66A 4GPKA 3L6AA 3CVUA 5EYLA 3T5VA 5ANRA 4XI0A 2KZTA 1MX2A 5E75A 3O4ZA 3APCA 4ILIA 1BI7B 4N39A 1H2TC 4X8QA 1SZ9A 2AWIA 1AP7A 4GA2A 2HE0A 3QOUA 4NIKA 3E30A 4HI8A 3CHQA 1E8WA 5BXUA 4AY6A 3ABLE 3SNXA 2GROB 5T4YA 2ZXWE 5CBNA 4HORA 3Q75A 3LXUX 2HM8A 3HVEA 4QFVA 3EUVA 3ZVVA 4DX6D 1HH8A 5AQAA 4HLLA 4JVSA 3T9KA 3AU5A 2YQ8A 3QAQA 1MZCA 3U3WA 4GTQA 4Y6CA 3ENEA 3R7RA 1S64A 5KWDA 1WAO1 2KCVA 1WY6A 3E4BA 1FVHA 1OXJA 2DWZA 5CEAA 4IYPA 3SF4A 2BF0X 2L0TB 2VSXE 3CIAA 4F7AA 3FUJA 3EHQA 2IOSA 3DPDA 4ACKA 5FQ4A 3ABME 3SBTB 1B89A 2B0OE 1O1RA 4GTOA 2UY1A 4YVOA 2X3MA 4UWHA 2HO1A 1X81A 3PNLB 1FT1A 4EBAG 1ZU2A 4J7WA 3JQ0A 2RFAA 3Q49B 4HNAD 4BFRA 2RFMA 1H6OA 5LP0A 4FHJA 4JPSA 1HG5A 4JA7A 3D9IA 1Y8MA 4EZKA 3ZKJA 1N52A 4IRUA 2ONDA 2CHWA 3ZN3A 5BW8C 2P9LG 1OY3D 4XEIG 4DK5A 1BPOA 3ESKA 1L5JA 3CVVA 1JCRA 3FH7A 3TWWA 2EIME 5H7PA 2GRPB 5ARGA 1BI8B 3CVNA 4MLPA 3Q73A 4WUYA 2JABA 4XX5A 2J08A 3L13A 2WXKA 3HXFA 3FTWA 3ZPJA 5BV0A 2R05A 1V54E 5AYWD 3UMVA 4XI9A 3SGHA 2WXHA 4U8VD 2WPVA 3PZ2A 2P9KG 2WQHA 2OEVA 4B8CB 1HZ4A 4F3VA 4CDRA 3ULYA 4CCAA 2AVPA 4BX8A 3CVPA 4TXRA 3RRMB 2X38A 3Q15A 5LCWC 1N54A 1P5QA 4G23A 4I43A 4B93B 2E2EA 2QFCA 3MV2B 4JXTA 3CSTA 3R9MA 3RO2A 3BG1B 3OXLA 5CERB 3MKQA 4CRWA 4L9PA 1TN6A 4N3CA 3CLJA 2MYOA 2VQ2A 5CMWA 4EZLA 1IKND 4I6GA 4XIFA 3ZGQA 4XZ4A 5JJTA 1YCSB 1K3ZD 1WM5A 3B7BA 4AY5A 3VTYA 3D9HA 2XEHA 3TG5A 3KAEA 3R9AB 3OAWA 2NC9A 3AG4E 2V0PA 3TXMA 3HIZA 2Y4TA 3I5PA 1TR4A 4YNDA 5LFAA 3EU9A 1AWCB 4RG9A 3RU0A 3V31A 4GZCA 3CQCB 3EIQC 3ZYLA 4LCTA 4O1OA 5AN8A 1SZAA 1NL4A 1IHBA 5JMND 4E6HA 3ML9A 3CHMA 4I1MA 3ZHEA 4AP2A 3ZRHA 2BEDA 3MCXA 4CGWA 3LVRE 5ENNA 4GTVA 3CKBA 3NF1A 4AIFA 4O60A 3PZ3A 4HVBA 3RIBA 5BNWA 2P9IG 3U4TA 4YDEA 4H7XA 5J08A 1ELWA 3MGBA 4AV7A 3UM1A 5T8IA 4FLHA 3HXBA 1HX8A 4BTBA 3PEUB 4WWOA 5HKPA 5ENRD 4LRZA 4N5QA 3FH8A 3MZLB 4LUNU 3Q9UC 4GTRA 4CGVA 1N11A 2J9QA 2X6KA 3TWVA 3ASNE 3RAUA 5BV1A 3D9OA 3TWRA 2YINA 4GTMA 4HRMB 2J07A 2GRMA 5AIJA 3T8MA 2H6FA 3LJ3A 2GW1A 4BT9A 3PZ1A 3LKUA 3EJNA 3IBEA 1TYQG 4B8AA 3JYSA 2ZU6B 4RVBA 3PH0C 1SQMA 3ONLA 4PUCA 4QQIA 3GW4A 3MYVA 2GRNB 1OCZE 3ULQA 3CEQA 4BY6A 3C5RA 4NACA 3FTVA 4J6IA 3L82A 2KBXA 1KZOA 3PVLA 2XRZA 3LDZA 3EIJA 5EDSA 4FULA 2WXQA 2L9BA 1ZBPA 1ELRA 2PQNA 1DC2A 1OT8A 4DX7D 2H6HA 2WXIA 2LXMA 3FTYA 4HXIA 5AENA 4GA0A 2Q7FA 2IOLA 3X2QE 3DBSA 4JL0A 3SO8A 3C3QA 4GMJA 3KS2A 4OYSA 3NB2A 3P2BA 5KBAA 5CEDB 1MJ0A 1BU9A 2YNQA 3LEWA 3FTSA 5JHBA 4I1AA 4A1GA 4Q96A 5AARA 1H2UA 1UW4B 2QYJA 3HG0D 5KJNA 2F37A 3LVQE 4J8FA 4HLEA 4IN3B 3F6QA 2V8SE 3DWLG 2FO1E 4JD2G 3I3NA 2I2OA 1NA3A 2CG3A 2XCBA 4WWPA 4U8YD 2B6CA 4CDMA 5EKQD 4HI9A 2DZOA 1OWLA 3PUKA 1NA0A 2YHEA 2A4ZA 3TWSA 2RD0A 3CHRA 3NQPA 3J5PA 1TNOA 4GYOA 4WAFA 4LG6A 1BD8A 2X6FA 4UWFA 1TJCA 1MHQA 3HXDA 3SZ7A 2H6GA 2VGXB 4J8SA 1HXIA 1E90A 3IHYA 3D3MA 1S0PA 3W9GA 3VLFA 3ZYKA 3CHSA 2EINE 1Z3XA 3DEPA 2ZGGA 2JEKA 3HXCA 4I9EA 4D10C 4FLBA 3NOCD 3D9NA 3GZ1A 4G24A 1QBQA 4LNUD 1MQSA 4IULA 4DUIA 1FVFA 1N4SA 3ZYQA 3AS5A 2XGSA 4A63B 1G3NB 2F8YA 1YYHA 3ZFWA 4G8KA 1SA4A 3P1UA 3L9TA 4TRQA 3UX4A 5KJMA 2P9PG 3TGOA 2VSOE 5LX8A 2AJAA 3DPYA 2XZTG 2M63A 3JCKC 3FTUA 2WXFA 3E32A 2WXJA 3ZU7B 2NXPA 1U3DA 4GTSA 3VTXA 3Q78A 3RRNB 1EPUA 3BG0B 3SFYA 4HOTA 3V2OA 2E0IA 1TN7A 1O1SA 2VTBB 2CFZA 3EHRA 4FJZA 1NZNA 2R59A 2P9UG 5BT1A 4K5BA 3EHNA 4WNEA 4Z68A 3CVYA 2PM7A 2GGFA 3KEZA 3LY8A 2IONA 3LJNA 4RSYA 4JA9A 2LO6A 2IQCA 3CGHA 4UI9K 3HYMB 5ANLA 3DXMG 1OWPA 3ISMC 4L7TA 2XPYA 5AQ9A 4L2YA 4Q94A 2ZISA 3L22A 3QK0A 4K0RA 4BERA 4WNGA 2JLBA 4YDOA 4F1SA 3FH5A 4U7EB 1E96B 2ILRA 4CYMD 4B89A 5CRVA 2KCLA 4GMLA 3BQOA 1KT1A 2OVFA 4HQDA 2YHCA 4F53A 1DCEA 2WXPA 2V5FA 3KSQA 4JHKA 3Q7FA 1U2VG 2F8XK 1FCHA 4YDWA 1E8XA 1N94A 3FUDA 4TUUA 1A5EA 4OAUC 4U0UA 3PDNA 4UWLA 2UY1B 3N71A 4BX9A 2J49A 4AJWA 4GU5A 4HFGA 4KVMA 2F0YA 5ENSD 3SY2A 2WMOA 2NYJA 3NAWA 2FF4A 2PL2A 2XRYA 1ZB1A 3UM3A 3WG7E 2HR2A 3TWXA 3APFA 4G1TA 2KC7A 3QARA 4FJYA 3DSWA 3IXEA 3ZIMA 4JC8A 4WNDA 3LY9A 5BPPA 3GYZA 3DXKG 4MS6A 1S63A 1UN8A 4LNGA 1DVPA 3PREA 3ESLA 3CK7A 2DZNA 4UQYA 1QZ2A 3FULA 3FWVA 1HS6A 2WQ7A 4UQXA 5AAOA 4RLYA 4U8HA 3TWUA 4YDYA 3FU3A 3HHMA 5JJ7A 4FHKA 4TV3A 3FUEA 3AG3E 5FQ8A 3I4RB 1LD7A 1N4QA 3JQ1A 4BETA 4UI9J 3B7SA 3UI2A 2R03A 4CDNA 2XPZA 2IO3C 3FUIA 3NZSA 4EZJA 3SHFA 1WDYA 3Q9NC 2GRRB 2Y69E 4DRXE 4ANUA 4U0SA 3E34A 4HB5A 4JEUA 3CVQA 3DSXA 2IJGX 1Z3YA 4B94A 4AXHA 2WXMA 3CHPA 2AXVA 4AVXA 4PS7A 1VDYA 2XGMA 2WXRA 3CQGB 4K03A 4U95D 4BWRA 4FADA 3QDNA 1SA5A 2PNNA 5EYPF 2XCCA 4GPMA 1H6KA 4EBAA 4GYYA 4Q69A 4HBDA 1OUVA 3FY4A 3FUMA 3B13A 3CR3A 3G2UA 3UINC 3FU6A 1E7UA 2EIKE 1MX6A 5FJYA 5JHAA 3D9JA 5ENTD 4ATGA 4N5CA 4HOSA 4CT4A 4DI3A 4U96D 2VGEA 4ILGA 3E37A 3ZW3A 5CMYA 5DIZA 5B1BE 1SVXA 4OAVB 3HDXA 2ETCA 3KD7A 4APFA 4HRLA 3ASGA 3AJIA 3ZHEB 3VLDA 3GZSA 4OVVA 3SFZA 3V79K 4GCOA 4MKTA 3UIPC 1OCOE 3RO3A 1O1TA 2R5SA 5EIBE 3QKYA 4WNFA 4UQZA 5E76A 2OCCE 1E8YA 4I6JA 3CVWA 5D66A 2LNIA 4CT0A 2L0IA 3S7DA 4U0ZA 4FC8A 3J5QB 4UWKA 2HYZA 4GB9A 2IEJA 3QWVA 2R02A 4HRNA 3ZEFA 4GZ3A 5A7DB 1OCCE 4TUMA 1IXVA 4HOQA 2RKKA 4TXPA 3S7FA 4DX1A 5EILA 5A6CA 5G05J 3B7TA 1QNFA 4DJAA 3L08A 1NI1A 5D0QD 5C1DA 4DLQA 5FQ7A 3ULEG 5FIOA 2QYUA 3FHEA 3LCAA 3Q5MA 5ARFA 2DVWA 3SFXA 3UIOC 1N4PA 2WXOA 2KATA 3V30A 4CEMA 2C0LA 4G11A 1UOHA 3V2XA 3UXGA 4HS2A 4FA6A 3SBSA 5A23A 1UJKA 3KSLA 3ZXSA 3ZUVB 3UT7A 1NFIE 3D9KA 2IY0C 1W3BA 5G04J 3ZYMA 1JPLA 1A17A 1YA0A 2FEZA 1XGWA 3S7BA 3CK9A 3CKCA 4DX5D 2KCKA 3BUAA 4I1OB 3RSEG 3CVLA 2OVBA 2Y3AA 3O48A 5HI7A 3FFLA 1MX4A 4KT6B 1V55E 3DSTA 4URKA 3FU5A 1E7VA 1RW2A 2WVIA 3R7QA 3I4GA 3Q7AA 2EILE 4ANVA 4U04A 3JXIA 3UKUG 5BUZA 2XQ0A 3UT4A 3QWPA 5AJLA 1TNUA 4GTPA 4LNBA 4I2WA 3TWTA 5D0OD 3UT8A 3Q79A 3PS6A 1ELKA 3PZ4A 2PM6A 3AS8A 5CCLA 5ITZF 3FTXA 2P9NG 4MBGA 3ZNGA 1HO8A 1Y6IA 4RG6A 5FT9A 4DI4A 5KJLA 2WM9A 2X6HA 1UJJA 2FO7A 2ETAA 1OWNA 4FU3A 1JCQA 3NOGD 4LSZE 3AAAC 1OCRE 4J8EA 3IHVA 1LTXA 1H0AA 4EECA 3G2SA 1BLXB 3PEVB 1MYOA 2X6JA 2J4DA 5FZQA 4G25A 3FEXA 4ILHB 3TAXA 1K1AA 5KCMA 3FEYA 3MKRA 4JEHA 4ACLA 3S2AA 2P58C 2V4HC 4ZFHA 4JHJA 4UI9C 2VTBA 3ZXPA 4I2ZA 4NURA 3RKVA 1D9SA 2BUGA 5EIDA 3TL5A 4OVUA 3IV0A 2EQXA 5FINA 2FI7A 3C72A 2NSZA 4JW1A 4ATZD 2A5UA 2WXNA 2RG8A 1FT2A 2KZTB 4LEUA 3Q47B 4G26A 5G55A 3C98A 3K9IA 3D9LA 2DIWA 4KZ0A 3UTMA 1K8KG 2WXGA 1N0RA 4BSZB 2CHXA 3Q4AB 4GMRA 2ZGDA 1XNFA 2GRLA 4P29A 1OWMA 4R7LA 4ANXA 3RRUA 4YVQC 5CECB 1H2VC 5HQ8A 2ETBA 3URZA 1D8DA 3L16A 1TNBA 2BKKB 1TNZA 3HVEB 4C0EA 3AG1E 1H6PA 1PAQA 1HE8A 5CBOA 4ME2A 3CK8A 5EX0A 4EPZA 1YMPA 4JHRA 5D2MC 3T5XA 1O5MA 2KXPC 4M7CA 3IEGA 5FZSA 3ABKE 2IFUA 1PC2A 4N3BA 5FTPA 1KZPA 3FU0A 3C3RA 3RK6A 1E8ZA 5AQBA 3G2WA 4H7YA 4BESA 3EDTB 4FP7A 1UG3A 2QY7A 3AG2E 5KNGA 4GTTA 3AU4A 1INZA 2I1KA 2WXLA 2VYIA 4PDXA 1HU3A 3SI5A 4E85A 3UQ3A 3T8KA 1EF1C 4ZHBA 3PE3A 3ASFA 3B7UX 3NBNB 1KPSB 1LD8A 4K5CA 4ANWA 2PZIA 4G8LA 4KZCA 2CG2A 3B95A 1TN8A 4Y6WA 3CV0A 1JUQA 5G05C 3TJPA 5HRYA 3PE4A 5KJKA 3APDA 4F1PA 3UM2A 3FUNA 4NQ0A
chains in the Genus database with same CATH topology
4HRMB 4CYMD 5JA4D 3T9KA 2DZNA 5FIOA 2XZTG 4BEPA 4JB8P 2F37A 4O1PA 1MX6A 2DVWA 3TWWA 3B7BA 4HQDA 1BLXB 4CZ2D 5KNHD 4UUCA 5ENTD 3V30A 1MYOA 1K1BA 3F6QA 5AAOA 2FO1E 1UOHA 3V2XA 3UXGA 4RLYA 3D9HA 1BI8B 1K1AA 3JXJA 3TWUA 5KWDA 3ZUVB 4YDYA 2XEHA 5CBOA 1NFIE 2JABA 4U8YD 5BXOA 2F8XK 4YDWA 3ZU7B 1YMPA 2BKGA 4U96D 2VGEA 5ENQD 2DWZA 4C48B 5CEAA 1SVXA 4HI9A 2DZOA 2V4HC 1DCQA 4ZFHA 2XEEA 4QQIA 4OAVB 1SW6A 2ETCA 1TR4A 3TWSA 1N0QA 1A5EA 2KXPC 4OAUC 3EU9A 4DX5D 4DX2A 3EHQA 1AWCB 3J5PA 3C5RA 4BETA 1D9SA 4HRLA 5EYLA 3UI2A 4LG6A 3V31A 3AJIA 3HRAA 1BD8A 5EIDA 2KBXA 5AQ7A 3V2OA 1MX2A 1QYMA 5FINA 5AQBA 2B0OE 4O1OA 1BI7B 5AN8A 3V79K 3EHRA 4J8YA 5ENSD 2V5QC 4U8VD 4ATZD 1IHBA 2NYJA 4BESA 5JMND 5HS0A 1MX4A 2A5EA 1DC2A 1WDYA 1OT8A 4K5BA 4DX7D 3Q9NC 3TWQA 1AP7A 4Z68A 5KNGA 5EIBE 4DRXE 3W9FA 5EN5D 3W9GA 2HE0A 3TWXA 1S70B 4J7WA 4K5AB 3JXIA 2RFAA 3DEPA 4HB5A 4NIKA 2ZGGA 5D66A 4HNAD 3UTMA 2P2CP 3LJNA 4HI8A 4B93B 4O60A 3SO8A 3DEOA 2RFMA 2QC9A 3IXEA 3J5QB 5ENPD 3T8KA 3TWTA 2J8SD 4ZHBA 3NOCD 1N0RA 4BSZB 4GMRA 2ZGDA 4LNUD 3KEAA 3NBNB 5KBAA 5CERB 5CEDB 5BXUA 4DUIA 1MJ0A 4U95D 1BU9A 4K5CA 3ZKJA 4HRNA 2PNNA 2L6BA 5HKPA 4G8LA 5ENRD 5EYPF 5ITZF 5CBNA 3B95A 2MYOA 4A63B 5AQ9A 2Y0BG 3JUEA 4N5QA 3ZNGA 4TUMA 4F6RD 1IXVA 1G3NB 5CECB 1IKND 4GPMA 2F8YA 3Q9UC 4DX1A 1YYHA 1N11A 1OY3D 5HRYA 5ENOD 5EILA 2Y1LE 4G8KA 3TWVA 4HBDA 4BERA 4F1PA 5AARA 2ETAA 2ETBA 4QFVA 3TWRA 2QYJA 4DX6D 3HG0D 2XZDG 3NOGD 2BKKB 4LSZE 1YCSB 5AQAA 1WG0A 3AAAC 4HLLA 1K3ZD 2AJAA 2XENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRM B;  4CYM D;  5JA4 D;  3T9K A;  2DZN A;  5FIO A;  2XZT G;  4BEP A;  4JB8 P;  2F37 A;  4O1P A;  1MX6 A;  2DVW A;  3TWW A;  3B7B A;  4HQD A;  1BLX B;  4CZ2 D;  5KNH D;  4UUC A;  5ENT D;  3V30 A;  1MYO A;  1K1B A;  3F6Q A;  5AAO A;  2FO1 E;  1UOH A;  3V2X A;  3UXG A;  4RLY A;  3D9H A;  1BI8 B;  1K1A A;  3JXJ A;  3TWU A;  5KWD A;  3ZUV B;  4YDY A;  2XEH A;  5CBO A;  1NFI E;  2JAB A;  4U8Y D;  5BXO A;  2F8X K;  4YDW A;  3ZU7 B;  1YMP A;  2BKG A;  4U96 D;  2VGE A;  5ENQ D;  2DWZ A;  4C48 B;  5CEA A;  1SVX A;  4HI9 A;  2DZO A;  2V4H C;  1DCQ A;  4ZFH A;  2XEE A;  4QQI A;  4OAV B;  1SW6 A;  2ETC A;  1TR4 A;  3TWS A;  1N0Q A;  1A5E A;  2KXP C;  4OAU C;  3EU9 A;  4DX5 D;  4DX2 A;  3EHQ A;  1AWC B;  3J5P A;  3C5R A;  4BET A;  1D9S A;  4HRL A;  5EYL A;  3UI2 A;  4LG6 A;  3V31 A;  3AJI A;  3HRA A;  1BD8 A;  5EID A;  2KBX A;  5AQ7 A;  3V2O A;  1MX2 A;  1QYM A;  5FIN A;  5AQB A;  2B0O E;  4O1O A;  1BI7 B;  5AN8 A;  3V79 K;  3EHR A;  4J8Y A;  5ENS D;  2V5Q C;  4U8V D;  4ATZ D;  1IHB A;  2NYJ A;  4BES A;  5JMN D;  5HS0 A;  1MX4 A;  2A5E A;  1DC2 A;  1WDY A;  1OT8 A;  4K5B A;  4DX7 D;  3Q9N C;  3TWQ A;  1AP7 A;  4Z68 A;  5KNG A;  5EIB E;  4DRX E;  3W9F A;  5EN5 D;  3W9G A;  2HE0 A;  3TWX A;  1S70 B;  4J7W A;  4K5A B;  3JXI A;  2RFA A;  3DEP A;  4HB5 A;  4NIK A;  2ZGG A;  5D66 A;  4HNA D;  3UTM A;  2P2C P;  3LJN A;  4HI8 A;  4B93 B;  4O60 A;  3SO8 A;  3DEO A;  2RFM A;  2QC9 A;  3IXE A;  3J5Q B;  5ENP D;  3T8K A;  3TWT A;  2J8S D;  4ZHB A;  3NOC D;  1N0R A;  4BSZ B;  4GMR A;  2ZGD A;  4LNU D;  3KEA A;  3NBN B;  5KBA A;  5CER B;  5CED B;  5BXU A;  4DUI A;  1MJ0 A;  4U95 D;  1BU9 A;  4K5C A;  3ZKJ A;  4HRN A;  2PNN A;  2L6B A;  5HKP A;  4G8L A;  5ENR D;  5EYP F;  5ITZ F;  5CBN A;  3B95 A;  2MYO A;  4A63 B;  5AQ9 A;  2Y0B G;  3JUE A;  4N5Q A;  3ZNG A;  4TUM A;  4F6R D;  1IXV A;  1G3N B;  5CEC B;  1IKN D;  4GPM A;  2F8Y A;  3Q9U C;  4DX1 A;  1YYH A;  1N11 A;  1OY3 D;  5HRY A;  5ENO D;  5EIL A;  2Y1L E;  4G8K A;  3TWV A;  4HBD A;  4BER A;  4F1P A;  5AAR A;  2ETA A;  2ETB A;  4QFV A;  3TWR A;  2QYJ A;  4DX6 D;  3HG0 D;  2XZD G;  3NOG D;  2BKK B;  4LSZ E;  1YCS B;  5AQA A;  1WG0 A;  3AAA C;  4HLL A;  1K3Z D;  2AJA A;  2XEN A; 
#chains in the Genus database with same CATH topology
 3U9W A;  4XKB A;  5CRU A;  2XS8 A;  1UN9 A;  4BT8 A;  3UKR G;  1TJF A;  1JCS A;  3OXF A;  4UUC A;  1K1B A;  2C2L A;  3D9P A;  2EIJ E;  2DYR E;  2LUH A;  3EHM A;  5G04 C;  5BXO A;  2GRQ B;  2DYS E;  2BKG A;  2LXL A;  4KMO A;  4GZ6 A;  3MX3 A;  5T3R A;  5CCM A;  4AOF A;  4I17 A;  1HFA A;  2IF4 A;  5IY5 E;  3HRA A;  2XHE A;  4MRU A;  4KYO B;  5AQ7 A;  4B0Z A;  3DSU A;  1QYM A;  3FUF A;  3WXX A;  1N4R A;  3BU8 A;  4J8Y A;  2R17 C;  4DLO A;  3TG4 A;  1IYG A;  5HS0 A;  1LF8 A;  1GW6 A;  2A5E A;  2MRI A;  3L54 A;  3U64 A;  5EN5 D;  3PNT B;  5JJ6 A;  3ONK A;  2XGO A;  4K5A B;  5LOZ A;  4A1S A;  4XE0 A;  3ASD A;  2J4B A;  3BEE A;  2XS1 A;  2OEW A;  4EQF A;  5DBK A;  1JWF A;  4GZ5 A;  1KT0 A;  3FDH A;  3FTZ A;  2XEV A;  4PH4 B;  4GA1 A;  3MKQ B;  4G2V A;  2VGY A;  4HOU A;  3L17 A;  1EYH A;  1WG0 A;  3UM0 A;  3GZ2 A;  4J0U A;  2XEN A;  4PS3 A;  3VLE A;  4L2L A;  4BEP A;  4JB8 P;  1X5B A;  4AM9 A;  3PUJ A;  1KLX A;  4NRH B;  4BSX A;  3JXJ A;  3CVX A;  4O6F A;  2WQ6 A;  4C0M A;  2V4L A;  1Q2Z A;  4A3T A;  3CSF A;  2CHZ A;  3QNK A;  2I9C A;  3PRZ A;  4L23 A;  4I6E A;  3IKO B;  3S7J A;  1EDU A;  1DCQ A;  2I1J A;  2I6H A;  4A3V A;  5J90 A;  3TXN A;  4N3A A;  4DX2 A;  2WMN A;  3RJV A;  5M72 A;  4UWG A;  2OV8 A;  4KVO A;  4JZY A;  4N2Q A;  4TXQ A;  2VSN A;  3HXE A;  1OWO A;  2VJ8 A;  1D8E A;  3W9F A;  2X6I A;  3UUX A;  5FQ6 A;  2IU1 A;  1S70 B;  4U63 A;  2R2L A;  3FP3 A;  1NP7 A;  1TEZ A;  2P2C P;  1Z5S C;  1RZ4 A;  3LPZ A;  4DPR A;  3EU5 A;  2J8S D;  5FZR A;  2Y4U A;  3KEA A;  2L6J A;  3B7R L;  4PS8 A;  3QC1 A;  1FPP A;  2L6B A;  2AXZ A;  1HF8 A;  2Y0B G;  3ML8 A;  3G2T A;  4J8D A;  3QJZ A;  4KBQ A;  3UPV A;  3QB2 A;  3OXG A;  5G2N A;  2P9S G;  1IQR A;  3D9M A;  3MV3 B;  4C9B B;  4APO A;  1JWG A;  5JA4 D;  3ASO E;  4O1P A;  5B3S E;  5KNH D;  2IO2 C;  2DBA A;  4LER A;  4EHM A;  4GYW A;  1IHG A;  4WWN A;  4L1B A;  3MEK A;  2LAI A;  2DCP A;  1DNP A;  3LYA A;  1TNY A;  2FBN A;  4ABN A;  4C48 B;  2XEE A;  2WB2 A;  1SW6 A;  2UWJ G;  2MHK A;  1N0Q A;  2ZIR A;  5EX3 A;  3CHO A;  5CHE E;  2V5Q C;  4XKC A;  3MA5 A;  3LY7 A;  2LSU A;  2MOW A;  3PZD A;  3ASH A;  3TWQ A;  4M3O A;  4A55 A;  1HG2 A;  3SD5 A;  3QWW A;  2OOE A;  3DRA A;  2VGX A;  4W9R A;  3JUI A;  5LCW J;  2PQR A;  3DEO A;  3OTN A;  2AXU A;  1N95 A;  2CFU A;  2QC9 A;  3FUH A;  5ENP D;  4AEZ C;  4RQI A;  3SQV A;  1PY1 A;  4KXK B;  2J09 A;  3G2V A;  4GCN A;  2LSV A;  5AJD A;  4V3I A;  3JUE A;  4F6R D;  2FUL A;  5B1A E;  2XPI A;  2H6I A;  5ENO D;  4U07 A;  3C3O A;  2AW6 A;  2Y1L E;  3LS8 A;  2C0M A;  2XZD G;  4GZD A;  2KM4 A;  4BTA A;  2LAH A;  3NZU A;  2QZA A;  3FUK A;  3DSV A;  4CZ2 D;  1N9A A;  3AS4 A;  5C2Y A;  4I9C A;  1Z6T A;  2BTD A;  3DSS A;  5FWQ A;  2VSY A;  4GAA A;  1QQE A;  1U3C A;  3MJW A;  4N2S A;  1IQU A;  5ENQ D;  1H19 A;  3E33 A;  3U66 A;  4GPK A;  3L6A A;  3CVU A;  5EYL A;  3T5V A;  5ANR A;  4XI0 A;  2KZT A;  1MX2 A;  5E75 A;  3O4Z A;  3APC A;  4ILI A;  1BI7 B;  4N39 A;  1H2T C;  4X8Q A;  1SZ9 A;  2AWI A;  1AP7 A;  4GA2 A;  2HE0 A;  3QOU A;  4NIK A;  3E30 A;  4HI8 A;  3CHQ A;  1E8W A;  5BXU A;  4AY6 A;  3ABL E;  3SNX A;  2GRO B;  5T4Y A;  2ZXW E;  5CBN A;  4HOR A;  3Q75 A;  3LXU X;  2HM8 A;  3HVE A;  4QFV A;  3EUV A;  3ZVV A;  4DX6 D;  1HH8 A;  5AQA A;  4HLL A;  4JVS A;  3T9K A;  3AU5 A;  2YQ8 A;  3QAQ A;  1MZC A;  3U3W A;  4GTQ A;  4Y6C A;  3ENE A;  3R7R A;  1S64 A;  5KWD A;  1WAO 1;  2KCV A;  1WY6 A;  3E4B A;  1FVH A;  1OXJ A;  2DWZ A;  5CEA A;  4IYP A;  3SF4 A;  2BF0 X;  2L0T B;  2VSX E;  3CIA A;  4F7A A;  3FUJ A;  3EHQ A;  2IOS A;  3DPD A;  4ACK A;  5FQ4 A;  3ABM E;  3SBT B;  1B89 A;  2B0O E;  1O1R A;  4GTO A;  2UY1 A;  4YVO A;  2X3M A;  4UWH A;  2HO1 A;  1X81 A;  3PNL B;  1FT1 A;  4EBA G;  1ZU2 A;  4J7W A;  3JQ0 A;  2RFA A;  3Q49 B;  4HNA D;  4BFR A;  2RFM A;  1H6O A;  5LP0 A;  4FHJ A;  4JPS A;  1HG5 A;  4JA7 A;  3D9I A;  1Y8M A;  4EZK A;  3ZKJ A;  1N52 A;  4IRU A;  2OND A;  2CHW A;  3ZN3 A;  5BW8 C;  2P9L G;  1OY3 D;  4XEI G;  4DK5 A;  1BPO A;  3ESK A;  1L5J A;  3CVV A;  1JCR A;  3FH7 A;  3TWW A;  2EIM E;  5H7P A;  2GRP B;  5ARG A;  1BI8 B;  3CVN A;  4MLP A;  3Q73 A;  4WUY A;  2JAB A;  4XX5 A;  2J08 A;  3L13 A;  2WXK A;  3HXF A;  3FTW A;  3ZPJ A;  5BV0 A;  2R05 A;  1V54 E;  5AYW D;  3UMV A;  4XI9 A;  3SGH A;  2WXH A;  4U8V D;  2WPV A;  3PZ2 A;  2P9K G;  2WQH A;  2OEV A;  4B8C B;  1HZ4 A;  4F3V A;  4CDR A;  3ULY A;  4CCA A;  2AVP A;  4BX8 A;  3CVP A;  4TXR A;  3RRM B;  2X38 A;  3Q15 A;  5LCW C;  1N54 A;  1P5Q A;  4G23 A;  4I43 A;  4B93 B;  2E2E A;  2QFC A;  3MV2 B;  4JXT A;  3CST A;  3R9M A;  3RO2 A;  3BG1 B;  3OXL A;  5CER B;  3MKQ A;  4CRW A;  4L9P A;  1TN6 A;  4N3C A;  3CLJ A;  2MYO A;  2VQ2 A;  5CMW A;  4EZL A;  1IKN D;  4I6G A;  4XIF A;  3ZGQ A;  4XZ4 A;  5JJT A;  1YCS B;  1K3Z D;  1WM5 A;  3B7B A;  4AY5 A;  3VTY A;  3D9H A;  2XEH A;  3TG5 A;  3KAE A;  3R9A B;  3OAW A;  2NC9 A;  3AG4 E;  2V0P A;  3TXM A;  3HIZ A;  2Y4T A;  3I5P A;  1TR4 A;  4YND A;  5LFA A;  3EU9 A;  1AWC B;  4RG9 A;  3RU0 A;  3V31 A;  4GZC A;  3CQC B;  3EIQ C;  3ZYL A;  4LCT A;  4O1O A;  5AN8 A;  1SZA A;  1NL4 A;  1IHB A;  5JMN D;  4E6H A;  3ML9 A;  3CHM A;  4I1M A;  3ZHE A;  4AP2 A;  3ZRH A;  2BED A;  3MCX A;  4CGW A;  3LVR E;  5ENN A;  4GTV A;  3CKB A;  3NF1 A;  4AIF A;  4O60 A;  3PZ3 A;  4HVB A;  3RIB A;  5BNW A;  2P9I G;  3U4T A;  4YDE A;  4H7X A;  5J08 A;  1ELW A;  3MGB A;  4AV7 A;  3UM1 A;  5T8I A;  4FLH A;  3HXB A;  1HX8 A;  4BTB A;  3PEU B;  4WWO A;  5HKP A;  5ENR D;  4LRZ A;  4N5Q A;  3FH8 A;  3MZL B;  4LUN U;  3Q9U C;  4GTR A;  4CGV A;  1N11 A;  2J9Q A;  2X6K A;  3TWV A;  3ASN E;  3RAU A;  5BV1 A;  3D9O A;  3TWR A;  2YIN A;  4GTM A;  4HRM B;  2J07 A;  2GRM A;  5AIJ A;  3T8M A;  2H6F A;  3LJ3 A;  2GW1 A;  4BT9 A;  3PZ1 A;  3LKU A;  3EJN A;  3IBE A;  1TYQ G;  4B8A A;  3JYS A;  2ZU6 B;  4RVB A;  3PH0 C;  1SQM A;  3ONL A;  4PUC A;  4QQI A;  3GW4 A;  3MYV A;  2GRN B;  1OCZ E;  3ULQ A;  3CEQ A;  4BY6 A;  3C5R A;  4NAC A;  3FTV A;  4J6I A;  3L82 A;  2KBX A;  1KZO A;  3PVL A;  2XRZ A;  3LDZ A;  3EIJ A;  5EDS A;  4FUL A;  2WXQ A;  2L9B A;  1ZBP A;  1ELR A;  2PQN A;  1DC2 A;  1OT8 A;  4DX7 D;  2H6H A;  2WXI A;  2LXM A;  3FTY A;  4HXI A;  5AEN A;  4GA0 A;  2Q7F A;  2IOL A;  3X2Q E;  3DBS A;  4JL0 A;  3SO8 A;  3C3Q A;  4GMJ A;  3KS2 A;  4OYS A;  3NB2 A;  3P2B A;  5KBA A;  5CED B;  1MJ0 A;  1BU9 A;  2YNQ A;  3LEW A;  3FTS A;  5JHB A;  4I1A A;  4A1G A;  4Q96 A;  5AAR A;  1H2U A;  1UW4 B;  2QYJ A;  3HG0 D;  5KJN A;  2F37 A;  3LVQ E;  4J8F A;  4HLE A;  4IN3 B;  3F6Q A;  2V8S E;  3DWL G;  2FO1 E;  4JD2 G;  3I3N A;  2I2O A;  1NA3 A;  2CG3 A;  2XCB A;  4WWP A;  4U8Y D;  2B6C A;  4CDM A;  5EKQ D;  4HI9 A;  2DZO A;  1OWL A;  3PUK A;  1NA0 A;  2YHE A;  2A4Z A;  3TWS A;  2RD0 A;  3CHR A;  3NQP A;  3J5P A;  1TNO A;  4GYO A;  4WAF A;  4LG6 A;  1BD8 A;  2X6F A;  4UWF A;  1TJC A;  1MHQ A;  3HXD A;  3SZ7 A;  2H6G A;  2VGX B;  4J8S A;  1HXI A;  1E90 A;  3IHY A;  3D3M A;  1S0P A;  3W9G A;  3VLF A;  3ZYK A;  3CHS A;  2EIN E;  1Z3X A;  3DEP A;  2ZGG A;  2JEK A;  3HXC A;  4I9E A;  4D10 C;  4FLB A;  3NOC D;  3D9N A;  3GZ1 A;  4G24 A;  1QBQ A;  4LNU D;  1MQS A;  4IUL A;  4DUI A;  1FVF A;  1N4S A;  3ZYQ A;  3AS5 A;  2XGS A;  4A63 B;  1G3N B;  2F8Y A;  1YYH A;  3ZFW A;  4G8K A;  1SA4 A;  3P1U A;  3L9T A;  4TRQ A;  3UX4 A;  5KJM A;  2P9P G;  3TGO A;  2VSO E;  5LX8 A;  2AJA A;  3DPY A;  2XZT G;  2M63 A;  3JCK C;  3FTU A;  2WXF A;  3E32 A;  2WXJ A;  3ZU7 B;  2NXP A;  1U3D A;  4GTS A;  3VTX A;  3Q78 A;  3RRN B;  1EPU A;  3BG0 B;  3SFY A;  4HOT A;  3V2O A;  2E0I A;  1TN7 A;  1O1S A;  2VTB B;  2CFZ A;  3EHR A;  4FJZ A;  1NZN A;  2R59 A;  2P9U G;  5BT1 A;  4K5B A;  3EHN A;  4WNE A;  4Z68 A;  3CVY A;  2PM7 A;  2GGF A;  3KEZ A;  3LY8 A;  2ION A;  3LJN A;  4RSY A;  4JA9 A;  2LO6 A;  2IQC A;  3CGH A;  4UI9 K;  3HYM B;  5ANL A;  3DXM G;  1OWP A;  3ISM C;  4L7T A;  2XPY A;  5AQ9 A;  4L2Y A;  4Q94 A;  2ZIS A;  3L22 A;  3QK0 A;  4K0R A;  4BER A;  4WNG A;  2JLB A;  4YDO A;  4F1S A;  3FH5 A;  4U7E B;  1E96 B;  2ILR A;  4CYM D;  4B89 A;  5CRV A;  2KCL A;  4GML A;  3BQO A;  1KT1 A;  2OVF A;  4HQD A;  2YHC A;  4F53 A;  1DCE A;  2WXP A;  2V5F A;  3KSQ A;  4JHK A;  3Q7F A;  1U2V G;  2F8X K;  1FCH A;  4YDW A;  1E8X A;  1N94 A;  3FUD A;  4TUU A;  1A5E A;  4OAU C;  4U0U A;  3PDN A;  4UWL A;  2UY1 B;  3N71 A;  4BX9 A;  2J49 A;  4AJW A;  4GU5 A;  4HFG A;  4KVM A;  2F0Y A;  5ENS D;  3SY2 A;  2WMO A;  2NYJ A;  3NAW A;  2FF4 A;  2PL2 A;  2XRY A;  1ZB1 A;  3UM3 A;  3WG7 E;  2HR2 A;  3TWX A;  3APF A;  4G1T A;  2KC7 A;  3QAR A;  4FJY A;  3DSW A;  3IXE A;  3ZIM A;  4JC8 A;  4WND A;  3LY9 A;  5BPP A;  3GYZ A;  3DXK G;  4MS6 A;  1S63 A;  1UN8 A;  4LNG A;  1DVP A;  3PRE A;  3ESL A;  3CK7 A;  2DZN A;  4UQY A;  1QZ2 A;  3FUL A;  3FWV A;  1HS6 A;  2WQ7 A;  4UQX A;  5AAO A;  4RLY A;  4U8H A;  3TWU A;  4YDY A;  3FU3 A;  3HHM A;  5JJ7 A;  4FHK A;  4TV3 A;  3FUE A;  3AG3 E;  5FQ8 A;  3I4R B;  1LD7 A;  1N4Q A;  3JQ1 A;  4BET A;  4UI9 J;  3B7S A;  3UI2 A;  2R03 A;  4CDN A;  2XPZ A;  2IO3 C;  3FUI A;  3NZS A;  4EZJ A;  3SHF A;  1WDY A;  3Q9N C;  2GRR B;  2Y69 E;  4DRX E;  4ANU A;  4U0S A;  3E34 A;  4HB5 A;  4JEU A;  3CVQ A;  3DSX A;  2IJG X;  1Z3Y A;  4B94 A;  4AXH A;  2WXM A;  3CHP A;  2AXV A;  4AVX A;  4PS7 A;  1VDY A;  2XGM A;  2WXR A;  3CQG B;  4K03 A;  4U95 D;  4BWR A;  4FAD A;  3QDN A;  1SA5 A;  2PNN A;  5EYP F;  2XCC A;  4GPM A;  1H6K A;  4EBA A;  4GYY A;  4Q69 A;  4HBD A;  1OUV A;  3FY4 A;  3FUM A;  3B13 A;  3CR3 A;  3G2U A;  3UIN C;  3FU6 A;  1E7U A;  2EIK E;  1MX6 A;  5FJY A;  5JHA A;  3D9J A;  5ENT D;  4ATG A;  4N5C A;  4HOS A;  4CT4 A;  4DI3 A;  4U96 D;  2VGE A;  4ILG A;  3E37 A;  3ZW3 A;  5CMY A;  5DIZ A;  5B1B E;  1SVX A;  4OAV B;  3HDX A;  2ETC A;  3KD7 A;  4APF A;  4HRL A;  3ASG A;  3AJI A;  3ZHE B;  3VLD A;  3GZS A;  4OVV A;  3SFZ A;  3V79 K;  4GCO A;  4MKT A;  3UIP C;  1OCO E;  3RO3 A;  1O1T A;  2R5S A;  5EIB E;  3QKY A;  4WNF A;  4UQZ A;  5E76 A;  2OCC E;  1E8Y A;  4I6J A;  3CVW A;  5D66 A;  2LNI A;  4CT0 A;  2L0I A;  3S7D A;  4U0Z A;  4FC8 A;  3J5Q B;  4UWK A;  2HYZ A;  4GB9 A;  2IEJ A;  3QWV A;  2R02 A;  4HRN A;  3ZEF A;  4GZ3 A;  5A7D B;  1OCC E;  4TUM A;  1IXV A;  4HOQ A;  2RKK A;  4TXP A;  3S7F A;  4DX1 A;  5EIL A;  5A6C A;  5G05 J;  3B7T A;  1QNF A;  4DJA A;  3L08 A;  1NI1 A;  5D0Q D;  5C1D A;  4DLQ A;  5FQ7 A;  3ULE G;  5FIO A;  2QYU A;  3FHE A;  3LCA A;  3Q5M A;  5ARF A;  2DVW A;  3SFX A;  3UIO C;  1N4P A;  2WXO A;  2KAT A;  3V30 A;  4CEM A;  2C0L A;  4G11 A;  1UOH A;  3V2X A;  3UXG A;  4HS2 A;  4FA6 A;  3SBS A;  5A23 A;  1UJK A;  3KSL A;  3ZXS A;  3ZUV B;  3UT7 A;  1NFI E;  3D9K A;  2IY0 C;  1W3B A;  5G04 J;  3ZYM A;  1JPL A;  1A17 A;  1YA0 A;  2FEZ A;  1XGW A;  3S7B A;  3CK9 A;  3CKC A;  4DX5 D;  2KCK A;  3BUA A;  4I1O B;  3RSE G;  3CVL A;  2OVB A;  2Y3A A;  3O48 A;  5HI7 A;  3FFL A;  1MX4 A;  4KT6 B;  1V55 E;  3DST A;  4URK A;  3FU5 A;  1E7V A;  1RW2 A;  2WVI A;  3R7Q A;  3I4G A;  3Q7A A;  2EIL E;  4ANV A;  4U04 A;  3JXI A;  3UKU G;  5BUZ A;  2XQ0 A;  3UT4 A;  3QWP A;  5AJL A;  1TNU A;  4GTP A;  4LNB A;  4I2W A;  3TWT A;  5D0O D;  3UT8 A;  3Q79 A;  3PS6 A;  1ELK A;  3PZ4 A;  2PM6 A;  3AS8 A;  5CCL A;  5ITZ F;  3FTX A;  2P9N G;  4MBG A;  3ZNG A;  1HO8 A;  1Y6I A;  4RG6 A;  5FT9 A;  4DI4 A;  5KJL A;  2WM9 A;  2X6H A;  1UJJ A;  2FO7 A;  2ETA A;  1OWN A;  4FU3 A;  1JCQ A;  3NOG D;  4LSZ E;  3AAA C;  1OCR E;  4J8E A;  3IHV A;  1LTX A;  1H0A A;  4EEC A;  3G2S A;  1BLX B;  3PEV B;  1MYO A;  2X6J A;  2J4D A;  5FZQ A;  4G25 A;  3FEX A;  4ILH B;  3TAX A;  1K1A A;  5KCM A;  3FEY A;  3MKR A;  4JEH A;  4ACL A;  3S2A A;  2P58 C;  2V4H C;  4ZFH A;  4JHJ A;  4UI9 C;  2VTB A;  3ZXP A;  4I2Z A;  4NUR A;  3RKV A;  1D9S A;  2BUG A;  5EID A;  3TL5 A;  4OVU A;  3IV0 A;  2EQX A;  5FIN A;  2FI7 A;  3C72 A;  2NSZ A;  4JW1 A;  4ATZ D;  2A5U A;  2WXN A;  2RG8 A;  1FT2 A;  2KZT B;  4LEU A;  3Q47 B;  4G26 A;  5G55 A;  3C98 A;  3K9I A;  3D9L A;  2DIW A;  4KZ0 A;  3UTM A;  1K8K G;  2WXG A;  1N0R A;  4BSZ B;  2CHX A;  3Q4A B;  4GMR A;  2ZGD A;  1XNF A;  2GRL A;  4P29 A;  1OWM A;  4R7L A;  4ANX A;  3RRU A;  4YVQ C;  5CEC B;  1H2V C;  5HQ8 A;  2ETB A;  3URZ A;  1D8D A;  3L16 A;  1TNB A;  2BKK B;  1TNZ A;  3HVE B;  4C0E A;  3AG1 E;  1H6P A;  1PAQ A;  1HE8 A;  5CBO A;  4ME2 A;  3CK8 A;  5EX0 A;  4EPZ A;  1YMP A;  4JHR A;  5D2M C;  3T5X A;  1O5M A;  2KXP C;  4M7C A;  3IEG A;  5FZS A;  3ABK E;  2IFU A;  1PC2 A;  4N3B A;  5FTP A;  1KZP A;  3FU0 A;  3C3R A;  3RK6 A;  1E8Z A;  5AQB A;  3G2W A;  4H7Y A;  4BES A;  3EDT B;  4FP7 A;  1UG3 A;  2QY7 A;  3AG2 E;  5KNG A;  4GTT A;  3AU4 A;  1INZ A;  2I1K A;  2WXL A;  2VYI A;  4PDX A;  1HU3 A;  3SI5 A;  4E85 A;  3UQ3 A;  3T8K A;  1EF1 C;  4ZHB A;  3PE3 A;  3ASF A;  3B7U X;  3NBN B;  1KPS B;  1LD8 A;  4K5C A;  4ANW A;  2PZI A;  4G8L A;  4KZC A;  2CG2 A;  3B95 A;  1TN8 A;  4Y6W A;  3CV0 A;  1JUQ A;  5G05 C;  3TJP A;  5HRY A;  3PE4 A;  5KJK A;  3APD A;  4F1P A;  3UM2 A;  3FUN A;  4NQ0 A; 
#chains in the Genus database with same CATH homology
 4HRM B;  4CYM D;  5JA4 D;  3T9K A;  2DZN A;  5FIO A;  2XZT G;  4BEP A;  4JB8 P;  2F37 A;  4O1P A;  1MX6 A;  2DVW A;  3TWW A;  3B7B A;  4HQD A;  1BLX B;  4CZ2 D;  5KNH D;  4UUC A;  5ENT D;  3V30 A;  1MYO A;  1K1B A;  3F6Q A;  5AAO A;  2FO1 E;  1UOH A;  3V2X A;  3UXG A;  4RLY A;  3D9H A;  1BI8 B;  1K1A A;  3JXJ A;  3TWU A;  5KWD A;  3ZUV B;  4YDY A;  2XEH A;  5CBO A;  1NFI E;  2JAB A;  4U8Y D;  5BXO A;  2F8X K;  4YDW A;  3ZU7 B;  1YMP A;  2BKG A;  4U96 D;  2VGE A;  5ENQ D;  2DWZ A;  4C48 B;  5CEA A;  1SVX A;  4HI9 A;  2DZO A;  2V4H C;  1DCQ A;  4ZFH A;  2XEE A;  4QQI A;  4OAV B;  1SW6 A;  2ETC A;  1TR4 A;  3TWS A;  1N0Q A;  1A5E A;  2KXP C;  4OAU C;  3EU9 A;  4DX5 D;  4DX2 A;  3EHQ A;  1AWC B;  3J5P A;  3C5R A;  4BET A;  1D9S A;  4HRL A;  5EYL A;  3UI2 A;  4LG6 A;  3V31 A;  3AJI A;  3HRA A;  1BD8 A;  5EID A;  2KBX A;  5AQ7 A;  3V2O A;  1MX2 A;  1QYM A;  5FIN A;  5AQB A;  2B0O E;  4O1O A;  1BI7 B;  5AN8 A;  3V79 K;  3EHR A;  4J8Y A;  5ENS D;  2V5Q C;  4U8V D;  4ATZ D;  1IHB A;  2NYJ A;  4BES A;  5JMN D;  5HS0 A;  1MX4 A;  2A5E A;  1DC2 A;  1WDY A;  1OT8 A;  4K5B A;  4DX7 D;  3Q9N C;  3TWQ A;  1AP7 A;  4Z68 A;  5KNG A;  5EIB E;  4DRX E;  3W9F A;  5EN5 D;  3W9G A;  2HE0 A;  3TWX A;  1S70 B;  4J7W A;  4K5A B;  3JXI A;  2RFA A;  3DEP A;  4HB5 A;  4NIK A;  2ZGG A;  5D66 A;  4HNA D;  3UTM A;  2P2C P;  3LJN A;  4HI8 A;  4B93 B;  4O60 A;  3SO8 A;  3DEO A;  2RFM A;  2QC9 A;  3IXE A;  3J5Q B;  5ENP D;  3T8K A;  3TWT A;  2J8S D;  4ZHB A;  3NOC D;  1N0R A;  4BSZ B;  4GMR A;  2ZGD A;  4LNU D;  3KEA A;  3NBN B;  5KBA A;  5CER B;  5CED B;  5BXU A;  4DUI A;  1MJ0 A;  4U95 D;  1BU9 A;  4K5C A;  3ZKJ A;  4HRN A;  2PNN A;  2L6B A;  5HKP A;  4G8L A;  5ENR D;  5EYP F;  5ITZ F;  5CBN A;  3B95 A;  2MYO A;  4A63 B;  5AQ9 A;  2Y0B G;  3JUE A;  4N5Q A;  3ZNG A;  4TUM A;  4F6R D;  1IXV A;  1G3N B;  5CEC B;  1IKN D;  4GPM A;  2F8Y A;  3Q9U C;  4DX1 A;  1YYH A;  1N11 A;  1OY3 D;  5HRY A;  5ENO D;  5EIL A;  2Y1L E;  4G8K A;  3TWV A;  4HBD A;  4BER A;  4F1P A;  5AAR A;  2ETA A;  2ETB A;  4QFV A;  3TWR A;  2QYJ A;  4DX6 D;  3HG0 D;  2XZD G;  3NOG D;  2BKK B;  4LSZ E;  1YCS B;  5AQA A;  1WG0 A;  3AAA C;  4HLL A;  1K3Z D;  2AJA A;  2XEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...