4BETA

Crystal structure of the legionella pneumophila fic domain-containing effector ankx protein (inactive h229a mutant) in complex with cytidine-diphosphate-choline
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
480
structure length
480
Chain Sequence
MPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLAPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGTPELISAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PHOSPHOCHOLINE TRANSFERASE ANKX
publication title Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 160
structure length 480
sequence length 480
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4betA02
1BU9A 1YCSB 5CEDB 1OY3D 2QC9A 4OAUC 5FINA 2KXPC 5D66A 3JUEA 3V30A 3EHRA 4J7WA 4UUCA 5AQ7A 3TWQA 4BESA 4LNUD 1IXVA 5HS0A 4F1PA 5CBNA 5AARA 3NBNB 2PNNA 5HKPA 2L6BA 5JMND 5KWDA 4J8YA 5AN8A 1SW6A 3F6QA 3UI2A 1MX4A 2ETCA 5KNGA 1BI8B 4YDWA 2FO1E 3HRAA 4U8VD 3J5PA 3TWVA 3V2OA 4ATZD 4A63B 2NYJA 4G8LA 4BSZB 3TWRA 1WDYA 5CERB 3T9KA 3V31A 4YDYA 1MX2A 4U96D 4BEPA 5AQAA 4HRMB 2XZDG 4TUMA 3J5QB 1OT8A 4DX1A 4OAVB 4DX2A 5ITZF 2DZNA 3NOGD 3UTMA 4BETA 3JXJA 1K3ZD 1D9SA 1IHBA 2F8YA 3ZKJA 5EIBE 1SVXA 5BXOA 3B7BA 3JXIA 3EU9A 4B93B 5ENTD 4HQDA 4Z68A 2DVWA 2J8SD 5CBOA 3LJNA 5FIOA 2AJAA 1NFIE 4LG6A 5ENRD 2KBXA 1DC2A 4DX5D 3KEAA 1S70B 5KBAA 5ENOD 5AQ9A 5EYLA 2B0OE 4BERA 4HLLA 4U95D 5KNHD 4NIKA 1AP7A 2JABA 4O1PA 3TWUA 4U8YD 4CYMD 3W9GA 4LSZE 2F37A 3IXEA 2XZTG 4QFVA 5EIDA 4ZHBA 4DX6D 4DX7D 4K5CA 1AWCB 2XEHA 5BXUA 1G3NB 2F8XK 4HRNA 2HE0A 1YMPA 1MX6A 3ZNGA 3DEPA 3TWSA 4O1OA 2Y1LE 1QYMA 3ZUVB 2V4HC 3ZU7B 3TWTA 5AQBA 4JB8P 3V2XA 2V5QC 2MYOA 2DZOA 2XENA 3DEOA 2DWZA 4O60A 4RLYA 4C48B 5HRYA 1BD8A 5CECB 5ENQD 4HI9A 1MYOA 2P2CP 3TWWA 5EYPF 4HI8A 3AAAC 5EN5D 1DCQA 3V79K 1N0RA 1UOHA 4DRXE 1MJ0A 1WG0A 4N5QA 4G8KA 3HG0D 4GPMA 1IKND 4K5AB 3B95A 2Y0BG 3AJIA 3D9HA 4HRLA 5ENPD 3W9FA 5AAOA 2A5EA 3UXGA 1N0QA 1K1BA 1A5EA 4CZ2D 1YYHA 4QQIA 5CEAA 2BKGA 2RFAA 4K5BA 5ENSD 4F6RD 4GMRA 1BI7B 3Q9NC 3C5RA 2QYJA 2ZGGA 3SO8A 2XEEA 3NOCD 4ZFHA 4HNAD 3Q9UC 2BKKB 4HB5A 1TR4A 4HBDA 1BLXB 1N11A 2ETAA 2RFMA 2ZGDA 5EILA 1K1AA 3TWXA 2VGEA 3EHQA 3T8KA 5JA4D 4DUIA 2ETBA
chains in the Genus database with same CATH superfamily
4G25A 3T5XA 3GYZA 3ML8A 4K0RA 1L5JA 3CVVA 4JL0A 4PS8A 2PM7A 3V30A 4E6HA 3KEZA 5T8IA 3Q7FA 3QARA 3LXUX 2X6FA 3TL5A 4GAAA 2JLBA 1U3DA 3MGBA 3MKQA 4CT0A 4HVBA 2CFUA 3V2OA 3R7RA 3LEWA 2V5FA 3ZW3A 3FH7A 1TYQG 1OCZE 2R05A 3GZ1A 3QC1A 2XZDG 1H19A 1N94A 3CHQA 3NAWA 3ASDA 4GYWA 3JUIA 4U04A 4PH4B 5BXOA 4JHKA 3ZGQA 3EUVA 5ARGA 1LTXA 4NIKA 1PC2A 3FUIA 3OXLA 4N3AA 3S7JA 1YMPA 3T5VA 3U66A 3CHPA 4O60A 3ZEFA 4HI8A 3V79K 4C0MA 4KYOB 3D9IA 3DSTA 4NRHB 3CHOA 1IYGA 5CEAA 5KJMA 4BSXA 1H2VC 3CIAA 5EILA 5LOZA 3EHQA 1BU9A 4CDRA 1EYHA 1H2UA 4J7WA 4LNUD 3BU8A 4GYYA 3DXKG 3L17A 3PDNA 4YDWA 3UQ3A 4BTAA 3TWRA 1E7UA 2EINE 1TEZA 4U96D 5AQAA 3SBSA 2FO7A 2FULA 2BF0X 4W9RA 4U63A 4ACKA 3PEVB 4GTTA 3SHFA 3CKCA 3MKQB 2IU1A 4B93B 3LJNA 3P2BA 4LG6A 2WB2A 2P58C 3AS8A 4M7CA 3D9KA 2FBNA 3TWUA 5AJDA 3URZA 4EECA 4N2QA 4BY6A 3LY9A 3QJZA 2ZIRA 4O1OA 3CVNA 3FHEA 2VGXA 4JW1A 4JA7A 3DEOA 3FUEA 2DWZA 1JCRA 5CECB 3EDTB 4AY5A 2GROB 4N39A 3QKYA 4UWFA 2L0TB 2VYIA 4K5AB 2P9PG 2WQHA 2E0IA 3FU3A 3LDZA 4UWKA 3FTXA 1BI7B 1IQRA 2XEEA 5DBKA 3Q9UC 5D2MC 4HB5A 1UW4B 4HXIA 4XE0A 3ZPJA 3E30A 4HBDA 4RG6A 1K1AA 5BNWA 3S7DA 3ASHA 5J90A 2XCCA 3UKUG 3G2VA 3EHRA 4CDMA 4B8AA 4XEIG 5AYWD 4P29A 3QB2A 5AN8A 3FEYA 4B8CB 4I9CA 1U2VG 2CHZA 2WPVA 4N3BA 4OYSA 4FLHA 4BFRA 3C3QA 3CGHA 4HOUA 3CHMA 2YHEA 4OAVB 2WXLA 2XEVA 1OCRE 2P9IG 2OVFA 1S64A 4GTRA 3FUJA 2XRZA 4TV3A 3KEAA 4G11A 4F7AA 3UUXA 4I6GA 5CCMA 5EIDA 4WNGA 2VSNA 2XEHA 3B7TA 1EDUA 4HRNA 1ZU2A 3Q5MA 3L54A 4JB8P 2XGMA 3RKVA 5EYPF 3ISMC 1H6KA 3E4BA 3MYVA 3UINC 4ILGA 2R5SA 3ULEG 3AJIA 5ENPD 3KSLA 3CVPA 2WXJA 1XGWA 3TG4A 4F6RD 4GMRA 3C5RA 1E7VA 3EIJA 4CGVA 4G2VA 3CVWA 2BKKB 2OVBA 1BLXB 3GZ2A 5ARFA 4BT9A 4H7YA 1DCEA 5CEDB 3QWWA 4BX9A 4DI4A 4O6FA 4YVQC 2KCLA 3CR3A 4XX5A 5CCLA 1V55E 4AXHA 3NBNB 3I4RB 2ZISA 4AJWA 1NA3A 4ANUA 2GRNB 4EZLA 1N95A 4GYOA 2LAHA 3SZ7A 4HRMB 2WQ7A 4XI0A 1YA0A 1RW2A 2F8YA 3ZKJA 3FULA 2WQ6A 5CMYA 2Y4UA 4U7EB 4WNEA 3RRMB 5EYLA 1E8YA 2H6HA 2CFZA 4ILIA 4MKTA 1HX8A 1KLXA 3SF4A 4HOQA 1BPOA 2HE0A 4Y6CA 1WY6A 4J8EA 1SZ9A 3JQ0A 4AM9A 2RG8A 1N54A 1E96B 5CRVA 4HI9A 1N0RA 4JHJA 3G2SA 4AY6A 2EIKE 5ANLA 5AAOA 2IO2C 4KXKB 4YDOA 5ANRA 4WNDA 4I43A 3ZYLA 2GRQB 2RFAA 4PUCA 4F3VA 1SA5A 3C98A 2IONA 1FT2A 4J6IA 4B0ZA 1HZ4A 2C0MA 4GZCA 3FUHA 4GU5A 3APDA 3B7UX 1IXVA 4BX8A 3UT8A 1X81A 5HKPA 1MHQA 4GPKA 5C2YA 4AV7A 2L0IA 3NQPA 3SQVA 3RSEG 5DIZA 4N3CA 1KT1A 3D9LA 3L16A 3TXNA 5KJKA 1QQEA 3DPDA 4MLPA 4BETA 1FT1A 1TNBA 2RKKA 2RD0A 2P9LG 2XRYA 4CDNA 3RAUA 5BW8C 5FIOA 3B13A 5AQ9A 2XS1A 4GCNA 4EZJA 5E76A 3SFXA 4GTPA 4DX7D 1OWMA 2I1KA 2CHWA 3FTZA 3FTWA 4F53A 5CMWA 3TWSA 4NURA 2KC7A 4HLEA 4C48B 3ABKE 1MJ0A 2WVIA 3Q4AB 4UI9J 3PEUB 2V0PA 3OTNA 5G04J 4DLQA 4QQIA 5JJTA 4X8QA 2GRMA 4IN3B 4M3OA 2BUGA 3Q75A 1PY1A 4FJYA 3L08A 2ZGDA 3T8MA 5G55A 2QZAA 4JA9A 2J4DA 4XKBA 2CG2A 1ZB1A 4HS2A 3PS6A 3GW4A 5HS0A 1HG2A 3EHMA 3U4TA 3DWLG 3FTSA 1MX4A 2AXUA 2FO1E 3TWVA 1O1TA 1XNFA 1LD7A 1ZBPA 2DIWA 3VLEA 4LEUA 4UQZA 3KAEA 2OCCE 4I6JA 3UKRG 3FH8A 2VTBA 1K3ZD 3FUKA 3NZSA 1HE8A 2I1JA 3DSXA 2DVWA 3VLDA 2VSOE 1SZAA 4MS6A 5LCWJ 3DSVA 5BUZA 3UM2A 3RU0A 2A5UA 1AP7A 3U64A 5T4YA 3IXEA 1O1RA 3FUFA 3AG3E 1E8WA 3I4GA 3KS2A 4DJAA 4A3TA 3HXCA 2E2EA 4L2YA 2P2CP 4EHMA 1FCHA 2NC9A 3E32A 2A5EA 1GW6A 3E37A 4RSYA 3SFZA 4AP2A 3PZ4A 3MEKA 2LSUA 4J0UA 3D9OA 1JWFA 2XGSA 3ZNGA 3D9MA 4L1BA 4U0ZA 4KBQA 4EQFA 5AQ7A 4GA0A 5AARA 2PNNA 5JMND 1DNPA 2IOSA 1HU3A 2R17C 4L7TA 5B3SE 4MRUA 3UMVA 1S63A 4FADA 3CVXA 5CERB 3T9KA 2UY1A 4H7XA 2J08A 2KCVA 3IKOB 5G2NA 5EDSA 1TNOA 3WG7E 5CBOA 1P5QA 2HO1A 4DLOA 4NQ0A 5G05C 4U8YD 4CGWA 4LCTA 5JHAA 4J8DA 2VTBB 1KT0A 3U9WA 4HOSA 1QYMA 3RRUA 4N2SA 3ULQA 2XENA 3I3NA 3AAAC 4N5QA 1O5MA 4ANXA 1ELWA 3IHYA 4GMJA 4RQIA 1OCCE 2B6CA 1N52A 1HS6A 4WNFA 1HG5A 2QYJA 2ZGGA 4I2WA 1N11A 3ZIMA 4N5CA 2OEWA 1JUQA 5A6CA 1KZOA 4I1OB 3PUJA 5FINA 3C3RA 3IV0A 5FZQA 1UN8A 1LF8A 4UQXA 5AJLA 5B1AE 3F6QA 1PAQA 5KNGA 1BI8B 4LUNU 3SGHA 4A3VA 1TJFA 3C3OA 3KD7A 4FU3A 3DSSA 3CV0A 1UJJA 3FUDA 1D9SA 4APFA 3HYMB 1SA4A 4I6EA 3CSTA 3AU4A 3EU9A 5ENTD 3PE3A 1FVFA 2AJAA 1TN6A 3UT4A 3AS4A 4JEUA 4U0UA 4EBAG 3SBTB 4HLLA 2UY1B 5KNHD 1FPPA 2Y69E 3ESKA 2C2LA 2R59A 3S7BA 4LSZE 2F37A 5BXUA 1Y8MA 1MX6A 4L23A 4I1AA 2LAIA 4GB9A 3WXXA 5M72A 3SNXA 1Z3XA 3PVLA 2FI7A 4RLYA 4IYPA 2DBAA 1DCQA 1WG0A 3CQCB 4CCAA 2HM8A 3L6AA 3TG5A 3SO8A 4ZFHA 1NL4A 3BG0B 1JCSA 2ETAA 3ABLE 2RFMA 1JCQA 5BPPA 1OY3D 2QC9A 3ASOE 5KCMA 1OWOA 4RVBA 4R7LA 2IQCA 2JEKA 5KWDA 5FQ8A 1N9AA 5FQ7A 3IEGA 3J5PA 3ASNE 4AOFA 4A63B 4BSZB 4GTSA 4IULA 3Q73A 1HO8A 2PQRA 4XIFA 2PQNA 3OXFA 4DX1A 3ULYA 3MX3A 1ELKA 1KZPA 3ASGA 2J9QA 1JPLA 4ATGA 2F0YA 2VGYA 5E75A 5IY5E 2XPZA 2B0OE 4LERA 3X2QE 4U95D 2KATA 3RO3A 5BV0A 2XZTG 4A55A 3NZUA 3LY7A 4D10C 2NXPA 3OXGA 2WXPA 2H6FA 5HRYA 5AIJA 3MZLB 5EX3A 3R9MA 4V3IA 4GPMA 3MCXA 4HRLA 2J4BA 4CZ2D 2Y3AA 2Q7FA 4F1SA 2WXRA 4TXQA 3D9JA 3NOCD 4KZCA 2H6IA 4AVXA 1SQMA 3ONKA 4Q96A 1HH8A 4WUYA 5H7PA 3FTYA 2OOEA 3ONLA 3DSWA 3FEXA 4NACA 2MOWA 1SW6A 3LVQE 3PZ3A 4TXRA 3FH5A 3FUNA 4B94A 3E33A 3BQOA 1Z3YA 4KT6B 2I2OA 3QOUA 1UN9A 1D8EA 2DYSE 4I9EA 3FU5A 4HORA 3UTMA 3JXJA 3QNKA 3SY2A 5BV1A 1HFAA 3QK0A 3CK8A 3Q78A 3HVEA 4XKCA 4Z68A 3FU6A 3PZ2A 5JJ6A 5ENOD 3MV3B 2NSZA 5BT1A 3D9PA 4CYMD 2IJGX 3S7FA 1TNYA 3L13A 2GW1A 4QFVA 5KJLA 5FZSA 3L9TA 1G3NB 1JWGA 4Q69A 3CVYA 3EU5A 4EZKA 3RK6A 2IO3C 3V2XA 4GTMA 3QWVA 4WAFA 4UWLA 1HF8A 4JHRA 1UOHA 2P9SG 3EJNA 1X5BA 4ILHB 3Q9NC 3G2UA 2IF4A 4GZ5A 3PREA 4G24A 4KZ0A 1H6PA 2QY7A 3Q79A 5D66A 5FJYA 3UIPC 2AXZA 2ILRA 3OAWA 3PZDA 2R02A 2XCBA 3UI2A 4DI3A 5A7DB 4GCOA 3UT7A 3FUMA 4UWHA 1WDYA 4B89A 5D0OD 2IY0C 2HR2A 1OT8A 1OWPA 3IBEA 1Y6IA 2R03A 3NOGD 4UI9K 2H6GA 2LUHA 3TAXA 3B7BA 1E8XA 3JXIA 2PM6A 4A1GA 2EILE 5CHEE 4DX5D 1DVPA 5KBAA 4FHKA 3CVLA 3W9GA 1UG3A 4ZHBA 4DX6D 2F8XK 2J09A 4GZ3A 3DPYA 3ZFWA 2WMOA 1U3CA 2CHXA 1W3BA 3ZUVB 3HVEB 4ACLA 2WXQA 4KMOA 3FDHA 2X6IA 4G26A 2X38A 3JCKC 4ANVA 2OEVA 2YINA 3ML9A 4GTVA 1K8KG 3CK7A 2J49A 3APFA 2PL2A 3G2WA 4FLBA 1OWLA 2VQ2A 3K9IA 4DPRA 2YHCA 5CRUA 3T8KA 2WXIA 4HOTA 2AWIA 2AXVA 2L9BA 4GZ6A 3RO2A 3UPVA 3N71A 5CBNA 3TXMA 1TN7A 4J8YA 1RZ4A 3MA5A 2L6JA 3ZRHA 2YQ8A 4G8LA 2MRIA 2VSXE 1VDYA 3B7RL 4I17A 1NZNA 1WM5A 2VJ8A 2LXMA 4I2ZA 4CT4A 3GZSA 5ITZF 3EHNA 2KCKA 3FWVA 3L22A 4HQDA 2J8SD 1INZA 4DK5A 2KBXA 3SI5A 3RRNB 4Q94A 3FTUA 1H6OA 1TNUA 2CG3A 4K5CA 3AG2E 2EQXA 4U07A 4C9BB 5KJNA 2Y1LE 1KPSB 2AVPA 2MYOA 3LY8A 3PE4A 3PUKA 1B89A 1QBQA 1Z6TA 5ENQD 1MYOA 2WXMA 3Q47B 4WWPA 4UWGA 4GTOA 2X6HA 2ZXWE 3HG0D 3BG1B 1Q2ZA 3HIZA 3UXGA 1K1BA 4APOA 1ELRA 2R2LA 1TNZA 5ENSD 4E85A 1Z5SC 3SD5A 4TXPA 3UM1A 4JD2G 5JJ7A 4G1TA 4HNAD 2QYUA 3TGOA 3Q15A 3IHVA 3QAQA 3TWXA 2ETBA 3Q7AA 4JZYA 2WXFA 5LP0A 3DRAA 1OCOE 4YDEA 1NA0A 4UUCA 1H2TC 4BESA 3HXFA 3ZYKA 2XQ0A 3CHSA 2XHEA 2LNIA 5AENA 3O4ZA 3QWPA 3CEQA 3HRAA 3CHRA 2HYZA 3VTYA 2LSVA 3ESLA 4GA1A 5FTPA 1IHGA 5J08A 3APCA 3RJVA 2DCPA 3SFYA 1DC2A 2X6KA 1S70B 3FFLA 4BERA 1A17A 2J07A 4LRZA 2BTDA 4C0EA 1UJKA 3CQGB 4XZ4A 2V8SE 4U8HA 2FF4A 3PRZA 1D8DA 4MBGA 3QDNA 3ZU7B 3TWTA 1NP7A 2GRLA 2MHKA 1S0PA 4JXTA 4AEZC 4K03A 5T3RA 3JQ1A 3LS8A 2V4LA 4G8KA 1IKND 2IFUA 2Y0BG 1N0QA 2BEDA 4K5BA 2UWJG 3TJPA 1TJCA 1TN8A 5G05J 1TR4A 4IRUA 2XPYA 4ANWA 4A1SA 4FC8A 3HXBA 3VLFA 1HXIA 3NF1A 2XS8A 3UM3A 2WMNA 4ME2A 4FA6A 2IOLA 1WAO1 3FP3A 3O48A 2ETCA 3R9AB 4U8VD 2NYJA 3V31A 4YDYA 1MX2A 3ABME 3FTVA 3J5QB 3U3WA 4DX2A 3C72A 3ENEA 4FJZA 4TUUA 4U0SA 3AG1E 3ZN3A 1NFIE 4JPSA 4RG9A 3VTXA 2WXGA 3DXMG 3ZYQA 5JHBA 2P9NG 3LPZA 5C1DA 2QFCA 3LJ3A 4G23A 2VGXB 4JC8A 3R7QA 5AQBA 2V5QC 2ONDA 2Y4TA 2M63A 3LCAA 4GZDA 1BD8A 1N4PA 2PZIA 5EN5D 1EPUA 4GMLA 4DRXE 1NI1A 4AIFA 3B95A 1MQSA 4XI9A 5B1BE 1YYHA 2KZTA 2LO6A 3UX4A 1E8ZA 3CLJA 3CK9A 5EX0A 1N4SA 2VGEA 4EBAA 2X6JA 4DUIA 3ZHEA 3Q49B 1YCSB 2KXPC 3UM0A 3JUEA 3TWQA 4BWRA 3UIOC 4F1PA 3CKBA 2WXKA 2WM9A 3HHMA 2P9KG 4JVSA 3ZXPA 2GRPB 4UQYA 3FU0A 4PDXA 4ATZD 5LX8A 2WXOA 3ZXSA 1O1SA 5LFAA 2I6HA 5FQ6A 4TRQA 3MKRA 5FQ4A 2I9CA 2C0LA 4ABNA 1IHBA 4URKA 3HXDA 5EIBE 3HXEA 2X3MA 4UI9C 3EIQC 1IQUA 5EKQD 1N4RA 5ENRD 5G04C 2FEZA 4PS7A 2AW6A 3NB2A 3G2TA 3S2AA 3HDXA 1AWCB 5ENNA 3BUAA 3CVQA 3DEPA 4JEHA 1LD8A 4KVOA 4KVMA 3E34A 2LXLA 3FY4A 2IEJA 3D9NA 3TWWA 5HQ8A 3AU5A 4YNDA 1OWNA 4L9PA 4WWOA 3ASFA 3P1UA 2YNQA 3D3MA 5FWQA 2XPIA 4Y6WA 2P9UG 1E90A 4CEMA 3KSQA 4GTQA 5FT9A 3MJWA 4OVVA 4YVOA 2DYRE 1V54E 4OAUC 2EIJE 2A4ZA 4WWNA 3AS5A 3DSUA 2KZTB 3I5PA 3ZYMA 5LCWC 2L6BA 3JYSA 2GRRB 4PS3A 4BT8A 4J8FA 2EIME 4FP7A 3ZHEB 1OXJA 2WXNA 4BEPA 5D0QD 5HI7A 3BEEA 3PNTB 4TUMA 3CSFA 4LNBA 2DZNA 1QZ2A 3AG4E 3MV2B 1SVXA 3PNLB 2XGOA 3LYAA 1MZCA 2OV8A 1N4QA 3PZ1A 4J8SA 3DBSA 2GGFA 2JABA 4GA2A 4O1PA 1FVHA 4CRWA 3LKUA 5FZRA 3ZVVA 1H0AA 3LVRE 5A23A 2V4HC 1QNFA 4LNGA 2WXHA 2DZOA 3CVUA 4I1MA 4L2LA 3L82A 2KM4A 2ZU6B 3W9FA 3D9HA 1A5EA 2VSYA 4BTBA 4FULA 4HFGA 2BKGA 4FHJA 3PH0C 1EF1C 4OVUA 1OUVA 5JA4D 3B7SA 3RIBA 4EPZA
chains in the Genus database with same CATH topology
1BU9A 1YCSB 5CEDB 1OY3D 2QC9A 4OAUC 5FINA 2KXPC 5D66A 3JUEA 3V30A 3EHRA 4J7WA 4UUCA 5AQ7A 3TWQA 4BESA 4LNUD 1IXVA 5HS0A 4F1PA 5CBNA 5AARA 3NBNB 2PNNA 5HKPA 2L6BA 5JMND 5KWDA 4J8YA 5AN8A 1SW6A 3F6QA 3UI2A 1MX4A 2ETCA 5KNGA 1BI8B 4YDWA 2FO1E 3HRAA 4U8VD 3J5PA 3TWVA 3V2OA 4ATZD 4A63B 2NYJA 4G8LA 4BSZB 3TWRA 1WDYA 5CERB 3T9KA 3V31A 4YDYA 1MX2A 4U96D 4BEPA 5AQAA 4HRMB 2XZDG 4TUMA 3J5QB 1OT8A 4DX1A 4OAVB 4DX2A 5ITZF 2DZNA 3NOGD 3UTMA 4BETA 3JXJA 1K3ZD 1D9SA 1IHBA 2F8YA 3ZKJA 5EIBE 1SVXA 5BXOA 3B7BA 3JXIA 3EU9A 4B93B 5ENTD 4HQDA 4Z68A 2DVWA 2J8SD 5CBOA 3LJNA 5FIOA 2AJAA 1NFIE 4LG6A 5ENRD 2KBXA 1DC2A 4DX5D 3KEAA 1S70B 5KBAA 5ENOD 5AQ9A 5EYLA 2B0OE 4BERA 4HLLA 4U95D 5KNHD 4NIKA 1AP7A 2JABA 4O1PA 3TWUA 4U8YD 4CYMD 3W9GA 4LSZE 2F37A 3IXEA 2XZTG 4QFVA 5EIDA 4ZHBA 4DX6D 4DX7D 4K5CA 1AWCB 2XEHA 5BXUA 1G3NB 2F8XK 4HRNA 2HE0A 1YMPA 1MX6A 3ZNGA 3DEPA 3TWSA 4O1OA 2Y1LE 1QYMA 3ZUVB 2V4HC 3ZU7B 3TWTA 5AQBA 4JB8P 3V2XA 2V5QC 2MYOA 2DZOA 2XENA 3DEOA 2DWZA 4O60A 4RLYA 4C48B 5HRYA 1BD8A 5CECB 5ENQD 4HI9A 1MYOA 2P2CP 3TWWA 5EYPF 4HI8A 3AAAC 5EN5D 1DCQA 3V79K 1N0RA 1UOHA 4DRXE 1MJ0A 1WG0A 4N5QA 4G8KA 3HG0D 4GPMA 1IKND 4K5AB 3B95A 2Y0BG 3AJIA 3D9HA 4HRLA 5ENPD 3W9FA 5AAOA 2A5EA 3UXGA 1N0QA 1K1BA 1A5EA 4CZ2D 1YYHA 4QQIA 5CEAA 2BKGA 2RFAA 4K5BA 5ENSD 4F6RD 4GMRA 1BI7B 3Q9NC 3C5RA 2QYJA 2ZGGA 3SO8A 2XEEA 3NOCD 4ZFHA 4HNAD 3Q9UC 2BKKB 4HB5A 1TR4A 4HBDA 1BLXB 1N11A 2ETAA 2RFMA 2ZGDA 5EILA 1K1AA 3TWXA 2VGEA 3EHQA 3T8KA 5JA4D 4DUIA 2ETBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU9 A;  1YCS B;  5CED B;  1OY3 D;  2QC9 A;  4OAU C;  5FIN A;  2KXP C;  5D66 A;  3JUE A;  3V30 A;  3EHR A;  4J7W A;  4UUC A;  5AQ7 A;  3TWQ A;  4BES A;  4LNU D;  1IXV A;  5HS0 A;  4F1P A;  5CBN A;  5AAR A;  3NBN B;  2PNN A;  5HKP A;  2L6B A;  5JMN D;  5KWD A;  4J8Y A;  5AN8 A;  1SW6 A;  3F6Q A;  3UI2 A;  1MX4 A;  2ETC A;  5KNG A;  1BI8 B;  4YDW A;  2FO1 E;  3HRA A;  4U8V D;  3J5P A;  3TWV A;  3V2O A;  4ATZ D;  4A63 B;  2NYJ A;  4G8L A;  4BSZ B;  3TWR A;  1WDY A;  5CER B;  3T9K A;  3V31 A;  4YDY A;  1MX2 A;  4U96 D;  4BEP A;  5AQA A;  4HRM B;  2XZD G;  4TUM A;  3J5Q B;  1OT8 A;  4DX1 A;  4OAV B;  4DX2 A;  5ITZ F;  2DZN A;  3NOG D;  3UTM A;  4BET A;  3JXJ A;  1K3Z D;  1D9S A;  1IHB A;  2F8Y A;  3ZKJ A;  5EIB E;  1SVX A;  5BXO A;  3B7B A;  3JXI A;  3EU9 A;  4B93 B;  5ENT D;  4HQD A;  4Z68 A;  2DVW A;  2J8S D;  5CBO A;  3LJN A;  5FIO A;  2AJA A;  1NFI E;  4LG6 A;  5ENR D;  2KBX A;  1DC2 A;  4DX5 D;  3KEA A;  1S70 B;  5KBA A;  5ENO D;  5AQ9 A;  5EYL A;  2B0O E;  4BER A;  4HLL A;  4U95 D;  5KNH D;  4NIK A;  1AP7 A;  2JAB A;  4O1P A;  3TWU A;  4U8Y D;  4CYM D;  3W9G A;  4LSZ E;  2F37 A;  3IXE A;  2XZT G;  4QFV A;  5EID A;  4ZHB A;  4DX6 D;  4DX7 D;  4K5C A;  1AWC B;  2XEH A;  5BXU A;  1G3N B;  2F8X K;  4HRN A;  2HE0 A;  1YMP A;  1MX6 A;  3ZNG A;  3DEP A;  3TWS A;  4O1O A;  2Y1L E;  1QYM A;  3ZUV B;  2V4H C;  3ZU7 B;  3TWT A;  5AQB A;  4JB8 P;  3V2X A;  2V5Q C;  2MYO A;  2DZO A;  2XEN A;  3DEO A;  2DWZ A;  4O60 A;  4RLY A;  4C48 B;  5HRY A;  1BD8 A;  5CEC B;  5ENQ D;  4HI9 A;  1MYO A;  2P2C P;  3TWW A;  5EYP F;  4HI8 A;  3AAA C;  5EN5 D;  1DCQ A;  3V79 K;  1N0R A;  1UOH A;  4DRX E;  1MJ0 A;  1WG0 A;  4N5Q A;  4G8K A;  3HG0 D;  4GPM A;  1IKN D;  4K5A B;  3B95 A;  2Y0B G;  3AJI A;  3D9H A;  4HRL A;  5ENP D;  3W9F A;  5AAO A;  2A5E A;  3UXG A;  1N0Q A;  1K1B A;  1A5E A;  4CZ2 D;  1YYH A;  4QQI A;  5CEA A;  2BKG A;  2RFA A;  4K5B A;  5ENS D;  4F6R D;  4GMR A;  1BI7 B;  3Q9N C;  3C5R A;  2QYJ A;  2ZGG A;  3SO8 A;  2XEE A;  3NOC D;  4ZFH A;  4HNA D;  3Q9U C;  2BKK B;  4HB5 A;  1TR4 A;  4HBD A;  1BLX B;  1N11 A;  2ETA A;  2RFM A;  2ZGD A;  5EIL A;  1K1A A;  3TWX A;  2VGE A;  3EHQ A;  3T8K A;  5JA4 D;  4DUI A;  2ETB A; 
#chains in the Genus database with same CATH topology
 4G25 A;  3T5X A;  3GYZ A;  3ML8 A;  4K0R A;  1L5J A;  3CVV A;  4JL0 A;  4PS8 A;  2PM7 A;  3V30 A;  4E6H A;  3KEZ A;  5T8I A;  3Q7F A;  3QAR A;  3LXU X;  2X6F A;  3TL5 A;  4GAA A;  2JLB A;  1U3D A;  3MGB A;  3MKQ A;  4CT0 A;  4HVB A;  2CFU A;  3V2O A;  3R7R A;  3LEW A;  2V5F A;  3ZW3 A;  3FH7 A;  1TYQ G;  1OCZ E;  2R05 A;  3GZ1 A;  3QC1 A;  2XZD G;  1H19 A;  1N94 A;  3CHQ A;  3NAW A;  3ASD A;  4GYW A;  3JUI A;  4U04 A;  4PH4 B;  5BXO A;  4JHK A;  3ZGQ A;  3EUV A;  5ARG A;  1LTX A;  4NIK A;  1PC2 A;  3FUI A;  3OXL A;  4N3A A;  3S7J A;  1YMP A;  3T5V A;  3U66 A;  3CHP A;  4O60 A;  3ZEF A;  4HI8 A;  3V79 K;  4C0M A;  4KYO B;  3D9I A;  3DST A;  4NRH B;  3CHO A;  1IYG A;  5CEA A;  5KJM A;  4BSX A;  1H2V C;  3CIA A;  5EIL A;  5LOZ A;  3EHQ A;  1BU9 A;  4CDR A;  1EYH A;  1H2U A;  4J7W A;  4LNU D;  3BU8 A;  4GYY A;  3DXK G;  3L17 A;  3PDN A;  4YDW A;  3UQ3 A;  4BTA A;  3TWR A;  1E7U A;  2EIN E;  1TEZ A;  4U96 D;  5AQA A;  3SBS A;  2FO7 A;  2FUL A;  2BF0 X;  4W9R A;  4U63 A;  4ACK A;  3PEV B;  4GTT A;  3SHF A;  3CKC A;  3MKQ B;  2IU1 A;  4B93 B;  3LJN A;  3P2B A;  4LG6 A;  2WB2 A;  2P58 C;  3AS8 A;  4M7C A;  3D9K A;  2FBN A;  3TWU A;  5AJD A;  3URZ A;  4EEC A;  4N2Q A;  4BY6 A;  3LY9 A;  3QJZ A;  2ZIR A;  4O1O A;  3CVN A;  3FHE A;  2VGX A;  4JW1 A;  4JA7 A;  3DEO A;  3FUE A;  2DWZ A;  1JCR A;  5CEC B;  3EDT B;  4AY5 A;  2GRO B;  4N39 A;  3QKY A;  4UWF A;  2L0T B;  2VYI A;  4K5A B;  2P9P G;  2WQH A;  2E0I A;  3FU3 A;  3LDZ A;  4UWK A;  3FTX A;  1BI7 B;  1IQR A;  2XEE A;  5DBK A;  3Q9U C;  5D2M C;  4HB5 A;  1UW4 B;  4HXI A;  4XE0 A;  3ZPJ A;  3E30 A;  4HBD A;  4RG6 A;  1K1A A;  5BNW A;  3S7D A;  3ASH A;  5J90 A;  2XCC A;  3UKU G;  3G2V A;  3EHR A;  4CDM A;  4B8A A;  4XEI G;  5AYW D;  4P29 A;  3QB2 A;  5AN8 A;  3FEY A;  4B8C B;  4I9C A;  1U2V G;  2CHZ A;  2WPV A;  4N3B A;  4OYS A;  4FLH A;  4BFR A;  3C3Q A;  3CGH A;  4HOU A;  3CHM A;  2YHE A;  4OAV B;  2WXL A;  2XEV A;  1OCR E;  2P9I G;  2OVF A;  1S64 A;  4GTR A;  3FUJ A;  2XRZ A;  4TV3 A;  3KEA A;  4G11 A;  4F7A A;  3UUX A;  4I6G A;  5CCM A;  5EID A;  4WNG A;  2VSN A;  2XEH A;  3B7T A;  1EDU A;  4HRN A;  1ZU2 A;  3Q5M A;  3L54 A;  4JB8 P;  2XGM A;  3RKV A;  5EYP F;  3ISM C;  1H6K A;  3E4B A;  3MYV A;  3UIN C;  4ILG A;  2R5S A;  3ULE G;  3AJI A;  5ENP D;  3KSL A;  3CVP A;  2WXJ A;  1XGW A;  3TG4 A;  4F6R D;  4GMR A;  3C5R A;  1E7V A;  3EIJ A;  4CGV A;  4G2V A;  3CVW A;  2BKK B;  2OVB A;  1BLX B;  3GZ2 A;  5ARF A;  4BT9 A;  4H7Y A;  1DCE A;  5CED B;  3QWW A;  4BX9 A;  4DI4 A;  4O6F A;  4YVQ C;  2KCL A;  3CR3 A;  4XX5 A;  5CCL A;  1V55 E;  4AXH A;  3NBN B;  3I4R B;  2ZIS A;  4AJW A;  1NA3 A;  4ANU A;  2GRN B;  4EZL A;  1N95 A;  4GYO A;  2LAH A;  3SZ7 A;  4HRM B;  2WQ7 A;  4XI0 A;  1YA0 A;  1RW2 A;  2F8Y A;  3ZKJ A;  3FUL A;  2WQ6 A;  5CMY A;  2Y4U A;  4U7E B;  4WNE A;  3RRM B;  5EYL A;  1E8Y A;  2H6H A;  2CFZ A;  4ILI A;  4MKT A;  1HX8 A;  1KLX A;  3SF4 A;  4HOQ A;  1BPO A;  2HE0 A;  4Y6C A;  1WY6 A;  4J8E A;  1SZ9 A;  3JQ0 A;  4AM9 A;  2RG8 A;  1N54 A;  1E96 B;  5CRV A;  4HI9 A;  1N0R A;  4JHJ A;  3G2S A;  4AY6 A;  2EIK E;  5ANL A;  5AAO A;  2IO2 C;  4KXK B;  4YDO A;  5ANR A;  4WND A;  4I43 A;  3ZYL A;  2GRQ B;  2RFA A;  4PUC A;  4F3V A;  1SA5 A;  3C98 A;  2ION A;  1FT2 A;  4J6I A;  4B0Z A;  1HZ4 A;  2C0M A;  4GZC A;  3FUH A;  4GU5 A;  3APD A;  3B7U X;  1IXV A;  4BX8 A;  3UT8 A;  1X81 A;  5HKP A;  1MHQ A;  4GPK A;  5C2Y A;  4AV7 A;  2L0I A;  3NQP A;  3SQV A;  3RSE G;  5DIZ A;  4N3C A;  1KT1 A;  3D9L A;  3L16 A;  3TXN A;  5KJK A;  1QQE A;  3DPD A;  4MLP A;  4BET A;  1FT1 A;  1TNB A;  2RKK A;  2RD0 A;  2P9L G;  2XRY A;  4CDN A;  3RAU A;  5BW8 C;  5FIO A;  3B13 A;  5AQ9 A;  2XS1 A;  4GCN A;  4EZJ A;  5E76 A;  3SFX A;  4GTP A;  4DX7 D;  1OWM A;  2I1K A;  2CHW A;  3FTZ A;  3FTW A;  4F53 A;  5CMW A;  3TWS A;  4NUR A;  2KC7 A;  4HLE A;  4C48 B;  3ABK E;  1MJ0 A;  2WVI A;  3Q4A B;  4UI9 J;  3PEU B;  2V0P A;  3OTN A;  5G04 J;  4DLQ A;  4QQI A;  5JJT A;  4X8Q A;  2GRM A;  4IN3 B;  4M3O A;  2BUG A;  3Q75 A;  1PY1 A;  4FJY A;  3L08 A;  2ZGD A;  3T8M A;  5G55 A;  2QZA A;  4JA9 A;  2J4D A;  4XKB A;  2CG2 A;  1ZB1 A;  4HS2 A;  3PS6 A;  3GW4 A;  5HS0 A;  1HG2 A;  3EHM A;  3U4T A;  3DWL G;  3FTS A;  1MX4 A;  2AXU A;  2FO1 E;  3TWV A;  1O1T A;  1XNF A;  1LD7 A;  1ZBP A;  2DIW A;  3VLE A;  4LEU A;  4UQZ A;  3KAE A;  2OCC E;  4I6J A;  3UKR G;  3FH8 A;  2VTB A;  1K3Z D;  3FUK A;  3NZS A;  1HE8 A;  2I1J A;  3DSX A;  2DVW A;  3VLD A;  2VSO E;  1SZA A;  4MS6 A;  5LCW J;  3DSV A;  5BUZ A;  3UM2 A;  3RU0 A;  2A5U A;  1AP7 A;  3U64 A;  5T4Y A;  3IXE A;  1O1R A;  3FUF A;  3AG3 E;  1E8W A;  3I4G A;  3KS2 A;  4DJA A;  4A3T A;  3HXC A;  2E2E A;  4L2Y A;  2P2C P;  4EHM A;  1FCH A;  2NC9 A;  3E32 A;  2A5E A;  1GW6 A;  3E37 A;  4RSY A;  3SFZ A;  4AP2 A;  3PZ4 A;  3MEK A;  2LSU A;  4J0U A;  3D9O A;  1JWF A;  2XGS A;  3ZNG A;  3D9M A;  4L1B A;  4U0Z A;  4KBQ A;  4EQF A;  5AQ7 A;  4GA0 A;  5AAR A;  2PNN A;  5JMN D;  1DNP A;  2IOS A;  1HU3 A;  2R17 C;  4L7T A;  5B3S E;  4MRU A;  3UMV A;  1S63 A;  4FAD A;  3CVX A;  5CER B;  3T9K A;  2UY1 A;  4H7X A;  2J08 A;  2KCV A;  3IKO B;  5G2N A;  5EDS A;  1TNO A;  3WG7 E;  5CBO A;  1P5Q A;  2HO1 A;  4DLO A;  4NQ0 A;  5G05 C;  4U8Y D;  4CGW A;  4LCT A;  5JHA A;  4J8D A;  2VTB B;  1KT0 A;  3U9W A;  4HOS A;  1QYM A;  3RRU A;  4N2S A;  3ULQ A;  2XEN A;  3I3N A;  3AAA C;  4N5Q A;  1O5M A;  4ANX A;  1ELW A;  3IHY A;  4GMJ A;  4RQI A;  1OCC E;  2B6C A;  1N52 A;  1HS6 A;  4WNF A;  1HG5 A;  2QYJ A;  2ZGG A;  4I2W A;  1N11 A;  3ZIM A;  4N5C A;  2OEW A;  1JUQ A;  5A6C A;  1KZO A;  4I1O B;  3PUJ A;  5FIN A;  3C3R A;  3IV0 A;  5FZQ A;  1UN8 A;  1LF8 A;  4UQX A;  5AJL A;  5B1A E;  3F6Q A;  1PAQ A;  5KNG A;  1BI8 B;  4LUN U;  3SGH A;  4A3V A;  1TJF A;  3C3O A;  3KD7 A;  4FU3 A;  3DSS A;  3CV0 A;  1UJJ A;  3FUD A;  1D9S A;  4APF A;  3HYM B;  1SA4 A;  4I6E A;  3CST A;  3AU4 A;  3EU9 A;  5ENT D;  3PE3 A;  1FVF A;  2AJA A;  1TN6 A;  3UT4 A;  3AS4 A;  4JEU A;  4U0U A;  4EBA G;  3SBT B;  4HLL A;  2UY1 B;  5KNH D;  1FPP A;  2Y69 E;  3ESK A;  2C2L A;  2R59 A;  3S7B A;  4LSZ E;  2F37 A;  5BXU A;  1Y8M A;  1MX6 A;  4L23 A;  4I1A A;  2LAI A;  4GB9 A;  3WXX A;  5M72 A;  3SNX A;  1Z3X A;  3PVL A;  2FI7 A;  4RLY A;  4IYP A;  2DBA A;  1DCQ A;  1WG0 A;  3CQC B;  4CCA A;  2HM8 A;  3L6A A;  3TG5 A;  3SO8 A;  4ZFH A;  1NL4 A;  3BG0 B;  1JCS A;  2ETA A;  3ABL E;  2RFM A;  1JCQ A;  5BPP A;  1OY3 D;  2QC9 A;  3ASO E;  5KCM A;  1OWO A;  4RVB A;  4R7L A;  2IQC A;  2JEK A;  5KWD A;  5FQ8 A;  1N9A A;  5FQ7 A;  3IEG A;  3J5P A;  3ASN E;  4AOF A;  4A63 B;  4BSZ B;  4GTS A;  4IUL A;  3Q73 A;  1HO8 A;  2PQR A;  4XIF A;  2PQN A;  3OXF A;  4DX1 A;  3ULY A;  3MX3 A;  1ELK A;  1KZP A;  3ASG A;  2J9Q A;  1JPL A;  4ATG A;  2F0Y A;  2VGY A;  5E75 A;  5IY5 E;  2XPZ A;  2B0O E;  4LER A;  3X2Q E;  4U95 D;  2KAT A;  3RO3 A;  5BV0 A;  2XZT G;  4A55 A;  3NZU A;  3LY7 A;  4D10 C;  2NXP A;  3OXG A;  2WXP A;  2H6F A;  5HRY A;  5AIJ A;  3MZL B;  5EX3 A;  3R9M A;  4V3I A;  4GPM A;  3MCX A;  4HRL A;  2J4B A;  4CZ2 D;  2Y3A A;  2Q7F A;  4F1S A;  2WXR A;  4TXQ A;  3D9J A;  3NOC D;  4KZC A;  2H6I A;  4AVX A;  1SQM A;  3ONK A;  4Q96 A;  1HH8 A;  4WUY A;  5H7P A;  3FTY A;  2OOE A;  3ONL A;  3DSW A;  3FEX A;  4NAC A;  2MOW A;  1SW6 A;  3LVQ E;  3PZ3 A;  4TXR A;  3FH5 A;  3FUN A;  4B94 A;  3E33 A;  3BQO A;  1Z3Y A;  4KT6 B;  2I2O A;  3QOU A;  1UN9 A;  1D8E A;  2DYS E;  4I9E A;  3FU5 A;  4HOR A;  3UTM A;  3JXJ A;  3QNK A;  3SY2 A;  5BV1 A;  1HFA A;  3QK0 A;  3CK8 A;  3Q78 A;  3HVE A;  4XKC A;  4Z68 A;  3FU6 A;  3PZ2 A;  5JJ6 A;  5ENO D;  3MV3 B;  2NSZ A;  5BT1 A;  3D9P A;  4CYM D;  2IJG X;  3S7F A;  1TNY A;  3L13 A;  2GW1 A;  4QFV A;  5KJL A;  5FZS A;  3L9T A;  1G3N B;  1JWG A;  4Q69 A;  3CVY A;  3EU5 A;  4EZK A;  3RK6 A;  2IO3 C;  3V2X A;  4GTM A;  3QWV A;  4WAF A;  4UWL A;  1HF8 A;  4JHR A;  1UOH A;  2P9S G;  3EJN A;  1X5B A;  4ILH B;  3Q9N C;  3G2U A;  2IF4 A;  4GZ5 A;  3PRE A;  4G24 A;  4KZ0 A;  1H6P A;  2QY7 A;  3Q79 A;  5D66 A;  5FJY A;  3UIP C;  2AXZ A;  2ILR A;  3OAW A;  3PZD A;  2R02 A;  2XCB A;  3UI2 A;  4DI3 A;  5A7D B;  4GCO A;  3UT7 A;  3FUM A;  4UWH A;  1WDY A;  4B89 A;  5D0O D;  2IY0 C;  2HR2 A;  1OT8 A;  1OWP A;  3IBE A;  1Y6I A;  2R03 A;  3NOG D;  4UI9 K;  2H6G A;  2LUH A;  3TAX A;  3B7B A;  1E8X A;  3JXI A;  2PM6 A;  4A1G A;  2EIL E;  5CHE E;  4DX5 D;  1DVP A;  5KBA A;  4FHK A;  3CVL A;  3W9G A;  1UG3 A;  4ZHB A;  4DX6 D;  2F8X K;  2J09 A;  4GZ3 A;  3DPY A;  3ZFW A;  2WMO A;  1U3C A;  2CHX A;  1W3B A;  3ZUV B;  3HVE B;  4ACL A;  2WXQ A;  4KMO A;  3FDH A;  2X6I A;  4G26 A;  2X38 A;  3JCK C;  4ANV A;  2OEV A;  2YIN A;  3ML9 A;  4GTV A;  1K8K G;  3CK7 A;  2J49 A;  3APF A;  2PL2 A;  3G2W A;  4FLB A;  1OWL A;  2VQ2 A;  3K9I A;  4DPR A;  2YHC A;  5CRU A;  3T8K A;  2WXI A;  4HOT A;  2AWI A;  2AXV A;  2L9B A;  4GZ6 A;  3RO2 A;  3UPV A;  3N71 A;  5CBN A;  3TXM A;  1TN7 A;  4J8Y A;  1RZ4 A;  3MA5 A;  2L6J A;  3ZRH A;  2YQ8 A;  4G8L A;  2MRI A;  2VSX E;  1VDY A;  3B7R L;  4I17 A;  1NZN A;  1WM5 A;  2VJ8 A;  2LXM A;  4I2Z A;  4CT4 A;  3GZS A;  5ITZ F;  3EHN A;  2KCK A;  3FWV A;  3L22 A;  4HQD A;  2J8S D;  1INZ A;  4DK5 A;  2KBX A;  3SI5 A;  3RRN B;  4Q94 A;  3FTU A;  1H6O A;  1TNU A;  2CG3 A;  4K5C A;  3AG2 E;  2EQX A;  4U07 A;  4C9B B;  5KJN A;  2Y1L E;  1KPS B;  2AVP A;  2MYO A;  3LY8 A;  3PE4 A;  3PUK A;  1B89 A;  1QBQ A;  1Z6T A;  5ENQ D;  1MYO A;  2WXM A;  3Q47 B;  4WWP A;  4UWG A;  4GTO A;  2X6H A;  2ZXW E;  3HG0 D;  3BG1 B;  1Q2Z A;  3HIZ A;  3UXG A;  1K1B A;  4APO A;  1ELR A;  2R2L A;  1TNZ A;  5ENS D;  4E85 A;  1Z5S C;  3SD5 A;  4TXP A;  3UM1 A;  4JD2 G;  5JJ7 A;  4G1T A;  4HNA D;  2QYU A;  3TGO A;  3Q15 A;  3IHV A;  3QAQ A;  3TWX A;  2ETB A;  3Q7A A;  4JZY A;  2WXF A;  5LP0 A;  3DRA A;  1OCO E;  4YDE A;  1NA0 A;  4UUC A;  1H2T C;  4BES A;  3HXF A;  3ZYK A;  2XQ0 A;  3CHS A;  2XHE A;  2LNI A;  5AEN A;  3O4Z A;  3QWP A;  3CEQ A;  3HRA A;  3CHR A;  2HYZ A;  3VTY A;  2LSV A;  3ESL A;  4GA1 A;  5FTP A;  1IHG A;  5J08 A;  3APC A;  3RJV A;  2DCP A;  3SFY A;  1DC2 A;  2X6K A;  1S70 B;  3FFL A;  4BER A;  1A17 A;  2J07 A;  4LRZ A;  2BTD A;  4C0E A;  1UJK A;  3CQG B;  4XZ4 A;  2V8S E;  4U8H A;  2FF4 A;  3PRZ A;  1D8D A;  4MBG A;  3QDN A;  3ZU7 B;  3TWT A;  1NP7 A;  2GRL A;  2MHK A;  1S0P A;  4JXT A;  4AEZ C;  4K03 A;  5T3R A;  3JQ1 A;  3LS8 A;  2V4L A;  4G8K A;  1IKN D;  2IFU A;  2Y0B G;  1N0Q A;  2BED A;  4K5B A;  2UWJ G;  3TJP A;  1TJC A;  1TN8 A;  5G05 J;  1TR4 A;  4IRU A;  2XPY A;  4ANW A;  4A1S A;  4FC8 A;  3HXB A;  3VLF A;  1HXI A;  3NF1 A;  2XS8 A;  3UM3 A;  2WMN A;  4ME2 A;  4FA6 A;  2IOL A;  1WAO 1;  3FP3 A;  3O48 A;  2ETC A;  3R9A B;  4U8V D;  2NYJ A;  3V31 A;  4YDY A;  1MX2 A;  3ABM E;  3FTV A;  3J5Q B;  3U3W A;  4DX2 A;  3C72 A;  3ENE A;  4FJZ A;  4TUU A;  4U0S A;  3AG1 E;  3ZN3 A;  1NFI E;  4JPS A;  4RG9 A;  3VTX A;  2WXG A;  3DXM G;  3ZYQ A;  5JHB A;  2P9N G;  3LPZ A;  5C1D A;  2QFC A;  3LJ3 A;  4G23 A;  2VGX B;  4JC8 A;  3R7Q A;  5AQB A;  2V5Q C;  2OND A;  2Y4T A;  2M63 A;  3LCA A;  4GZD A;  1BD8 A;  1N4P A;  2PZI A;  5EN5 D;  1EPU A;  4GML A;  4DRX E;  1NI1 A;  4AIF A;  3B95 A;  1MQS A;  4XI9 A;  5B1B E;  1YYH A;  2KZT A;  2LO6 A;  3UX4 A;  1E8Z A;  3CLJ A;  3CK9 A;  5EX0 A;  1N4S A;  2VGE A;  4EBA A;  2X6J A;  4DUI A;  3ZHE A;  3Q49 B;  1YCS B;  2KXP C;  3UM0 A;  3JUE A;  3TWQ A;  4BWR A;  3UIO C;  4F1P A;  3CKB A;  2WXK A;  2WM9 A;  3HHM A;  2P9K G;  4JVS A;  3ZXP A;  2GRP B;  4UQY A;  3FU0 A;  4PDX A;  4ATZ D;  5LX8 A;  2WXO A;  3ZXS A;  1O1S A;  5LFA A;  2I6H A;  5FQ6 A;  4TRQ A;  3MKR A;  5FQ4 A;  2I9C A;  2C0L A;  4ABN A;  1IHB A;  4URK A;  3HXD A;  5EIB E;  3HXE A;  2X3M A;  4UI9 C;  3EIQ C;  1IQU A;  5EKQ D;  1N4R A;  5ENR D;  5G04 C;  2FEZ A;  4PS7 A;  2AW6 A;  3NB2 A;  3G2T A;  3S2A A;  3HDX A;  1AWC B;  5ENN A;  3BUA A;  3CVQ A;  3DEP A;  4JEH A;  1LD8 A;  4KVO A;  4KVM A;  3E34 A;  2LXL A;  3FY4 A;  2IEJ A;  3D9N A;  3TWW A;  5HQ8 A;  3AU5 A;  4YND A;  1OWN A;  4L9P A;  4WWO A;  3ASF A;  3P1U A;  2YNQ A;  3D3M A;  5FWQ A;  2XPI A;  4Y6W A;  2P9U G;  1E90 A;  4CEM A;  3KSQ A;  4GTQ A;  5FT9 A;  3MJW A;  4OVV A;  4YVO A;  2DYR E;  1V54 E;  4OAU C;  2EIJ E;  2A4Z A;  4WWN A;  3AS5 A;  3DSU A;  2KZT B;  3I5P A;  3ZYM A;  5LCW C;  2L6B A;  3JYS A;  2GRR B;  4PS3 A;  4BT8 A;  4J8F A;  2EIM E;  4FP7 A;  3ZHE B;  1OXJ A;  2WXN A;  4BEP A;  5D0Q D;  5HI7 A;  3BEE A;  3PNT B;  4TUM A;  3CSF A;  4LNB A;  2DZN A;  1QZ2 A;  3AG4 E;  3MV2 B;  1SVX A;  3PNL B;  2XGO A;  3LYA A;  1MZC A;  2OV8 A;  1N4Q A;  3PZ1 A;  4J8S A;  3DBS A;  2GGF A;  2JAB A;  4GA2 A;  4O1P A;  1FVH A;  4CRW A;  3LKU A;  5FZR A;  3ZVV A;  1H0A A;  3LVR E;  5A23 A;  2V4H C;  1QNF A;  4LNG A;  2WXH A;  2DZO A;  3CVU A;  4I1M A;  4L2L A;  3L82 A;  2KM4 A;  2ZU6 B;  3W9F A;  3D9H A;  1A5E A;  2VSY A;  4BTB A;  4FUL A;  4HFG A;  2BKG A;  4FHJ A;  3PH0 C;  1EF1 C;  4OVU A;  1OUV A;  5JA4 D;  3B7S A;  3RIB A;  4EPZ A; 
#chains in the Genus database with same CATH homology
 1BU9 A;  1YCS B;  5CED B;  1OY3 D;  2QC9 A;  4OAU C;  5FIN A;  2KXP C;  5D66 A;  3JUE A;  3V30 A;  3EHR A;  4J7W A;  4UUC A;  5AQ7 A;  3TWQ A;  4BES A;  4LNU D;  1IXV A;  5HS0 A;  4F1P A;  5CBN A;  5AAR A;  3NBN B;  2PNN A;  5HKP A;  2L6B A;  5JMN D;  5KWD A;  4J8Y A;  5AN8 A;  1SW6 A;  3F6Q A;  3UI2 A;  1MX4 A;  2ETC A;  5KNG A;  1BI8 B;  4YDW A;  2FO1 E;  3HRA A;  4U8V D;  3J5P A;  3TWV A;  3V2O A;  4ATZ D;  4A63 B;  2NYJ A;  4G8L A;  4BSZ B;  3TWR A;  1WDY A;  5CER B;  3T9K A;  3V31 A;  4YDY A;  1MX2 A;  4U96 D;  4BEP A;  5AQA A;  4HRM B;  2XZD G;  4TUM A;  3J5Q B;  1OT8 A;  4DX1 A;  4OAV B;  4DX2 A;  5ITZ F;  2DZN A;  3NOG D;  3UTM A;  4BET A;  3JXJ A;  1K3Z D;  1D9S A;  1IHB A;  2F8Y A;  3ZKJ A;  5EIB E;  1SVX A;  5BXO A;  3B7B A;  3JXI A;  3EU9 A;  4B93 B;  5ENT D;  4HQD A;  4Z68 A;  2DVW A;  2J8S D;  5CBO A;  3LJN A;  5FIO A;  2AJA A;  1NFI E;  4LG6 A;  5ENR D;  2KBX A;  1DC2 A;  4DX5 D;  3KEA A;  1S70 B;  5KBA A;  5ENO D;  5AQ9 A;  5EYL A;  2B0O E;  4BER A;  4HLL A;  4U95 D;  5KNH D;  4NIK A;  1AP7 A;  2JAB A;  4O1P A;  3TWU A;  4U8Y D;  4CYM D;  3W9G A;  4LSZ E;  2F37 A;  3IXE A;  2XZT G;  4QFV A;  5EID A;  4ZHB A;  4DX6 D;  4DX7 D;  4K5C A;  1AWC B;  2XEH A;  5BXU A;  1G3N B;  2F8X K;  4HRN A;  2HE0 A;  1YMP A;  1MX6 A;  3ZNG A;  3DEP A;  3TWS A;  4O1O A;  2Y1L E;  1QYM A;  3ZUV B;  2V4H C;  3ZU7 B;  3TWT A;  5AQB A;  4JB8 P;  3V2X A;  2V5Q C;  2MYO A;  2DZO A;  2XEN A;  3DEO A;  2DWZ A;  4O60 A;  4RLY A;  4C48 B;  5HRY A;  1BD8 A;  5CEC B;  5ENQ D;  4HI9 A;  1MYO A;  2P2C P;  3TWW A;  5EYP F;  4HI8 A;  3AAA C;  5EN5 D;  1DCQ A;  3V79 K;  1N0R A;  1UOH A;  4DRX E;  1MJ0 A;  1WG0 A;  4N5Q A;  4G8K A;  3HG0 D;  4GPM A;  1IKN D;  4K5A B;  3B95 A;  2Y0B G;  3AJI A;  3D9H A;  4HRL A;  5ENP D;  3W9F A;  5AAO A;  2A5E A;  3UXG A;  1N0Q A;  1K1B A;  1A5E A;  4CZ2 D;  1YYH A;  4QQI A;  5CEA A;  2BKG A;  2RFA A;  4K5B A;  5ENS D;  4F6R D;  4GMR A;  1BI7 B;  3Q9N C;  3C5R A;  2QYJ A;  2ZGG A;  3SO8 A;  2XEE A;  3NOC D;  4ZFH A;  4HNA D;  3Q9U C;  2BKK B;  4HB5 A;  1TR4 A;  4HBD A;  1BLX B;  1N11 A;  2ETA A;  2RFM A;  2ZGD A;  5EIL A;  1K1A A;  3TWX A;  2VGE A;  3EHQ A;  3T8K A;  5JA4 D;  4DUI A;  2ETB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...