1MYOA

Solution structure of myotrophin, nmr, 44 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
118
structure length
118
Chain Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOTROPHIN
publication title The structural basis of ankyrin-like repeat function as revealed by the solution structure of myotrophin.
pubmed doi rcsb
molecule tags Ank-repeat
total genus 15
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1myoA00
5FIOA 3AAAC 5JMND 2VGEA 2DZNA 3TWRA 1SW6A 1BD8A 1BI7B 5ENOD 5ENSD 3TWTA 4BERA 5BXOA 5HKPA 5AQBA 4O1PA 5ENPD 4HQDA 3NOCD 3NOGD 3UTMA 3JUEA 4A63B 1K1AA 3V79K 3V2XA 4K5BA 4F1PA 5CEAA 4BEPA 3KEAA 3ZU7B 5JA4D 2XZTG 4GMRA 3Q9NC 5ENTD 5KBAA 4OAUC 4G8LA 4B93B 5EIBE 2B0OE 3J5PA 1TR4A 3EU9A 2KXPC 3B95A 4LG6A 4NIKA 1OT8A 3UI2A 4HRMB 4J7WA 5AAOA 4BSZB 4J8YA 4HRLA 4C48B 5CBOA 5AQ9A 1K1BA 5ENQD 5EYPF 4DX6D 4HBDA 5CEDB 1N0QA 3ZKJA 4ZFHA 4BETA 4ZHBA 4UUCA 2DVWA 4OAVB 4U95D 3SO8A 3B7BA 2XZDG 1IHBA 5ENRD 1WDYA 4YDYA 2P2CP 3TWXA 2ETAA 4N5QA 2DWZA 3TWSA 2V4HC 2A5EA 1BLXB 1OY3D 5AQAA 4DX1A 3LJNA 1IXVA 2ZGDA 4LSZE 4HB5A 3DEOA 5EILA 2XEHA 4ATZD 4G8KA 3T9KA 3C5RA 1AWCB 2F37A 1NFIE 5BXUA 1MX6A 5EYLA 2MYOA 1D9SA 1S70B 2J8SD 4O60A 2RFMA 3TWWA 3TWVA 1SVXA 5AN8A 4QQIA 5KWDA 3ZNGA 4GPMA 4HNAD 5KNHD 4TUMA 4U96D 5AARA 1UOHA 2DZOA 3T8KA 2JABA 3F6QA 2AJAA 5D66A 5FINA 4DX5D 4CYMD 4JB8P 4LNUD 4YDWA 4DX7D 4K5AB 2L6BA 5CERB 4HI8A 2XEEA 2PNNA 1DC2A 2ETCA 2BKKB 3DEPA 2ZGGA 5AQ7A 2BKGA 1YCSB 1DCQA 2ETBA 3NBNB 1MX2A 1N0RA 1WG0A 3UXGA 1K3ZD 4DUIA 2FO1E 5EIDA 5HRYA 5HS0A 1N11A 3V30A 2QC9A 1A5EA 2Y1LE 2F8XK 1MJ0A 1AP7A 2KBXA 1IKND 2NYJA 3IXEA 4Z68A 3JXJA 3EHRA 4RLYA 2RFAA 1QYMA 2F8YA 2XENA 3V31A 5EN5D 5KNGA 3Q9UC 5CECB 5ITZF 2HE0A 1YMPA 4U8VD 1BU9A 3V2OA 3EHQA 4U8YD 3ZUVB 4HLLA 3W9GA 1MYOA 4HI9A 4DX2A 2Y0BG 4HRNA 3HRAA 3JXIA 2QYJA 3J5QB 3TWUA 1G3NB 3TWQA 3D9HA 4O1OA 1BI8B 2V5QC 4QFVA 3W9FA 4BESA 4DRXE 1YYHA 5CBNA 3AJIA 3HG0D 4K5CA 4CZ2D 4F6RD 1MX4A
chains in the Genus database with same CATH superfamily
4O6FA 5ENSD 5HKPA 1NI1A 4HQDA 1P5QA 4K0RA 4K5BA 3TG5A 5A7DB 4B94A 1JCSA 3EU5A 3Q9NC 3MA5A 4GTMA 3FDHA 4HRLA 3BG1B 5KJMA 1H2VC 4XX5A 2KZTB 3CGHA 1MQSA 2E0IA 3EUVA 3TWXA 4FHKA 4GTPA 2XPYA 4WWPA 3CQGB 3PVLA 4JD2G 2ZGDA 4I43A 1TNZA 2F37A 2GROB 3CK9A 2LUHA 1S70B 2RFMA 3ASDA 5KWDA 1JWGA 4L23A 1Z6TA 2P9PG 3RIBA 4DX5D 4N2QA 3CK8A 3UKUG 2VSXE 1Z3YA 2WXGA 3G2TA 5CMWA 3UT8A 5B3SE 2BKGA 2HR2A 3ABKE 2AXVA 4GZCA 4LERA 3GYZA 3ZXPA 3G2SA 4U63A 4FU3A 4RVBA 1AP7A 4TXQA 4Z68A 3ZYKA 4KZ0A 5FJYA 2L6JA 3MGBA 4F7AA 3IBEA 1BU9A 1S64A 4G26A 3G2VA 4HLLA 4RSYA 4HOTA 4BFRA 4MRUA 4F1SA 3LEWA 3NF1A 1KT1A 4GCOA 4FP7A 1HF8A 3SGHA 2LAHA 2WXOA 4CEMA 4G8LA 3PUKA 3FUMA 5BPPA 4EQFA 5CBOA 4LUNU 2YINA 1IHBA 3E32A 1H6PA 4YDOA 2IOLA 2GW1A 1SZAA 3Q73A 1NP7A 2X6KA 3D9NA 3FH5A 3T9KA 1JCQA 2EIJE 2MYOA 3K9IA 2OOEA 5BNWA 4QQIA 4U96D 4KXKB 3LY9A 4FADA 4J8EA 2J4DA 3F6QA 5D66A 4JEHA 3UM1A 1O5MA 2ETCA 2IFUA 4I1AA 1Z3XA 2IJGX 2RD0A 1Y8MA 3RSEG 3ZRHA 4YVQC 5C1DA 1OUVA 2X6JA 2JLBA 2WXLA 5HS0A 3V30A 1HG2A 3PZ3A 3B7SA 4TRQA 4P29A 5E75A 4GA0A 5CECB 4U0UA 3FWVA 1FVFA 3CK7A 4HI9A 3VLFA 2XRYA 4AY6A 1ZBPA 3DBSA 3QWVA 4UI9C 2Y4TA 3SQVA 3UM0A 1MX4A 1E8XA 3U9WA 4EZJA 3C98A 3SZ7A 2P9UG 5ENPD 2J07A 5CEAA 1DCEA 4EZKA 1H6OA 3B95A 3LVQE 5FWQA 4U04A 2WQ6A 3UT7A 4HOUA 5B1BE 4OVUA 4ZHBA 2EIME 2EILE 4U07A 4U95D 3FULA 1SA5A 5G04J 3L22A 2YHEA 3KAEA 2X6HA 4BY6A 3EIQC 5EILA 3TAXA 1ZU2A 1NA0A 3B7RL 5B1AE 2FI7A 4XI9A 4RG6A 5EX0A 1TJCA 5LCWJ 4UWKA 2PL2A 3ZNGA 2XHEA 4PUCA 1TEZA 4I1MA 2AXUA 5G05C 1XGWA 2H6IA 4TXRA 2KCVA 3DSVA 5D2MC 3ZGQA 4AP2A 3VTYA 5EX3A 2L6BA 3LPZA 3WG7E 4JHKA 4APOA 4CCAA 4ILHB 5JJ6A 1N9AA 4N5CA 4YNDA 3CVQA 2OV8A 2NYJA 3S7BA 3EHRA 1D8DA 5AJLA 2GRLA 5ARFA 5AIJA 3DPDA 3TG4A 4AVXA 2CHXA 3AJIA 1JPLA 1A17A 3S2AA 4URKA 2FO1E 1PAQA 4GTTA 3Q7AA 4N39A 5E76A 4H7XA 4GMRA 5ANLA 2XGMA 4B93B 1E7VA 2I2OA 3EU9A 3FY4A 2WXPA 5C2YA 5CCLA 3FTUA 4AIFA 3U3WA 4XKCA 3PE3A 3TWSA 2OVFA 2P9SG 4HB5A 3C5RA 5G55A 1YA0A 1OCCE 5BXUA 3D9PA 4HFGA 2ZISA 4XZ4A 1O1SA 3MKQA 2WVIA 3U64A 2DZOA 4I6EA 4GTRA 2UWJG 4Q94A 4K5AB 2R17C 4U0ZA 2XEEA 4BTBA 4G2VA 4CRWA 4A1GA 1PY1A 1MJ0A 2KBXA 3ABME 3IXEA 3SF4A 4RLYA 2I1JA 4I6JA 3ZYLA 2MHKA 3T5XA 1VDYA 2H6HA 4CGVA 5FT9A 3ZUVB 5LP0A 1KT0A 3D3MA 3HXDA 4UQYA 3ZYMA 4EECA 3LYAA 1WY6A 3DXMG 4C0EA 5BXOA 2IONA 1FVHA 3LJ3A 2J09A 4WUYA 1RW2A 1QNFA 2IF4A 4TXPA 4TUUA 4OAUC 2VSOE 5D0QD 1UG3A 2KXPC 1OT8A 2LSVA 4HBDA 4ZFHA 3CHSA 3NZUA 4XE0A 3EDTB 4GZ3A 3ZN3A 2KATA 4AEZC 3RU0A 2KZTA 4GZDA 4BT8A 3FEXA 4RG9A 3EHNA 4GPMA 3D9JA 2NSZA 3T8KA 1OCZE 3SHFA 2XCBA 1DC2A 4U7EB 3OXFA 4WNGA 1FT2A 2ZU6B 4B8AA 4ANWA 3SI5A 1TNUA 3OXGA 5FQ8A 4F3VA 1QYMA 2J49A 4KZCA 3UM3A 3V2OA 3FUJA 4DLOA 2Y0BG 5T3RA 3D9HA 3I5PA 3PH0C 4DRXE 1YYHA 4G1TA 1N54A 2ZIRA 3AAAC 1BD8A 3URZA 2A5UA 4ACKA 4PS3A 4E85A 5EDSA 4L7TA 4LNBA 2XRZA 1UN8A 2X3MA 2FEZA 3OTNA 1XNFA 3ZPJA 4ANUA 3FUKA 4HRMB 3ULQA 3VLEA 1N4QA 3QK0A 2EIKE 5M72A 3DWLG 3TL5A 3L16A 2MRIA 2V4HC 2VTBB 1TN7A 4G8KA 4KBQA 1U2VG 3PUJA 3AG1E 1E90A 5IY5E 2X6IA 3D9OA 4HNAD 3QWWA 3FUDA 3MYVA 3PZ2A 2WXJA 2WXMA 4UQZA 3UIPC 3QJZA 3D9KA 1PC2A 4GA1A 4HI8A 2PNNA 4JVSA 1SQMA 4DJAA 2ETBA 1OWOA 3UT4A 1TNBA 3SBSA 3APFA 2BEDA 3Q79A 3L13A 4Q69A 5BT1A 4FULA 1UW4B 3ZYQA 5CMYA 2HE0A 4AJWA 2XGOA 5FQ7A 3RRUA 3IV0A 5CRVA 1EF1C 2R02A 3Q7FA 4BESA 4E6HA 2AXZA 3SD5A 4XI0A 4ATGA 4CZ2D 2C0LA 3CVYA 2OEVA 5AQBA 3JUEA 2I1KA 2H6GA 4MS6A 4UWLA 3QKYA 2H6FA 2LSUA 1H6KA 3APDA 3ISMC 5D0OD 4NIKA 5AAOA 1UN9A 3BEEA 5CCMA 3VTXA 1UJKA 3FHEA 3R9MA 1N95A 3QC1A 5ENRD 3GZSA 1TJFA 4AV7A 3GZ1A 4NQ0A 4LSZE 1LD7A 5A23A 1B89A 4UI9J 3CVPA 3LS8A 2A4ZA 1EYHA 2YQ8A 3TWWA 4GZ5A 1Q2ZA 3I3NA 4TUMA 5LOZA 4CYMD 4IN3B 1IQRA 3ZVVA 3MV3B 4B8CB 3JCKC 4WNDA 4L2LA 1MX2A 4J8SA 4Y6WA 3UXGA 3NAWA 4HOQA 2QC9A 3LDZA 2Y1LE 1QBQA 4FJZA 3CVNA 4J8FA 3U4TA 2VSYA 2IY0C 4O1OA 2WQ7A 2KC7A 4X8QA 4GTQA 2P58C 4EBAA 5G05J 3PZDA 2EQXA 4JA9A 4NACA 4LNGA 3TWTA 5T4YA 2WB2A 1DNPA 3LXUX 3PDNA 3E30A 3KEAA 4I9EA 3LKUA 3L82A 4I1OB 3UX4A 5EIBE 2B0OE 4JHRA 5AJDA 1K1BA 5EYPF 3Q15A 3ZKJA 5LFAA 3RRNB 2FULA 4BETA 1JUQA 2UY1B 3N71A 3UINC 1KLXA 4UWHA 5HI7A 4M3OA 3ZHEB 3AG3E 2Y69E 4J8DA 1TNOA 3QARA 5EYLA 4O60A 2L0IA 1OWPA 4PH4B 3X2QE 3FP3A 3L6AA 1UOHA 1KZOA 4BSXA 4JA7A 5AQ7A 1IYGA 2VGXB 3NBNB 2WM9A 3FTXA 2F8XK 3CHMA 1E7UA 3QWPA 1H19A 4GPKA 3FU6A 4DPRA 3B13A 3RRMB 3TGOA 3ASFA 3HDXA 4QFVA 3HXFA 5AENA 1KPSB 4OYSA 3HVEB 4CDMA 1FCHA 5FIOA 2CG3A 3Q47B 3E37A 2R59A 4WNFA 4A3TA 3V79K 5BV1A 3UTMA 1K1AA 2BF0X 4JPSA 3L9TA 2XZTG 2P9NG 2LXMA 2P9KG 5KBAA 5JHBA 3J5PA 3IHYA 3FTYA 2CFUA 4C0MA 4GTSA 1SA4A 4TV3A 3CHQA 3KEZA 4FA6A 4C9BB 3B7BA 3FU3A 4KT6B 2XZDG 3DSWA 2IU1A 4FLHA 2WXRA 2WPVA 3D9LA 3FUNA 1BLXB 1OY3D 4EZLA 3LJNA 3CVLA 4DLQA 3AU5A 3D9IA 1D9SA 2PM6A 3I4RB 2GRQB 3C72A 3FUEA 4DK5A 3CV0A 2JABA 4IRUA 4JB8P 3U66A 2HYZA 3FUHA 2XQ0A 1WG0A 3JYSA 4DUIA 2XGSA 5HRYA 4KMOA 4CT4A 2GRRB 3ASNE 3S7DA 4HS2A 1N4RA 1O1RA 3Q9UC 4NRHB 4JHJA 5EN5D 1Y6IA 4U8VD 4NURA 2AW6A 1O1TA 3W9GA 4GYOA 3ZXSA 3Q49B 3JXIA 2XS8A 2QY7A 5JJTA 4EPZA 3UMVA 2FF4A 1ELKA 3W9FA 4CDRA 4F6RD 3MX3A 1JWFA 3ASHA 1DVPA 3CVWA 3PRZA 4IULA 1ZB1A 3DSTA 4GCNA 4HLEA 2Y4UA 3AS4A 3CVVA 5JA4D 3S7FA 4I17A 3UI2A 5AQ9A 3OXLA 1HU3A 5DIZA 1NZNA 4GZ6A 5FZQA 4FHJA 1HZ4A 1WDYA 3KSLA 2P2CP 3UIOC 3IKOB 4K03A 3FEYA 1EPUA 2R03A 4FJYA 3QNKA 3DEOA 3E33A 3Q78A 1MX6A 2VTBA 1WM5A 3UM2A 1SVXA 5AN8A 1JCRA 3ZFWA 2V4LA 5A6CA 5KNHD 4R7LA 1MHQA 3MEKA 3AS8A 2PQNA 4APFA 5ARGA 3JUIA 4MKTA 2ZGGA 4AOFA 5KJKA 4EHMA 1DCQA 4DI4A 2RG8A 3Q5MA 1N11A 2NXPA 4Q96A 1IKND 1OWLA 3FTVA 3DRAA 4JEUA 5KNGA 3ULYA 1NL4A 4CDNA 2KCLA 1IQUA 3PNLB 4RQIA 3QDNA 2KCKA 2V5QC 4PDXA 1E8YA 5KCMA 2PM7A 2CG2A 1SW6A 5ENOD 4BERA 3CHOA 4UI9K 3V2XA 3FTZA 3MV2B 1ELWA 3MZLB 4A55A 3BU8A 2XEVA 2AVPA 4LG6A 4DI3A 4BWRA 1N52A 1E8ZA 4C48B 3ONKA 4LEUA 3SNXA 2XPIA 2P9LG 3L54A 3EIJA 2NC9A 4BTAA 2OEWA 4G23A 1GW6A 1HH8A 4N5QA 3PNTB 2V0PA 3TXNA 2A5EA 4XKBA 5AYWD 1IXVA 2XEHA 4AM9A 1AWCB 2Y3AA 3RAUA 3MKRA 3NB2A 3CKCA 3CKBA 3CVUA 1S0PA 2CHWA 4ANXA 5FINA 3CHRA 2J08A 5CERB 3DXKG 2I9CA 2WXHA 4H7YA 4AY5A 1H2UA 1K3ZD 2DIWA 1Z5SC 2J4BA 3FH8A 1HXIA 1X81A 2CFZA 3AG2E 3PREA 4IYPA 3RJVA 4PS8A 3DSUA 3HIZA 1HE8A 5FQ6A 3CEQA 3CQCB 1QQEA 3TJPA 1BI7B 2YNQA 2R2LA 4OVVA 3AS5A 4G11A 4HXIA 3FH7A 3QB2A 3RO2A 1UJJA 5ENTD 2FO7A 3HXCA 4J0UA 1TR4A 3OAWA 3ZIMA 2IO3C 1S63A 3KSQA 3UQ3A 5CEDB 3P2BA 4GA2A 4L1BA 4W9RA 4GU5A 3SO8A 3GZ2A 2VYIA 3KD7A 2AWIA 3FUFA 2UY1A 4GYWA 2WXNA 3RO3A 3E4BA 3NZSA 3ZHEA 2C0MA 2J8SD 3SBTB 3VLDA 3O48A 3ZEFA 2CHZA 3UKRG 1LF8A 3CLJA 4UWFA 3DEPA 3NQPA 2WXIA 4A1SA 4A3VA 5FQ4A 2WMOA 5KJLA 2VGXA 5CRUA 3DSXA 4GMJA 3IHVA 3MCXA 2M63A 5LX8A 3V31A 3E34A 3TXMA 3EHQA 4DX2A 2PZIA 3ENEA 2QYJA 2IOSA 1E8WA 3UPVA 3ESLA 3CVXA 5CBNA 5KJNA 4KVMA 3JQ0A 3HG0D 2C2LA 4I2WA 5JMND 2VGEA 2DZNA 4ACLA 2ZXWE 4I9CA 3PEVB 2R05A 4A63B 1WAO1 3HVEA 3ZU7B 3ULEG 4XEIG 2JEKA 3ASGA 4FC8A 2R5SA 5ENQD 1N0QA 4N2SA 2DVWA 4OAVB 3T5VA 3SFZA 2HO1A 4HVBA 3RKVA 4YDYA 3T8MA 2ETAA 3HHMA 3C3QA 1X5BA 2OCCE 3TWVA 4I2ZA 2V5FA 4UQXA 2X38A 5AARA 5BV0A 4G24A 2AJAA 3P1UA 4LNUD 4JZYA 4V3IA 4N3CA 1N4PA 2LAIA 1H2TC 4WWNA 3HYMB 3B7TA 2OVBA 2L9BA 4BT9A 1E96B 4B0ZA 2WXKA 4YVOA 3Q75A 1TN8A 1TYQG 1YMPA 5J90A 1HX8A 1BI8B 3LY7A 2FBNA 3SFYA 3CHPA 5FZSA 1HO8A 3FTSA 3WXXA 2GRPB 4GYYA 2Q7FA 2J9QA 4F1PA 4U0SA 2GRMA 3DPYA 3FU5A 5CHEE 3ABLE 2DYSE 1OXJA 3C3RA 5BW8C 3APCA 4F53A 2XCCA 4UUCA 3L08A 2LNIA 3CSTA 5H7PA 2IEJA 2DWZA 4ANVA 2GRNB 1H0AA 1INZA 1OWMA 4GAAA 2F0YA 5ENNA 4GTVA 3IEGA 1N94A 3LY8A 3JQ1A 1LD8A 2MOWA 4ME2A 3SFXA 4KYOB 4GMLA 1RZ4A 1TNYA 2X6FA 4YDWA 4U8HA 4HOSA 4WNEA 3G2WA 2BKKB 2V8SE 1KZPA 4L2YA 2VSNA 2KM4A 2WQHA 3AG4E 3ML9A 1V54E 5FZRA 2RFAA 3PE4A 1OWNA 5ITZF 1ELRA 4MLPA 5G04C 3LVRE 5J08A 2E2EA 2IO2C 3J5QB 3RK6A 1G3NB 3TWUA 1HS6A 2BUGA 4UWGA 2IQCA 2L0TB 4AXHA 4K5CA 4G25A 2DYRE 3R7RA 1HG5A 3D9MA 3ESKA 5LCWC 3NOGD 2ILRA 4BEPA 3ASOE 3HXBA 3MJWA 2P9IG 2VJ8A 5BUZA 2VQ2A 3L17A 3G2UA 2DCPA 1NA3A 1EDUA 4BX9A 4D10C 2B6CA 4KVOA 1U3CA 3QOUA 3O4ZA 3B7UX 4LRZA 3FTWA 4JC8A 4JL0A 5JHAA 4N3BA 2XS1A 3C3OA 4ATZD 1OCOE 5ANRA 1FPPA 4YDEA 1L5JA 4FLBA 4WWOA 4ILIA 1K8KG 2EINE 2QFCA 3PEUB 3FUIA 3ZW3A 5DBKA 4DX7D 1V55E 4MBGA 3QAQA 1D8EA 1BPOA 2ONDA 1N0RA 4HORA 4GTOA 3R9AB 2BTDA 2XPZA 3UUXA 3AU4A 4JXTA 2XENA 3PZ1A 5G2NA 5FTPA 4U8YD 1MYOA 3GW4A 3CIAA 3BQOA 4HRNA 4L9PA 3TWQA 2VGYA 3I4GA 4PS7A 3EJNA 4M7CA 3TWRA 3ML8A 4O1PA 3NOCD 1N4SA 3FU0A 3R7QA 1W3BA 4GB9A 4CT0A 5T8IA 2QZAA 2RKKA 3HXEA 3EHMA 4J7WA 4BSZB 4J8YA 4DX6D 4EBAG 2YHCA 5JJ7A 3KS2A 1QZ2A 4I6GA 2GGFA 5AQAA 4DX1A 4N3AA 4JW1A 3ONLA 1OCRE 3MKQB 1NFIE 1U3DA 3FFLA 5EKQD 3S7JA 2LO6A 3PS6A 2DBAA 2QYUA 2LXLA 4LCTA 4Y6CA 3Q4AB 1YCSB 4J6IA 2HM8A 3LCAA 3SY2A 4CGWA 5EIDA 1HFAA 1TN6A 1SZ9A 3CSFA 3CR3A 1A5EA 1IHGA 1MZCA 1LTXA 3JXJA 4XIFA 2PQRA 2WMNA 3PZ4A 2F8YA 2WXQA 3BG0B 4ILGA 3DSSA 5HQ8A 4B89A 4ABNA 3HRAA 1FT1A 2I6HA 2WXFA 3BUAA 4WAFA 4BX8A
chains in the Genus database with same CATH topology
5FIOA 3AAAC 5JMND 2VGEA 2DZNA 3TWRA 1SW6A 1BD8A 1BI7B 5ENOD 5ENSD 3TWTA 4BERA 5BXOA 5HKPA 5AQBA 4O1PA 5ENPD 4HQDA 3NOCD 3NOGD 3UTMA 3JUEA 4A63B 1K1AA 3V79K 3V2XA 4K5BA 4F1PA 5CEAA 4BEPA 3KEAA 3ZU7B 5JA4D 2XZTG 4GMRA 3Q9NC 5ENTD 5KBAA 4OAUC 4G8LA 4B93B 5EIBE 2B0OE 3J5PA 1TR4A 3EU9A 2KXPC 3B95A 4LG6A 4NIKA 1OT8A 3UI2A 4HRMB 4J7WA 5AAOA 4BSZB 4J8YA 4HRLA 4C48B 5CBOA 5AQ9A 1K1BA 5ENQD 5EYPF 4DX6D 4HBDA 5CEDB 1N0QA 3ZKJA 4ZFHA 4BETA 4ZHBA 4UUCA 2DVWA 4OAVB 4U95D 3SO8A 3B7BA 2XZDG 1IHBA 5ENRD 1WDYA 4YDYA 2P2CP 3TWXA 2ETAA 4N5QA 2DWZA 3TWSA 2V4HC 2A5EA 1BLXB 1OY3D 5AQAA 4DX1A 3LJNA 1IXVA 2ZGDA 4LSZE 4HB5A 3DEOA 5EILA 2XEHA 4ATZD 4G8KA 3T9KA 3C5RA 1AWCB 2F37A 1NFIE 5BXUA 1MX6A 5EYLA 2MYOA 1D9SA 1S70B 2J8SD 4O60A 2RFMA 3TWWA 3TWVA 1SVXA 5AN8A 4QQIA 5KWDA 3ZNGA 4GPMA 4HNAD 5KNHD 4TUMA 4U96D 5AARA 1UOHA 2DZOA 3T8KA 2JABA 3F6QA 2AJAA 5D66A 5FINA 4DX5D 4CYMD 4JB8P 4LNUD 4YDWA 4DX7D 4K5AB 2L6BA 5CERB 4HI8A 2XEEA 2PNNA 1DC2A 2ETCA 2BKKB 3DEPA 2ZGGA 5AQ7A 2BKGA 1YCSB 1DCQA 2ETBA 3NBNB 1MX2A 1N0RA 1WG0A 3UXGA 1K3ZD 4DUIA 2FO1E 5EIDA 5HRYA 5HS0A 1N11A 3V30A 2QC9A 1A5EA 2Y1LE 2F8XK 1MJ0A 1AP7A 2KBXA 1IKND 2NYJA 3IXEA 4Z68A 3JXJA 3EHRA 4RLYA 2RFAA 1QYMA 2F8YA 2XENA 3V31A 5EN5D 5KNGA 3Q9UC 5CECB 5ITZF 2HE0A 1YMPA 4U8VD 1BU9A 3V2OA 3EHQA 4U8YD 3ZUVB 4HLLA 3W9GA 1MYOA 4HI9A 4DX2A 2Y0BG 4HRNA 3HRAA 3JXIA 2QYJA 3J5QB 3TWUA 1G3NB 3TWQA 3D9HA 4O1OA 1BI8B 2V5QC 4QFVA 3W9FA 4BESA 4DRXE 1YYHA 5CBNA 3AJIA 3HG0D 4K5CA 4CZ2D 4F6RD 1MX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FIO A;  3AAA C;  5JMN D;  2VGE A;  2DZN A;  3TWR A;  1SW6 A;  1BD8 A;  1BI7 B;  5ENO D;  5ENS D;  3TWT A;  4BER A;  5BXO A;  5HKP A;  5AQB A;  4O1P A;  5ENP D;  4HQD A;  3NOC D;  3NOG D;  3UTM A;  3JUE A;  4A63 B;  1K1A A;  3V79 K;  3V2X A;  4K5B A;  4F1P A;  5CEA A;  4BEP A;  3KEA A;  3ZU7 B;  5JA4 D;  2XZT G;  4GMR A;  3Q9N C;  5ENT D;  5KBA A;  4OAU C;  4G8L A;  4B93 B;  5EIB E;  2B0O E;  3J5P A;  1TR4 A;  3EU9 A;  2KXP C;  3B95 A;  4LG6 A;  4NIK A;  1OT8 A;  3UI2 A;  4HRM B;  4J7W A;  5AAO A;  4BSZ B;  4J8Y A;  4HRL A;  4C48 B;  5CBO A;  5AQ9 A;  1K1B A;  5ENQ D;  5EYP F;  4DX6 D;  4HBD A;  5CED B;  1N0Q A;  3ZKJ A;  4ZFH A;  4BET A;  4ZHB A;  4UUC A;  2DVW A;  4OAV B;  4U95 D;  3SO8 A;  3B7B A;  2XZD G;  1IHB A;  5ENR D;  1WDY A;  4YDY A;  2P2C P;  3TWX A;  2ETA A;  4N5Q A;  2DWZ A;  3TWS A;  2V4H C;  2A5E A;  1BLX B;  1OY3 D;  5AQA A;  4DX1 A;  3LJN A;  1IXV A;  2ZGD A;  4LSZ E;  4HB5 A;  3DEO A;  5EIL A;  2XEH A;  4ATZ D;  4G8K A;  3T9K A;  3C5R A;  1AWC B;  2F37 A;  1NFI E;  5BXU A;  1MX6 A;  5EYL A;  2MYO A;  1D9S A;  1S70 B;  2J8S D;  4O60 A;  2RFM A;  3TWW A;  3TWV A;  1SVX A;  5AN8 A;  4QQI A;  5KWD A;  3ZNG A;  4GPM A;  4HNA D;  5KNH D;  4TUM A;  4U96 D;  5AAR A;  1UOH A;  2DZO A;  3T8K A;  2JAB A;  3F6Q A;  2AJA A;  5D66 A;  5FIN A;  4DX5 D;  4CYM D;  4JB8 P;  4LNU D;  4YDW A;  4DX7 D;  4K5A B;  2L6B A;  5CER B;  4HI8 A;  2XEE A;  2PNN A;  1DC2 A;  2ETC A;  2BKK B;  3DEP A;  2ZGG A;  5AQ7 A;  2BKG A;  1YCS B;  1DCQ A;  2ETB A;  3NBN B;  1MX2 A;  1N0R A;  1WG0 A;  3UXG A;  1K3Z D;  4DUI A;  2FO1 E;  5EID A;  5HRY A;  5HS0 A;  1N11 A;  3V30 A;  2QC9 A;  1A5E A;  2Y1L E;  2F8X K;  1MJ0 A;  1AP7 A;  2KBX A;  1IKN D;  2NYJ A;  3IXE A;  4Z68 A;  3JXJ A;  3EHR A;  4RLY A;  2RFA A;  1QYM A;  2F8Y A;  2XEN A;  3V31 A;  5EN5 D;  5KNG A;  3Q9U C;  5CEC B;  5ITZ F;  2HE0 A;  1YMP A;  4U8V D;  1BU9 A;  3V2O A;  3EHQ A;  4U8Y D;  3ZUV B;  4HLL A;  3W9G A;  1MYO A;  4HI9 A;  4DX2 A;  2Y0B G;  4HRN A;  3HRA A;  3JXI A;  2QYJ A;  3J5Q B;  3TWU A;  1G3N B;  3TWQ A;  3D9H A;  4O1O A;  1BI8 B;  2V5Q C;  4QFV A;  3W9F A;  4BES A;  4DRX E;  1YYH A;  5CBN A;  3AJI A;  3HG0 D;  4K5C A;  4CZ2 D;  4F6R D;  1MX4 A; 
#chains in the Genus database with same CATH topology
 4O6F A;  5ENS D;  5HKP A;  1NI1 A;  4HQD A;  1P5Q A;  4K0R A;  4K5B A;  3TG5 A;  5A7D B;  4B94 A;  1JCS A;  3EU5 A;  3Q9N C;  3MA5 A;  4GTM A;  3FDH A;  4HRL A;  3BG1 B;  5KJM A;  1H2V C;  4XX5 A;  2KZT B;  3CGH A;  1MQS A;  2E0I A;  3EUV A;  3TWX A;  4FHK A;  4GTP A;  2XPY A;  4WWP A;  3CQG B;  3PVL A;  4JD2 G;  2ZGD A;  4I43 A;  1TNZ A;  2F37 A;  2GRO B;  3CK9 A;  2LUH A;  1S70 B;  2RFM A;  3ASD A;  5KWD A;  1JWG A;  4L23 A;  1Z6T A;  2P9P G;  3RIB A;  4DX5 D;  4N2Q A;  3CK8 A;  3UKU G;  2VSX E;  1Z3Y A;  2WXG A;  3G2T A;  5CMW A;  3UT8 A;  5B3S E;  2BKG A;  2HR2 A;  3ABK E;  2AXV A;  4GZC A;  4LER A;  3GYZ A;  3ZXP A;  3G2S A;  4U63 A;  4FU3 A;  4RVB A;  1AP7 A;  4TXQ A;  4Z68 A;  3ZYK A;  4KZ0 A;  5FJY A;  2L6J A;  3MGB A;  4F7A A;  3IBE A;  1BU9 A;  1S64 A;  4G26 A;  3G2V A;  4HLL A;  4RSY A;  4HOT A;  4BFR A;  4MRU A;  4F1S A;  3LEW A;  3NF1 A;  1KT1 A;  4GCO A;  4FP7 A;  1HF8 A;  3SGH A;  2LAH A;  2WXO A;  4CEM A;  4G8L A;  3PUK A;  3FUM A;  5BPP A;  4EQF A;  5CBO A;  4LUN U;  2YIN A;  1IHB A;  3E32 A;  1H6P A;  4YDO A;  2IOL A;  2GW1 A;  1SZA A;  3Q73 A;  1NP7 A;  2X6K A;  3D9N A;  3FH5 A;  3T9K A;  1JCQ A;  2EIJ E;  2MYO A;  3K9I A;  2OOE A;  5BNW A;  4QQI A;  4U96 D;  4KXK B;  3LY9 A;  4FAD A;  4J8E A;  2J4D A;  3F6Q A;  5D66 A;  4JEH A;  3UM1 A;  1O5M A;  2ETC A;  2IFU A;  4I1A A;  1Z3X A;  2IJG X;  2RD0 A;  1Y8M A;  3RSE G;  3ZRH A;  4YVQ C;  5C1D A;  1OUV A;  2X6J A;  2JLB A;  2WXL A;  5HS0 A;  3V30 A;  1HG2 A;  3PZ3 A;  3B7S A;  4TRQ A;  4P29 A;  5E75 A;  4GA0 A;  5CEC B;  4U0U A;  3FWV A;  1FVF A;  3CK7 A;  4HI9 A;  3VLF A;  2XRY A;  4AY6 A;  1ZBP A;  3DBS A;  3QWV A;  4UI9 C;  2Y4T A;  3SQV A;  3UM0 A;  1MX4 A;  1E8X A;  3U9W A;  4EZJ A;  3C98 A;  3SZ7 A;  2P9U G;  5ENP D;  2J07 A;  5CEA A;  1DCE A;  4EZK A;  1H6O A;  3B95 A;  3LVQ E;  5FWQ A;  4U04 A;  2WQ6 A;  3UT7 A;  4HOU A;  5B1B E;  4OVU A;  4ZHB A;  2EIM E;  2EIL E;  4U07 A;  4U95 D;  3FUL A;  1SA5 A;  5G04 J;  3L22 A;  2YHE A;  3KAE A;  2X6H A;  4BY6 A;  3EIQ C;  5EIL A;  3TAX A;  1ZU2 A;  1NA0 A;  3B7R L;  5B1A E;  2FI7 A;  4XI9 A;  4RG6 A;  5EX0 A;  1TJC A;  5LCW J;  4UWK A;  2PL2 A;  3ZNG A;  2XHE A;  4PUC A;  1TEZ A;  4I1M A;  2AXU A;  5G05 C;  1XGW A;  2H6I A;  4TXR A;  2KCV A;  3DSV A;  5D2M C;  3ZGQ A;  4AP2 A;  3VTY A;  5EX3 A;  2L6B A;  3LPZ A;  3WG7 E;  4JHK A;  4APO A;  4CCA A;  4ILH B;  5JJ6 A;  1N9A A;  4N5C A;  4YND A;  3CVQ A;  2OV8 A;  2NYJ A;  3S7B A;  3EHR A;  1D8D A;  5AJL A;  2GRL A;  5ARF A;  5AIJ A;  3DPD A;  3TG4 A;  4AVX A;  2CHX A;  3AJI A;  1JPL A;  1A17 A;  3S2A A;  4URK A;  2FO1 E;  1PAQ A;  4GTT A;  3Q7A A;  4N39 A;  5E76 A;  4H7X A;  4GMR A;  5ANL A;  2XGM A;  4B93 B;  1E7V A;  2I2O A;  3EU9 A;  3FY4 A;  2WXP A;  5C2Y A;  5CCL A;  3FTU A;  4AIF A;  3U3W A;  4XKC A;  3PE3 A;  3TWS A;  2OVF A;  2P9S G;  4HB5 A;  3C5R A;  5G55 A;  1YA0 A;  1OCC E;  5BXU A;  3D9P A;  4HFG A;  2ZIS A;  4XZ4 A;  1O1S A;  3MKQ A;  2WVI A;  3U64 A;  2DZO A;  4I6E A;  4GTR A;  2UWJ G;  4Q94 A;  4K5A B;  2R17 C;  4U0Z A;  2XEE A;  4BTB A;  4G2V A;  4CRW A;  4A1G A;  1PY1 A;  1MJ0 A;  2KBX A;  3ABM E;  3IXE A;  3SF4 A;  4RLY A;  2I1J A;  4I6J A;  3ZYL A;  2MHK A;  3T5X A;  1VDY A;  2H6H A;  4CGV A;  5FT9 A;  3ZUV B;  5LP0 A;  1KT0 A;  3D3M A;  3HXD A;  4UQY A;  3ZYM A;  4EEC A;  3LYA A;  1WY6 A;  3DXM G;  4C0E A;  5BXO A;  2ION A;  1FVH A;  3LJ3 A;  2J09 A;  4WUY A;  1RW2 A;  1QNF A;  2IF4 A;  4TXP A;  4TUU A;  4OAU C;  2VSO E;  5D0Q D;  1UG3 A;  2KXP C;  1OT8 A;  2LSV A;  4HBD A;  4ZFH A;  3CHS A;  3NZU A;  4XE0 A;  3EDT B;  4GZ3 A;  3ZN3 A;  2KAT A;  4AEZ C;  3RU0 A;  2KZT A;  4GZD A;  4BT8 A;  3FEX A;  4RG9 A;  3EHN A;  4GPM A;  3D9J A;  2NSZ A;  3T8K A;  1OCZ E;  3SHF A;  2XCB A;  1DC2 A;  4U7E B;  3OXF A;  4WNG A;  1FT2 A;  2ZU6 B;  4B8A A;  4ANW A;  3SI5 A;  1TNU A;  3OXG A;  5FQ8 A;  4F3V A;  1QYM A;  2J49 A;  4KZC A;  3UM3 A;  3V2O A;  3FUJ A;  4DLO A;  2Y0B G;  5T3R A;  3D9H A;  3I5P A;  3PH0 C;  4DRX E;  1YYH A;  4G1T A;  1N54 A;  2ZIR A;  3AAA C;  1BD8 A;  3URZ A;  2A5U A;  4ACK A;  4PS3 A;  4E85 A;  5EDS A;  4L7T A;  4LNB A;  2XRZ A;  1UN8 A;  2X3M A;  2FEZ A;  3OTN A;  1XNF A;  3ZPJ A;  4ANU A;  3FUK A;  4HRM B;  3ULQ A;  3VLE A;  1N4Q A;  3QK0 A;  2EIK E;  5M72 A;  3DWL G;  3TL5 A;  3L16 A;  2MRI A;  2V4H C;  2VTB B;  1TN7 A;  4G8K A;  4KBQ A;  1U2V G;  3PUJ A;  3AG1 E;  1E90 A;  5IY5 E;  2X6I A;  3D9O A;  4HNA D;  3QWW A;  3FUD A;  3MYV A;  3PZ2 A;  2WXJ A;  2WXM A;  4UQZ A;  3UIP C;  3QJZ A;  3D9K A;  1PC2 A;  4GA1 A;  4HI8 A;  2PNN A;  4JVS A;  1SQM A;  4DJA A;  2ETB A;  1OWO A;  3UT4 A;  1TNB A;  3SBS A;  3APF A;  2BED A;  3Q79 A;  3L13 A;  4Q69 A;  5BT1 A;  4FUL A;  1UW4 B;  3ZYQ A;  5CMY A;  2HE0 A;  4AJW A;  2XGO A;  5FQ7 A;  3RRU A;  3IV0 A;  5CRV A;  1EF1 C;  2R02 A;  3Q7F A;  4BES A;  4E6H A;  2AXZ A;  3SD5 A;  4XI0 A;  4ATG A;  4CZ2 D;  2C0L A;  3CVY A;  2OEV A;  5AQB A;  3JUE A;  2I1K A;  2H6G A;  4MS6 A;  4UWL A;  3QKY A;  2H6F A;  2LSU A;  1H6K A;  3APD A;  3ISM C;  5D0O D;  4NIK A;  5AAO A;  1UN9 A;  3BEE A;  5CCM A;  3VTX A;  1UJK A;  3FHE A;  3R9M A;  1N95 A;  3QC1 A;  5ENR D;  3GZS A;  1TJF A;  4AV7 A;  3GZ1 A;  4NQ0 A;  4LSZ E;  1LD7 A;  5A23 A;  1B89 A;  4UI9 J;  3CVP A;  3LS8 A;  2A4Z A;  1EYH A;  2YQ8 A;  3TWW A;  4GZ5 A;  1Q2Z A;  3I3N A;  4TUM A;  5LOZ A;  4CYM D;  4IN3 B;  1IQR A;  3ZVV A;  3MV3 B;  4B8C B;  3JCK C;  4WND A;  4L2L A;  1MX2 A;  4J8S A;  4Y6W A;  3UXG A;  3NAW A;  4HOQ A;  2QC9 A;  3LDZ A;  2Y1L E;  1QBQ A;  4FJZ A;  3CVN A;  4J8F A;  3U4T A;  2VSY A;  2IY0 C;  4O1O A;  2WQ7 A;  2KC7 A;  4X8Q A;  4GTQ A;  2P58 C;  4EBA A;  5G05 J;  3PZD A;  2EQX A;  4JA9 A;  4NAC A;  4LNG A;  3TWT A;  5T4Y A;  2WB2 A;  1DNP A;  3LXU X;  3PDN A;  3E30 A;  3KEA A;  4I9E A;  3LKU A;  3L82 A;  4I1O B;  3UX4 A;  5EIB E;  2B0O E;  4JHR A;  5AJD A;  1K1B A;  5EYP F;  3Q15 A;  3ZKJ A;  5LFA A;  3RRN B;  2FUL A;  4BET A;  1JUQ A;  2UY1 B;  3N71 A;  3UIN C;  1KLX A;  4UWH A;  5HI7 A;  4M3O A;  3ZHE B;  3AG3 E;  2Y69 E;  4J8D A;  1TNO A;  3QAR A;  5EYL A;  4O60 A;  2L0I A;  1OWP A;  4PH4 B;  3X2Q E;  3FP3 A;  3L6A A;  1UOH A;  1KZO A;  4BSX A;  4JA7 A;  5AQ7 A;  1IYG A;  2VGX B;  3NBN B;  2WM9 A;  3FTX A;  2F8X K;  3CHM A;  1E7U A;  3QWP A;  1H19 A;  4GPK A;  3FU6 A;  4DPR A;  3B13 A;  3RRM B;  3TGO A;  3ASF A;  3HDX A;  4QFV A;  3HXF A;  5AEN A;  1KPS B;  4OYS A;  3HVE B;  4CDM A;  1FCH A;  5FIO A;  2CG3 A;  3Q47 B;  3E37 A;  2R59 A;  4WNF A;  4A3T A;  3V79 K;  5BV1 A;  3UTM A;  1K1A A;  2BF0 X;  4JPS A;  3L9T A;  2XZT G;  2P9N G;  2LXM A;  2P9K G;  5KBA A;  5JHB A;  3J5P A;  3IHY A;  3FTY A;  2CFU A;  4C0M A;  4GTS A;  1SA4 A;  4TV3 A;  3CHQ A;  3KEZ A;  4FA6 A;  4C9B B;  3B7B A;  3FU3 A;  4KT6 B;  2XZD G;  3DSW A;  2IU1 A;  4FLH A;  2WXR A;  2WPV A;  3D9L A;  3FUN A;  1BLX B;  1OY3 D;  4EZL A;  3LJN A;  3CVL A;  4DLQ A;  3AU5 A;  3D9I A;  1D9S A;  2PM6 A;  3I4R B;  2GRQ B;  3C72 A;  3FUE A;  4DK5 A;  3CV0 A;  2JAB A;  4IRU A;  4JB8 P;  3U66 A;  2HYZ A;  3FUH A;  2XQ0 A;  1WG0 A;  3JYS A;  4DUI A;  2XGS A;  5HRY A;  4KMO A;  4CT4 A;  2GRR B;  3ASN E;  3S7D A;  4HS2 A;  1N4R A;  1O1R A;  3Q9U C;  4NRH B;  4JHJ A;  5EN5 D;  1Y6I A;  4U8V D;  4NUR A;  2AW6 A;  1O1T A;  3W9G A;  4GYO A;  3ZXS A;  3Q49 B;  3JXI A;  2XS8 A;  2QY7 A;  5JJT A;  4EPZ A;  3UMV A;  2FF4 A;  1ELK A;  3W9F A;  4CDR A;  4F6R D;  3MX3 A;  1JWF A;  3ASH A;  1DVP A;  3CVW A;  3PRZ A;  4IUL A;  1ZB1 A;  3DST A;  4GCN A;  4HLE A;  2Y4U A;  3AS4 A;  3CVV A;  5JA4 D;  3S7F A;  4I17 A;  3UI2 A;  5AQ9 A;  3OXL A;  1HU3 A;  5DIZ A;  1NZN A;  4GZ6 A;  5FZQ A;  4FHJ A;  1HZ4 A;  1WDY A;  3KSL A;  2P2C P;  3UIO C;  3IKO B;  4K03 A;  3FEY A;  1EPU A;  2R03 A;  4FJY A;  3QNK A;  3DEO A;  3E33 A;  3Q78 A;  1MX6 A;  2VTB A;  1WM5 A;  3UM2 A;  1SVX A;  5AN8 A;  1JCR A;  3ZFW A;  2V4L A;  5A6C A;  5KNH D;  4R7L A;  1MHQ A;  3MEK A;  3AS8 A;  2PQN A;  4APF A;  5ARG A;  3JUI A;  4MKT A;  2ZGG A;  4AOF A;  5KJK A;  4EHM A;  1DCQ A;  4DI4 A;  2RG8 A;  3Q5M A;  1N11 A;  2NXP A;  4Q96 A;  1IKN D;  1OWL A;  3FTV A;  3DRA A;  4JEU A;  5KNG A;  3ULY A;  1NL4 A;  4CDN A;  2KCL A;  1IQU A;  3PNL B;  4RQI A;  3QDN A;  2KCK A;  2V5Q C;  4PDX A;  1E8Y A;  5KCM A;  2PM7 A;  2CG2 A;  1SW6 A;  5ENO D;  4BER A;  3CHO A;  4UI9 K;  3V2X A;  3FTZ A;  3MV2 B;  1ELW A;  3MZL B;  4A55 A;  3BU8 A;  2XEV A;  2AVP A;  4LG6 A;  4DI3 A;  4BWR A;  1N52 A;  1E8Z A;  4C48 B;  3ONK A;  4LEU A;  3SNX A;  2XPI A;  2P9L G;  3L54 A;  3EIJ A;  2NC9 A;  4BTA A;  2OEW A;  4G23 A;  1GW6 A;  1HH8 A;  4N5Q A;  3PNT B;  2V0P A;  3TXN A;  2A5E A;  4XKB A;  5AYW D;  1IXV A;  2XEH A;  4AM9 A;  1AWC B;  2Y3A A;  3RAU A;  3MKR A;  3NB2 A;  3CKC A;  3CKB A;  3CVU A;  1S0P A;  2CHW A;  4ANX A;  5FIN A;  3CHR A;  2J08 A;  5CER B;  3DXK G;  2I9C A;  2WXH A;  4H7Y A;  4AY5 A;  1H2U A;  1K3Z D;  2DIW A;  1Z5S C;  2J4B A;  3FH8 A;  1HXI A;  1X81 A;  2CFZ A;  3AG2 E;  3PRE A;  4IYP A;  3RJV A;  4PS8 A;  3DSU A;  3HIZ A;  1HE8 A;  5FQ6 A;  3CEQ A;  3CQC B;  1QQE A;  3TJP A;  1BI7 B;  2YNQ A;  2R2L A;  4OVV A;  3AS5 A;  4G11 A;  4HXI A;  3FH7 A;  3QB2 A;  3RO2 A;  1UJJ A;  5ENT D;  2FO7 A;  3HXC A;  4J0U A;  1TR4 A;  3OAW A;  3ZIM A;  2IO3 C;  1S63 A;  3KSQ A;  3UQ3 A;  5CED B;  3P2B A;  4GA2 A;  4L1B A;  4W9R A;  4GU5 A;  3SO8 A;  3GZ2 A;  2VYI A;  3KD7 A;  2AWI A;  3FUF A;  2UY1 A;  4GYW A;  2WXN A;  3RO3 A;  3E4B A;  3NZS A;  3ZHE A;  2C0M A;  2J8S D;  3SBT B;  3VLD A;  3O48 A;  3ZEF A;  2CHZ A;  3UKR G;  1LF8 A;  3CLJ A;  4UWF A;  3DEP A;  3NQP A;  2WXI A;  4A1S A;  4A3V A;  5FQ4 A;  2WMO A;  5KJL A;  2VGX A;  5CRU A;  3DSX A;  4GMJ A;  3IHV A;  3MCX A;  2M63 A;  5LX8 A;  3V31 A;  3E34 A;  3TXM A;  3EHQ A;  4DX2 A;  2PZI A;  3ENE A;  2QYJ A;  2IOS A;  1E8W A;  3UPV A;  3ESL A;  3CVX A;  5CBN A;  5KJN A;  4KVM A;  3JQ0 A;  3HG0 D;  2C2L A;  4I2W A;  5JMN D;  2VGE A;  2DZN A;  4ACL A;  2ZXW E;  4I9C A;  3PEV B;  2R05 A;  4A63 B;  1WAO 1;  3HVE A;  3ZU7 B;  3ULE G;  4XEI G;  2JEK A;  3ASG A;  4FC8 A;  2R5S A;  5ENQ D;  1N0Q A;  4N2S A;  2DVW A;  4OAV B;  3T5V A;  3SFZ A;  2HO1 A;  4HVB A;  3RKV A;  4YDY A;  3T8M A;  2ETA A;  3HHM A;  3C3Q A;  1X5B A;  2OCC E;  3TWV A;  4I2Z A;  2V5F A;  4UQX A;  2X38 A;  5AAR A;  5BV0 A;  4G24 A;  2AJA A;  3P1U A;  4LNU D;  4JZY A;  4V3I A;  4N3C A;  1N4P A;  2LAI A;  1H2T C;  4WWN A;  3HYM B;  3B7T A;  2OVB A;  2L9B A;  4BT9 A;  1E96 B;  4B0Z A;  2WXK A;  4YVO A;  3Q75 A;  1TN8 A;  1TYQ G;  1YMP A;  5J90 A;  1HX8 A;  1BI8 B;  3LY7 A;  2FBN A;  3SFY A;  3CHP A;  5FZS A;  1HO8 A;  3FTS A;  3WXX A;  2GRP B;  4GYY A;  2Q7F A;  2J9Q A;  4F1P A;  4U0S A;  2GRM A;  3DPY A;  3FU5 A;  5CHE E;  3ABL E;  2DYS E;  1OXJ A;  3C3R A;  5BW8 C;  3APC A;  4F53 A;  2XCC A;  4UUC A;  3L08 A;  2LNI A;  3CST A;  5H7P A;  2IEJ A;  2DWZ A;  4ANV A;  2GRN B;  1H0A A;  1INZ A;  1OWM A;  4GAA A;  2F0Y A;  5ENN A;  4GTV A;  3IEG A;  1N94 A;  3LY8 A;  3JQ1 A;  1LD8 A;  2MOW A;  4ME2 A;  3SFX A;  4KYO B;  4GML A;  1RZ4 A;  1TNY A;  2X6F A;  4YDW A;  4U8H A;  4HOS A;  4WNE A;  3G2W A;  2BKK B;  2V8S E;  1KZP A;  4L2Y A;  2VSN A;  2KM4 A;  2WQH A;  3AG4 E;  3ML9 A;  1V54 E;  5FZR A;  2RFA A;  3PE4 A;  1OWN A;  5ITZ F;  1ELR A;  4MLP A;  5G04 C;  3LVR E;  5J08 A;  2E2E A;  2IO2 C;  3J5Q B;  3RK6 A;  1G3N B;  3TWU A;  1HS6 A;  2BUG A;  4UWG A;  2IQC A;  2L0T B;  4AXH A;  4K5C A;  4G25 A;  2DYR E;  3R7R A;  1HG5 A;  3D9M A;  3ESK A;  5LCW C;  3NOG D;  2ILR A;  4BEP A;  3ASO E;  3HXB A;  3MJW A;  2P9I G;  2VJ8 A;  5BUZ A;  2VQ2 A;  3L17 A;  3G2U A;  2DCP A;  1NA3 A;  1EDU A;  4BX9 A;  4D10 C;  2B6C A;  4KVO A;  1U3C A;  3QOU A;  3O4Z A;  3B7U X;  4LRZ A;  3FTW A;  4JC8 A;  4JL0 A;  5JHA A;  4N3B A;  2XS1 A;  3C3O A;  4ATZ D;  1OCO E;  5ANR A;  1FPP A;  4YDE A;  1L5J A;  4FLB A;  4WWO A;  4ILI A;  1K8K G;  2EIN E;  2QFC A;  3PEU B;  3FUI A;  3ZW3 A;  5DBK A;  4DX7 D;  1V55 E;  4MBG A;  3QAQ A;  1D8E A;  1BPO A;  2OND A;  1N0R A;  4HOR A;  4GTO A;  3R9A B;  2BTD A;  2XPZ A;  3UUX A;  3AU4 A;  4JXT A;  2XEN A;  3PZ1 A;  5G2N A;  5FTP A;  4U8Y D;  1MYO A;  3GW4 A;  3CIA A;  3BQO A;  4HRN A;  4L9P A;  3TWQ A;  2VGY A;  3I4G A;  4PS7 A;  3EJN A;  4M7C A;  3TWR A;  3ML8 A;  4O1P A;  3NOC D;  1N4S A;  3FU0 A;  3R7Q A;  1W3B A;  4GB9 A;  4CT0 A;  5T8I A;  2QZA A;  2RKK A;  3HXE A;  3EHM A;  4J7W A;  4BSZ B;  4J8Y A;  4DX6 D;  4EBA G;  2YHC A;  5JJ7 A;  3KS2 A;  1QZ2 A;  4I6G A;  2GGF A;  5AQA A;  4DX1 A;  4N3A A;  4JW1 A;  3ONL A;  1OCR E;  3MKQ B;  1NFI E;  1U3D A;  3FFL A;  5EKQ D;  3S7J A;  2LO6 A;  3PS6 A;  2DBA A;  2QYU A;  2LXL A;  4LCT A;  4Y6C A;  3Q4A B;  1YCS B;  4J6I A;  2HM8 A;  3LCA A;  3SY2 A;  4CGW A;  5EID A;  1HFA A;  1TN6 A;  1SZ9 A;  3CSF A;  3CR3 A;  1A5E A;  1IHG A;  1MZC A;  1LTX A;  3JXJ A;  4XIF A;  2PQR A;  2WMN A;  3PZ4 A;  2F8Y A;  2WXQ A;  3BG0 B;  4ILG A;  3DSS A;  5HQ8 A;  4B89 A;  4ABN A;  3HRA A;  1FT1 A;  2I6H A;  2WXF A;  3BUA A;  4WAF A;  4BX8 A; 
#chains in the Genus database with same CATH homology
 5FIO A;  3AAA C;  5JMN D;  2VGE A;  2DZN A;  3TWR A;  1SW6 A;  1BD8 A;  1BI7 B;  5ENO D;  5ENS D;  3TWT A;  4BER A;  5BXO A;  5HKP A;  5AQB A;  4O1P A;  5ENP D;  4HQD A;  3NOC D;  3NOG D;  3UTM A;  3JUE A;  4A63 B;  1K1A A;  3V79 K;  3V2X A;  4K5B A;  4F1P A;  5CEA A;  4BEP A;  3KEA A;  3ZU7 B;  5JA4 D;  2XZT G;  4GMR A;  3Q9N C;  5ENT D;  5KBA A;  4OAU C;  4G8L A;  4B93 B;  5EIB E;  2B0O E;  3J5P A;  1TR4 A;  3EU9 A;  2KXP C;  3B95 A;  4LG6 A;  4NIK A;  1OT8 A;  3UI2 A;  4HRM B;  4J7W A;  5AAO A;  4BSZ B;  4J8Y A;  4HRL A;  4C48 B;  5CBO A;  5AQ9 A;  1K1B A;  5ENQ D;  5EYP F;  4DX6 D;  4HBD A;  5CED B;  1N0Q A;  3ZKJ A;  4ZFH A;  4BET A;  4ZHB A;  4UUC A;  2DVW A;  4OAV B;  4U95 D;  3SO8 A;  3B7B A;  2XZD G;  1IHB A;  5ENR D;  1WDY A;  4YDY A;  2P2C P;  3TWX A;  2ETA A;  4N5Q A;  2DWZ A;  3TWS A;  2V4H C;  2A5E A;  1BLX B;  1OY3 D;  5AQA A;  4DX1 A;  3LJN A;  1IXV A;  2ZGD A;  4LSZ E;  4HB5 A;  3DEO A;  5EIL A;  2XEH A;  4ATZ D;  4G8K A;  3T9K A;  3C5R A;  1AWC B;  2F37 A;  1NFI E;  5BXU A;  1MX6 A;  5EYL A;  2MYO A;  1D9S A;  1S70 B;  2J8S D;  4O60 A;  2RFM A;  3TWW A;  3TWV A;  1SVX A;  5AN8 A;  4QQI A;  5KWD A;  3ZNG A;  4GPM A;  4HNA D;  5KNH D;  4TUM A;  4U96 D;  5AAR A;  1UOH A;  2DZO A;  3T8K A;  2JAB A;  3F6Q A;  2AJA A;  5D66 A;  5FIN A;  4DX5 D;  4CYM D;  4JB8 P;  4LNU D;  4YDW A;  4DX7 D;  4K5A B;  2L6B A;  5CER B;  4HI8 A;  2XEE A;  2PNN A;  1DC2 A;  2ETC A;  2BKK B;  3DEP A;  2ZGG A;  5AQ7 A;  2BKG A;  1YCS B;  1DCQ A;  2ETB A;  3NBN B;  1MX2 A;  1N0R A;  1WG0 A;  3UXG A;  1K3Z D;  4DUI A;  2FO1 E;  5EID A;  5HRY A;  5HS0 A;  1N11 A;  3V30 A;  2QC9 A;  1A5E A;  2Y1L E;  2F8X K;  1MJ0 A;  1AP7 A;  2KBX A;  1IKN D;  2NYJ A;  3IXE A;  4Z68 A;  3JXJ A;  3EHR A;  4RLY A;  2RFA A;  1QYM A;  2F8Y A;  2XEN A;  3V31 A;  5EN5 D;  5KNG A;  3Q9U C;  5CEC B;  5ITZ F;  2HE0 A;  1YMP A;  4U8V D;  1BU9 A;  3V2O A;  3EHQ A;  4U8Y D;  3ZUV B;  4HLL A;  3W9G A;  1MYO A;  4HI9 A;  4DX2 A;  2Y0B G;  4HRN A;  3HRA A;  3JXI A;  2QYJ A;  3J5Q B;  3TWU A;  1G3N B;  3TWQ A;  3D9H A;  4O1O A;  1BI8 B;  2V5Q C;  4QFV A;  3W9F A;  4BES A;  4DRX E;  1YYH A;  5CBN A;  3AJI A;  3HG0 D;  4K5C A;  4CZ2 D;  4F6R D;  1MX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...