1MYOA

Solution structure of myotrophin, nmr, 44 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
118
structure length
118
Chain Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ank-repeat
molecule keywords MYOTROPHIN
publication title The structural basis of ankyrin-like repeat function as revealed by the solution structure of myotrophin.
pubmed doi rcsb
total genus 15
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1myoA00
3J5QB 4DUIA 4HNAD 4HI8A 3IXEA 4J7WA 4DX1A 2F37A 2XZTG 2J8SD 5FINA 5ENRD 1AWCB 3NOGD 5CBOA 3ZNGA 5CERB 1BD8A 3DEOA 4BEPA 2L6BA 4UUCA 5HRYA 2DVWA 3J5PA 1N11A 2RFMA 3HG0D 5CECB 5KBAA 3D9HA 3ZU7B 4HI9A 4GPMA 3KEAA 4CZ2D 3AJIA 3T9KA 4QFVA 2A5EA 4DX6D 2XENA 3EHQA 1MYOA 5EYLA 5D66A 3JUEA 1YMPA 1MX6A 3TWUA 2BKGA 4JB8P 5JA4D 1NFIE 1YYHA 1N0QA 4BSZB 3W9GA 5CEAA 1WDYA 1QYMA 3B95A 2AJAA 2V5QC 5EIDA 3EU9A 3ZKJA 5KNHD 1DC2A 4U8YD 4C48B 1SW6A 2B0OE 2DZNA 4O1PA 4O60A 2F8XK 4LG6A 1BI8B 4K5CA 4O1OA 3B7BA 2QC9A 4U96D 2ZGGA 3TWRA 3TWVA 3UTMA 4DX2A 1A5EA 5EN5D 4DRXE 4J8YA 5JMND 5AQAA 4U8VD 4B93B 4LSZE 1BI7B 5ENTD 3Q9NC 4YDWA 5AN8A 2VGEA 3NOCD 4HQDA 2ETBA 3JXJA 3TWTA 2DWZA 2XZDG 3SO8A 4DX7D 2F8YA 4BETA 5EILA 1OT8A 4G8LA 1K1BA 4K5BA 4ZFHA 4CYMD 2XEHA 1K1AA 1IKND 2Y1LE 3TWSA 3TWXA 5BXOA 2Y0BG 1AP7A 4TUMA 1K3ZD 4OAVB 1MJ0A 5HS0A 5KWDA 2FO1E 1DCQA 3UI2A 4HBDA 4LNUD 4BERA 2DZOA 5KNGA 2BKKB 4ATZD 3EHRA 4QQIA 3Q9UC 5ENOD 2ETAA 3UXGA 1TR4A 5AQBA 3JXIA 2NYJA 4HLLA 4DX5D 3NBNB 3T8KA 4HRMB 4F1PA 1S70B 3DEPA 2JABA 3C5RA 5AQ7A 4F6RD 2ZGDA 3LJNA 1BU9A 3AAAC 5ENQD 1IHBA 5AAOA 1BLXB 1SVXA 4U95D 5FIOA 2HE0A 4N5QA 5HKPA 2P2CP 1G3NB 1UOHA 4K5AB 1N0RA 4G8KA 4YDYA 3V79K 5BXUA 5CBNA 1WG0A 4HRLA 3ZUVB 4GMRA 3W9FA 4HB5A 2KBXA 3F6QA 2XEEA 3HRAA 3V31A 5CEDB 4ZHBA 5ITZF 2PNNA 2QYJA 1IXVA 5EIBE 4HRNA 3TWQA 5EYPF 2V4HC 5ENSD 2KXPC 5AARA 2MYOA 1YCSB 3V30A 4RLYA 1MX2A 1OY3D 1MX4A 3TWWA 3V2XA 2RFAA 2ETCA 4A63B 5ENPD 1D9SA 4BESA 3V2OA 4Z68A 5AQ9A 4NIKA 4OAUC
chains in the Genus database with same CATH superfamily
4HI8A 4AY6A 4DX1A 3MX3A 2X6IA 2XZTG 5CCMA 3IV0A 3NOGD 3NZSA 5CERB 4PS8A 2VQ2A 3SBTB 4GPMA 4G2VA 3DWLG 4GTVA 2XENA 3QDNA 3UT4A 4L2LA 4UQZA 3DSSA 3SQVA 2M63A 4XEIG 1SW6A 3HDXA 4U8VD 4CDRA 3RO3A 3NQPA 2ZIRA 1SQMA 4EZKA 4HXIA 4AXHA 4WNGA 4HOQA 3AS5A 3ESLA 3Q4AB 5G05C 1OWNA 4GTMA 4TXRA 4A3VA 3RRUA 4J8EA 1HF8A 4PDXA 5AQ7A 3C5RA 3OTNA 2CHXA 4GTPA 5G05J 4ANXA 3FU5A 2UY1B 4CRWA 3FTUA 2HO1A 4A1GA 3L82A 3UT7A 3ASGA 1E8WA 5KCMA 1HS6A 2IOLA 4CGVA 2DYRE 3LKUA 1EF1C 5CRVA 3FUFA 5FTPA 2CHZA 3DEOA 2VJ8A 2QZAA 4QFVA 1QQEA 1KT1A 2L9BA 4JB8P 1OCOE 2X6KA 4B8AA 3L9TA 3Q75A 3GZ2A 1MHQA 2CG3A 3HXCA 3TXNA 3TWVA 3TWRA 3GW4A 4DPRA 3EUVA 4I6GA 4J8DA 2WXMA 4KVOA 2ETBA 4NRHB 3QAQA 1HH8A 5FQ6A 1E7UA 4ZFHA 3L08A 3MV3B 1H2UA 1Q2ZA 2WXPA 3SI5A 4C9BB 3PREA 4UI9C 4EECA 4J8SA 5ENOD 4GTOA 3UUXA 3UKRG 5J08A 1WY6A 1KZOA 4G24A 4F6RD 1BU9A 3L17A 4BWRA 4K5AB 4G11A 4UI9J 3PS6A 1SA5A 2LAIA 5LOZA 4HLEA 2NXPA 4Y6WA 2GRPB 3I4GA 4J8FA 4HOSA 1MX4A 4GCNA 5G2NA 4J6IA 4MS6A 4NQ0A 3V2OA 4FA6A 2P9SG 4IULA 3IXEA 4J7WA 3QNKA 5EKQD 1VDYA 2YHCA 2DVWA 4GMJA 3FFLA 1HZ4A 3L6AA 3GZ1A 5D66A 2WXLA 3JUEA 1HG5A 1N94A 5A23A 2Y4TA 4JEHA 3U9WA 4BSZB 2AJAA 2VGXA 2VTBA 2R5SA 3OAWA 4FJZA 3AG4E 1OWLA 3D9MA 3PEUB 3QWWA 3CVPA 4LSZE 5IY5E 2JLBA 1H6PA 3KSQA 3ABLE 4JC8A 3S7JA 5E75A 4G8LA 4HVBA 3L54A 2Y0BG 3MCXA 3BQOA 1O1SA 2PZIA 3DSTA 2PM6A 3E37A 2NC9A 2BKKB 2GRNB 2KM4A 2IOSA 3RO2A 5HQ8A 2XCBA 2XPZA 5KJNA 3SFXA 3EDTB 1S70B 4KYOB 4N5QA 3VTYA 2KZTA 1U3DA 4N3AA 5JJ6A 3ML9A 3ABKE 2WXIA 4EBAA 3F6QA 4LNBA 4UI9K 4W9RA 5EYPF 3TXMA 3TL5A 3KSLA 3UMVA 4HFGA 5CEAA 3FUNA 2P9UG 5BXUA 2WXJA 3C3RA 3PUKA 5CBOA 1P5QA 2EIME 2R05A 3CIAA 4EZJA 1ELWA 3ZU7B 4HORA 1QNFA 5HI7A 4N3BA 1LF8A 5BV1A 2AW6A 3FDHA 3D9KA 1E8XA 1H6OA 3I3NA 2FO7A 1N4QA 3CVQA 3B95A 3PE4A 2ZU6B 2J07A 3GZSA 3FWVA 4TV3A 3CVYA 4K5CA 2YNQA 3G2WA 4I1OB 3LXUX 4J8YA 1HXIA 3EJNA 1H19A 1S64A 3BUAA 3IKOB 2IQCA 3DSXA 5EILA 1V55E 1K1BA 1XGWA 4ILIA 3G2SA 2IF4A 5CRUA 3PRZA 3HIZA 4GZ6A 3RRMB 5FQ7A 3NF1A 3ULYA 2A5UA 3DBSA 3B7UX 5BPPA 3DEPA 3S7DA 2JABA 2JEKA 1IHBA 2LO6A 5E76A 5FIOA 4YVQC 2P2CP 4BFRA 1TYQG 1UOHA 3MKQB 1WG0A 1N52A 4YVOA 4I2ZA 2A4ZA 1YA0A 5T3RA 2AXUA 4EZLA 3UQ3A 3TWQA 1O1RA 5ENSD 5AARA 1E90A 4U07A 4ILGA 2P9KG 3HVEB 3J5QB 4LCTA 4DJAA 2J4BA 4I2WA 3RRNB 4L1BA 3BEEA 3C98A 1V54E 1AWCB 3DXMG 4BEPA 2EIKE 4O6FA 4WNEA 5KBAA 4XI9A 1U3CA 5C1DA 3T9KA 4KVMA 3SD5A 4Q96A 3Q78A 4EPZA 4GZCA 3CHMA 3E4BA 4L7TA 3ULQA 4F7AA 3U64A 1ZBPA 3MV2B 5A6CA 3L22A 5ARFA 2ZGGA 3DRAA 1NA3A 2XS8A 2WVIA 1TNBA 5FZRA 3I5PA 1ZU2A 2DWZA 1K8KG 1ELRA 2Q7FA 3TWSA 4C0EA 3EU5A 4I6EA 3OXLA 1TN7A 2FO1E 4AIFA 3SZ7A 4TUUA 2F0YA 3PDNA 2XRZA 5DBKA 2QY7A 3UM0A 4DX5D 2YQ8A 3UPVA 3PZDA 3FUMA 3CVLA 2KCKA 4U0SA 2CFUA 1O1TA 3PEVB 3ZEFA 3C3QA 3B7SA 4JHJA 4UQXA 3FUHA 3MA5A 5ITZF 2BTDA 1FVFA 2KXPC 4OAUC 1RZ4A 2WXFA 5A7DB 2RG8A 1BD8A 2FF4A 4JA9A 3AS4A 3E34A 1N54A 1MYOA 2J9QA 2WXRA 1KT0A 2LSVA 5C2YA 4YDOA 3EIQC 3APCA 1QYMA 4ANVA 3AG2E 2WXQA 3K9IA 4C48B 4G23A 4GMLA 4HS2A 3ZHEA 2VTBB 2OV8A 3ONLA 5KJLA 4YDWA 3URZA 3SO8A 2DIWA 4GYWA 3S7FA 3D9OA 4WNFA 3E33A 3ULEG 2AXVA 2X6HA 5AJDA 1DCQA 4LNUD 3MZLB 3QKYA 2FULA 2EQXA 2VSYA 1OUVA 3VTXA 1NZNA 4OVUA 3UT8A 3AAAC 1Y8MA 2MOWA 1LD8A 2DYSE 4LNGA 3CVVA 3BG1B 1N0RA 4Y6CA 3ZYMA 3R7RA 4APOA 4HRNA 1NI1A 1DNPA 1NL4A 3I4RB 1PAQA 5JJTA 3V2XA 4A63B 1UW4B 2GW1A 3GYZA 4N3CA 2XEVA 5JJ7A 2F37A 1HX8A 2IFUA 2EINE 2XCCA 3Q5MA 3FUEA 2GRQB 4EBAG 1UJJA 2XPIA 2A5EA 4HOUA 2KATA 5ENNA 2H6IA 4L2YA 4OVVA 4U7EB 3CK9A 1OWOA 1YYHA 2HR2A 4KZCA 3D9LA 4N2QA 3EU9A 4I43A 2H6FA 1TJCA 4JW1A 4O60A 2BEDA 3CV0A 3FEYA 3HXDA 2GRRB 1HU3A 3FY4A 1DCEA 2VGEA 4TXQA 1OCCE 3B7RL 4ACLA 5CMWA 2XEHA 2Y1LE 1MJ0A 3N71A 1PC2A 3HXFA 2AVPA 5KNGA 3EHRA 3UXGA 3ESKA 3LY7A 4BT9A 4HLLA 2KCLA 3T8KA 4CT4A 3DSWA 2J09A 2ZGDA 2X6JA 3AG1E 3CHSA 4J0UA 5FZSA 4Q94A 3IHYA 1EPUA 4BTBA 3FU3A 4KXKB 2R17C 3O48A 5D0OD 4A1SA 3VLEA 1YCSB 1OY3D 3SNXA 2R03A 3NZUA 3QOUA 4I9EA 4CEMA 3CHOA 3PNLB 3CHPA 3RK6A 4GZ5A 4URKA 3PUJA 2PL2A 3Q79A 2YINA 3CVUA 3J5PA 4CGWA 1HFAA 3UKUG 3CVNA 4DX6D 3FTVA 3TAXA 5JA4D 3LYAA 1WDYA 4U8HA 1KPSB 2ZISA 4GTSA 3ZKJA 4PS7A 1O5MA 2QC9A 3AG3E 4FLHA 5ANLA 3FH8A 4N2SA 1WM5A 3JQ0A 2WXGA 4RSYA 2X3MA 4EQFA 1HO8A 2E0IA 3D9NA 3IEGA 4CYMD 3FEXA 3R9MA 3Q15A 2L0IA 4KBQA 4MKTA 1OCZE 2I2OA 2YHEA 3RSEG 2XS1A 4FULA 1B89A 3CLJA 4WWPA 3FH7A 5AQBA 3U3WA 3ENEA 3TGOA 5ENQD 4UWFA 3WXXA 4BX9A 1QZ2A 4GAAA 4DLQA 5G04J 3W9FA 2KBXA 3CSFA 4RQIA 3MKRA 3ASDA 4RVBA 4GTTA 2LSUA 1IQUA 2FEZA 4RLYA 2RFAA 4UWHA 4FJYA 3FU0A 3L13A 3CVXA 5LFAA 2KC7A 1TEZA 2ILRA 4JHRA 2V8SE 3UIOC 1HG2A 5BNWA 3U4TA 1MQSA 1KZPA 3PH0C 1LD7A 3QARA 1JPLA 4KMOA 2R02A 4I17A 2CG2A 1N9AA 2IO3C 5ENTD 4LRZA 5B1AE 3MGBA 3NOCD 3HXEA 2QFCA 4BETA 4RG9A 4K5BA 4B89A 2VSXE 5D2MC 3PVLA 3ZXPA 4DLOA 2UWJG 2DZOA 2J08A 1KLXA 4IRUA 3T5VA 3NBNB 2OVFA 4U0ZA 1RW2A 3DXKG 1JUQA 3Q47B 4CT0A 4UQYA 3R7QA 4IYPA 1FCHA 1FT2A 4K03A 3KS2A 1H2TC 3G2TA 3SFZA 4HB5A 4WWOA 4GYYA 5EDSA 3QWVA 2H6GA 4AJWA 4ABNA 3CR3A 3CQGB 5EIBE 1Z5SC 4ACKA 4OYSA 3V30A 3EHMA 2Y69E 5ENPD 2MHKA 3ONKA 4LEUA 4XX5A 1FT1A 1TN8A 2PQNA 4N39A 4XZ4A 2GROB 4EHMA 3LPZA 1UN8A 2L6BA 3E30A 3SFYA 3HG0D 3ZYLA 2P9IG 3CVWA 2AXZA 1E8ZA 1YMPA 3ZYQA 1JWFA 3JQ1A 2EIJE 1Z3YA 2C0MA 5FQ4A 3FTWA 3UM2A 5LX8A 4GTRA 3NB2A 5AQAA 5H7PA 3ASHA 3Q9NC 1JWGA 4HQDA 4CDNA 4DX7D 2F8YA 3ZW3A 3PZ1A 3WG7E 1W3BA 2H6HA 4OAVB 2GRLA 2FI7A 4BERA 4BX8A 1E96B 4ATZD 1PY1A 2PQRA 4X8QA 2C2LA 2IONA 4YDEA 2XPYA 3ZXSA 4ANWA 4F1PA 1N4RA 4M7CA 5JHAA 2Y4UA 4PS3A 2CHWA 3JYSA 1FPPA 3AU5A 4LUNU 4G25A 2QYJA 4ILHB 4FU3A 3NAWA 4KT6B 2I9CA 1GW6A 1XNFA 3V79K 3O4ZA 3T5XA 2HM8A 5LCWC 4DK5A 4L23A 4UUCA 1UN9A 3X2QE 2RFMA 5CECB 3D9HA 4F1SA 3P2BA 4H7XA 4GA2A 3BG0B 4IN3B 1H2VC 5LCWJ 4C0MA 1ELKA 3QK0A 3ABME 2Y3AA 2WM9A 3LCAA 4U8YD 1LTXA 4O1PA 2DCPA 2OOEA 2WMOA 4O1OA 5FJYA 2E2EA 1E7VA 2XHEA 3FUKA 2R59A 3LVRE 3B13A 3IHVA 3FTYA 1OT8A 1X81A 2XGOA 4P29A 1D8EA 2ETAA 1N4SA 2EILE 2VGXB 4BY6A 3CK7A 3P1UA 3DSUA 5FQ8A 4XKCA 3LJNA 4AP2A 1BLXB 2HE0A 4AOFA 4JPSA 5T4YA 5EX3A 3CKBA 3FUDA 2PM7A 2WB2A 4XI0A 2PNNA 1IXVA 4UWKA 3FTZA 3Q7AA 2V4HC 3ZYKA 3ZRHA 2X6FA 4I1MA 4TRQA 4BESA 4WAFA 4DUIA 4HNAD 2L0TB 4E85A 3LVQE 2IJGX 5ENRD 2KZTB 2LXMA 4JVSA 4MLPA 5HRYA 2IO2C 2RKKA 1E8YA 2J49A 5AYWD 5EYLA 5EX0A 3ASFA 4MBGA 2OEWA 1N0QA 5EIDA 3SHFA 3QB2A 2LAHA 2VGYA 3D9PA 3B7BA 4NACA 4I6JA 5EN5D 4DRXE 2I6HA 2P9PG 4FHKA 4AEZC 4I9CA 4UWGA 1BI7B 2I1JA 3S7BA 5AN8A 3MKQA 1X5BA 2C0LA 3TG5A 4LERA 3CK8A 3APFA 3LY9A 4DI4A 3SY2A 4JEUA 5HS0A 5D0QD 3UI2A 1TNUA 3D3MA 4CCAA 3SBSA 3HVEA 1OWMA 3D9IA 3FH5A 4JA7A 1SVXA 5HKPA 2QYUA 1QBQA 1G3NB 4APFA 2X38A 2CFZA 3LY8A 3CHQA 2OCCE 2ONDA 2L6JA 3V31A 1OCRE 4ZHBA 3JUIA 1HE8A 3RIBA 3C3OA 3HYMB 2B6CA 4GU5A 1IYGA 4I1AA 3CGHA 5BW8C 4L9PA 1D9SA 3OXFA 4Z68A 5AQ9A 3MYVA 2OEVA 3ZGQA 3G2UA 5B1BE 5FINA 3ZVVA 5FZQA 1N11A 5AENA 2IY0C 3KEAA 3JCKC 3AJIA 1INZA 3EHQA 3RJVA 1NFIE 3Q49B 1JCSA 3R9AB 5M72A 1WAO1 4XE0A 1S0PA 3RAUA 1A5EA 2BUGA 4DX2A 4BTAA 4E6HA 4B93B 2WQ7A 1S63A 4A55A 2AWIA 2HYZA 4JL0A 3Q73A 4F3VA 2R2LA 4AVXA 4ME2A 4FP7A 4FC8A 4B0ZA 1IKND 5BXOA 3DSVA 3SGHA 3DPYA 4A3TA 3ML8A 3PZ4A 4D10C 4HRMB 3HHMA 3PE3A 4BSXA 4YDYA 3T8MA 3TG4A 5JHBA 1N4PA 2IU1A 1TNOA 4PUCA 2KCVA 1NP7A 1SA4A 1IHGA 4JXTA 1TN6A 5G04C 3MJWA 2XGMA 4YNDA 4N5CA 5B3SE 2ETCA 2WMNA 3MEKA 4U63A 4GA0A 3KD7A 4JD2G 5BUZA 1UJKA 3FUJA 4V3IA 1OWPA 3W9GA 3ZN3A 1OXJA 1DC2A 2DZNA 1BI8B 4U96D 4WWNA 4F53A 2VYIA 5AIJA 4TXPA 2GRMA 3JXJA 4WUYA 3QWPA 1N95A 4H7YA 5KJKA 2XQ0A 4NURA 1AP7A 2WXKA 2XGSA 4TUMA 1K3ZD 5LP0A 4AY5A 5CCLA 3EHNA 3PZ3A 1TNYA 4QQIA 3Q9UC 3E32A 1UG3A 2LUHA 1EDUA 3UM3A 4DI3A 1ZB1A 3EIJA 2UY1A 1D8DA 2NSZA 3ZHEB 5AAOA 4U95D 4KZ0A 4G8KA 3FP3A 3CEQA 3ZUVB 4GMRA 2XEEA 3HRAA 2WXNA 1H0AA 4GZDA 1JCRA 3S2AA 4GA1A 5CMYA 4B94A 2WQ6A 2V0PA 2BF0X 3SF4A 2FBNA 2J8SD 2V5FA 4ANUA 3HXBA 3ZNGA 1Y6IA 3B7TA 1TNZA 3RKVA 4XKBA 4GB9A 4HI9A 4CZ2D 3C72A 4BT8A 3AS8A 2WXOA 3PNTB 3OXGA 3LS8A 2LXLA 1SZAA 3LEWA 2BKGA 3FTXA 2V5QC 4FADA 4JHKA 5KJMA 2F8XK 4FLBA 3BU8A 1SZ9A 1H6KA 2V4LA 3U66A 5JMND 4G1TA 3KAEA 3CQCB 3ISMC 3QC1A 3LJ3A 3UX4A 3CSTA 2XZDG 3ZIMA 1A17A 1U2VG 3FU6A 3TWXA 1K1AA 3AU4A 4XIFA 4M3OA 2WQHA 3CKCA 5BT1A 3LDZA 5BV0A 3ZPJA 5CHEE 4GCOA 4GYOA 4G26A 3IBEA 3VLDA 5CBNA 2J4DA 5J90A 1NA0A 2GGFA 3PZ2A 2MRIA 2OVBA 2WXHA 1JCQA 2P58C 1EYHA 4GZ3A 3D9JA 4K0RA 1Z6TA 2MYOA 4U04A 3Q7FA 1MX2A 2XRYA 3FHEA 4ATGA 4NIKA 2P9NG 2VSOE 3KEZA 2WPVA 3UINC 1L5JA 4RG6A 3QJZA 3UIPC 4WNDA 3FULA 1MX6A 3TWUA 3CHRA 3DPDA 5KNHD 2IEJA 2B0OE 4LG6A 3UTMA 3VLFA 5ANRA 4Q69A 4AM9A 4UWLA 3TWTA 3APDA 2RD0A 4GPKA 1DVPA 4R7LA 5T8IA 3ZFWA 4JZYA 5KWDA 4HBDA 3RU0A 3UM1A 5FT9A 1FVHA 1TR4A 4PH4B 5ARGA 4HOTA 3G2VA 3JXIA 2NYJA 5FWQA 4CDMA 3TJPA 3ASOE 1IQRA 5DIZA 2LNIA 1MZCA 3L16A 4HRLA 4B8CB 2ZXWE 5G55A 2VSNA 3ASNE 4AV7A 4U0UA 5AJLA 5CEDB 2P9LG 1BPOA 3FTSA 4MRUA 1TJFA 4GTQA 2I1KA 2DBAA 3FUIA 3TWWA 1Z3XA 4FHJA
chains in the Genus database with same CATH topology
3J5QB 4DUIA 4HNAD 4HI8A 3IXEA 4J7WA 4DX1A 2F37A 2XZTG 2J8SD 5FINA 5ENRD 1AWCB 3NOGD 5CBOA 3ZNGA 5CERB 1BD8A 3DEOA 4BEPA 2L6BA 4UUCA 5HRYA 2DVWA 3J5PA 1N11A 2RFMA 3HG0D 5CECB 5KBAA 3D9HA 3ZU7B 4HI9A 4GPMA 3KEAA 4CZ2D 3AJIA 3T9KA 4QFVA 2A5EA 4DX6D 2XENA 3EHQA 1MYOA 5EYLA 5D66A 3JUEA 1YMPA 1MX6A 3TWUA 2BKGA 4JB8P 5JA4D 1NFIE 1YYHA 1N0QA 4BSZB 3W9GA 5CEAA 1WDYA 1QYMA 3B95A 2AJAA 2V5QC 5EIDA 3EU9A 3ZKJA 5KNHD 1DC2A 4U8YD 4C48B 1SW6A 2B0OE 2DZNA 4O1PA 4O60A 2F8XK 4LG6A 1BI8B 4K5CA 4O1OA 3B7BA 2QC9A 4U96D 2ZGGA 3TWRA 3TWVA 3UTMA 4DX2A 1A5EA 5EN5D 4DRXE 4J8YA 5JMND 5AQAA 4U8VD 4B93B 4LSZE 1BI7B 5ENTD 3Q9NC 4YDWA 5AN8A 2VGEA 3NOCD 4HQDA 2ETBA 3JXJA 3TWTA 2DWZA 2XZDG 3SO8A 4DX7D 2F8YA 4BETA 5EILA 1OT8A 4G8LA 1K1BA 4K5BA 4ZFHA 4CYMD 2XEHA 1K1AA 1IKND 2Y1LE 3TWSA 3TWXA 5BXOA 2Y0BG 1AP7A 4TUMA 1K3ZD 4OAVB 1MJ0A 5HS0A 5KWDA 2FO1E 1DCQA 3UI2A 4HBDA 4LNUD 4BERA 2DZOA 5KNGA 2BKKB 4ATZD 3EHRA 4QQIA 3Q9UC 5ENOD 2ETAA 3UXGA 1TR4A 5AQBA 3JXIA 2NYJA 4HLLA 4DX5D 3NBNB 3T8KA 4HRMB 4F1PA 1S70B 3DEPA 2JABA 3C5RA 5AQ7A 4F6RD 2ZGDA 3LJNA 1BU9A 3AAAC 5ENQD 1IHBA 5AAOA 1BLXB 1SVXA 4U95D 5FIOA 2HE0A 4N5QA 5HKPA 2P2CP 1G3NB 1UOHA 4K5AB 1N0RA 4G8KA 4YDYA 3V79K 5BXUA 5CBNA 1WG0A 4HRLA 3ZUVB 4GMRA 3W9FA 4HB5A 2KBXA 3F6QA 2XEEA 3HRAA 3V31A 5CEDB 4ZHBA 5ITZF 2PNNA 2QYJA 1IXVA 5EIBE 4HRNA 3TWQA 5EYPF 2V4HC 5ENSD 2KXPC 5AARA 2MYOA 1YCSB 3V30A 4RLYA 1MX2A 1OY3D 1MX4A 3TWWA 3V2XA 2RFAA 2ETCA 4A63B 5ENPD 1D9SA 4BESA 3V2OA 4Z68A 5AQ9A 4NIKA 4OAUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J5Q B;  4DUI A;  4HNA D;  4HI8 A;  3IXE A;  4J7W A;  4DX1 A;  2F37 A;  2XZT G;  2J8S D;  5FIN A;  5ENR D;  1AWC B;  3NOG D;  5CBO A;  3ZNG A;  5CER B;  1BD8 A;  3DEO A;  4BEP A;  2L6B A;  4UUC A;  5HRY A;  2DVW A;  3J5P A;  1N11 A;  2RFM A;  3HG0 D;  5CEC B;  5KBA A;  3D9H A;  3ZU7 B;  4HI9 A;  4GPM A;  3KEA A;  4CZ2 D;  3AJI A;  3T9K A;  4QFV A;  2A5E A;  4DX6 D;  2XEN A;  3EHQ A;  1MYO A;  5EYL A;  5D66 A;  3JUE A;  1YMP A;  1MX6 A;  3TWU A;  2BKG A;  4JB8 P;  5JA4 D;  1NFI E;  1YYH A;  1N0Q A;  4BSZ B;  3W9G A;  5CEA A;  1WDY A;  1QYM A;  3B95 A;  2AJA A;  2V5Q C;  5EID A;  3EU9 A;  3ZKJ A;  5KNH D;  1DC2 A;  4U8Y D;  4C48 B;  1SW6 A;  2B0O E;  2DZN A;  4O1P A;  4O60 A;  2F8X K;  4LG6 A;  1BI8 B;  4K5C A;  4O1O A;  3B7B A;  2QC9 A;  4U96 D;  2ZGG A;  3TWR A;  3TWV A;  3UTM A;  4DX2 A;  1A5E A;  5EN5 D;  4DRX E;  4J8Y A;  5JMN D;  5AQA A;  4U8V D;  4B93 B;  4LSZ E;  1BI7 B;  5ENT D;  3Q9N C;  4YDW A;  5AN8 A;  2VGE A;  3NOC D;  4HQD A;  2ETB A;  3JXJ A;  3TWT A;  2DWZ A;  2XZD G;  3SO8 A;  4DX7 D;  2F8Y A;  4BET A;  5EIL A;  1OT8 A;  4G8L A;  1K1B A;  4K5B A;  4ZFH A;  4CYM D;  2XEH A;  1K1A A;  1IKN D;  2Y1L E;  3TWS A;  3TWX A;  5BXO A;  2Y0B G;  1AP7 A;  4TUM A;  1K3Z D;  4OAV B;  1MJ0 A;  5HS0 A;  5KWD A;  2FO1 E;  1DCQ A;  3UI2 A;  4HBD A;  4LNU D;  4BER A;  2DZO A;  5KNG A;  2BKK B;  4ATZ D;  3EHR A;  4QQI A;  3Q9U C;  5ENO D;  2ETA A;  3UXG A;  1TR4 A;  5AQB A;  3JXI A;  2NYJ A;  4HLL A;  4DX5 D;  3NBN B;  3T8K A;  4HRM B;  4F1P A;  1S70 B;  3DEP A;  2JAB A;  3C5R A;  5AQ7 A;  4F6R D;  2ZGD A;  3LJN A;  1BU9 A;  3AAA C;  5ENQ D;  1IHB A;  5AAO A;  1BLX B;  1SVX A;  4U95 D;  5FIO A;  2HE0 A;  4N5Q A;  5HKP A;  2P2C P;  1G3N B;  1UOH A;  4K5A B;  1N0R A;  4G8K A;  4YDY A;  3V79 K;  5BXU A;  5CBN A;  1WG0 A;  4HRL A;  3ZUV B;  4GMR A;  3W9F A;  4HB5 A;  2KBX A;  3F6Q A;  2XEE A;  3HRA A;  3V31 A;  5CED B;  4ZHB A;  5ITZ F;  2PNN A;  2QYJ A;  1IXV A;  5EIB E;  4HRN A;  3TWQ A;  5EYP F;  2V4H C;  5ENS D;  2KXP C;  5AAR A;  2MYO A;  1YCS B;  3V30 A;  4RLY A;  1MX2 A;  1OY3 D;  1MX4 A;  3TWW A;  3V2X A;  2RFA A;  2ETC A;  4A63 B;  5ENP D;  1D9S A;  4BES A;  3V2O A;  4Z68 A;  5AQ9 A;  4NIK A;  4OAU C; 
#chains in the Genus database with same CATH topology
 4HI8 A;  4AY6 A;  4DX1 A;  3MX3 A;  2X6I A;  2XZT G;  5CCM A;  3IV0 A;  3NOG D;  3NZS A;  5CER B;  4PS8 A;  2VQ2 A;  3SBT B;  4GPM A;  4G2V A;  3DWL G;  4GTV A;  2XEN A;  3QDN A;  3UT4 A;  4L2L A;  4UQZ A;  3DSS A;  3SQV A;  2M63 A;  4XEI G;  1SW6 A;  3HDX A;  4U8V D;  4CDR A;  3RO3 A;  3NQP A;  2ZIR A;  1SQM A;  4EZK A;  4HXI A;  4AXH A;  4WNG A;  4HOQ A;  3AS5 A;  3ESL A;  3Q4A B;  5G05 C;  1OWN A;  4GTM A;  4TXR A;  4A3V A;  3RRU A;  4J8E A;  1HF8 A;  4PDX A;  5AQ7 A;  3C5R A;  3OTN A;  2CHX A;  4GTP A;  5G05 J;  4ANX A;  3FU5 A;  2UY1 B;  4CRW A;  3FTU A;  2HO1 A;  4A1G A;  3L82 A;  3UT7 A;  3ASG A;  1E8W A;  5KCM A;  1HS6 A;  2IOL A;  4CGV A;  2DYR E;  3LKU A;  1EF1 C;  5CRV A;  3FUF A;  5FTP A;  2CHZ A;  3DEO A;  2VJ8 A;  2QZA A;  4QFV A;  1QQE A;  1KT1 A;  2L9B A;  4JB8 P;  1OCO E;  2X6K A;  4B8A A;  3L9T A;  3Q75 A;  3GZ2 A;  1MHQ A;  2CG3 A;  3HXC A;  3TXN A;  3TWV A;  3TWR A;  3GW4 A;  4DPR A;  3EUV A;  4I6G A;  4J8D A;  2WXM A;  4KVO A;  2ETB A;  4NRH B;  3QAQ A;  1HH8 A;  5FQ6 A;  1E7U A;  4ZFH A;  3L08 A;  3MV3 B;  1H2U A;  1Q2Z A;  2WXP A;  3SI5 A;  4C9B B;  3PRE A;  4UI9 C;  4EEC A;  4J8S A;  5ENO D;  4GTO A;  3UUX A;  3UKR G;  5J08 A;  1WY6 A;  1KZO A;  4G24 A;  4F6R D;  1BU9 A;  3L17 A;  4BWR A;  4K5A B;  4G11 A;  4UI9 J;  3PS6 A;  1SA5 A;  2LAI A;  5LOZ A;  4HLE A;  2NXP A;  4Y6W A;  2GRP B;  3I4G A;  4J8F A;  4HOS A;  1MX4 A;  4GCN A;  5G2N A;  4J6I A;  4MS6 A;  4NQ0 A;  3V2O A;  4FA6 A;  2P9S G;  4IUL A;  3IXE A;  4J7W A;  3QNK A;  5EKQ D;  1VDY A;  2YHC A;  2DVW A;  4GMJ A;  3FFL A;  1HZ4 A;  3L6A A;  3GZ1 A;  5D66 A;  2WXL A;  3JUE A;  1HG5 A;  1N94 A;  5A23 A;  2Y4T A;  4JEH A;  3U9W A;  4BSZ B;  2AJA A;  2VGX A;  2VTB A;  2R5S A;  3OAW A;  4FJZ A;  3AG4 E;  1OWL A;  3D9M A;  3PEU B;  3QWW A;  3CVP A;  4LSZ E;  5IY5 E;  2JLB A;  1H6P A;  3KSQ A;  3ABL E;  4JC8 A;  3S7J A;  5E75 A;  4G8L A;  4HVB A;  3L54 A;  2Y0B G;  3MCX A;  3BQO A;  1O1S A;  2PZI A;  3DST A;  2PM6 A;  3E37 A;  2NC9 A;  2BKK B;  2GRN B;  2KM4 A;  2IOS A;  3RO2 A;  5HQ8 A;  2XCB A;  2XPZ A;  5KJN A;  3SFX A;  3EDT B;  1S70 B;  4KYO B;  4N5Q A;  3VTY A;  2KZT A;  1U3D A;  4N3A A;  5JJ6 A;  3ML9 A;  3ABK E;  2WXI A;  4EBA A;  3F6Q A;  4LNB A;  4UI9 K;  4W9R A;  5EYP F;  3TXM A;  3TL5 A;  3KSL A;  3UMV A;  4HFG A;  5CEA A;  3FUN A;  2P9U G;  5BXU A;  2WXJ A;  3C3R A;  3PUK A;  5CBO A;  1P5Q A;  2EIM E;  2R05 A;  3CIA A;  4EZJ A;  1ELW A;  3ZU7 B;  4HOR A;  1QNF A;  5HI7 A;  4N3B A;  1LF8 A;  5BV1 A;  2AW6 A;  3FDH A;  3D9K A;  1E8X A;  1H6O A;  3I3N A;  2FO7 A;  1N4Q A;  3CVQ A;  3B95 A;  3PE4 A;  2ZU6 B;  2J07 A;  3GZS A;  3FWV A;  4TV3 A;  3CVY A;  4K5C A;  2YNQ A;  3G2W A;  4I1O B;  3LXU X;  4J8Y A;  1HXI A;  3EJN A;  1H19 A;  1S64 A;  3BUA A;  3IKO B;  2IQC A;  3DSX A;  5EIL A;  1V55 E;  1K1B A;  1XGW A;  4ILI A;  3G2S A;  2IF4 A;  5CRU A;  3PRZ A;  3HIZ A;  4GZ6 A;  3RRM B;  5FQ7 A;  3NF1 A;  3ULY A;  2A5U A;  3DBS A;  3B7U X;  5BPP A;  3DEP A;  3S7D A;  2JAB A;  2JEK A;  1IHB A;  2LO6 A;  5E76 A;  5FIO A;  4YVQ C;  2P2C P;  4BFR A;  1TYQ G;  1UOH A;  3MKQ B;  1WG0 A;  1N52 A;  4YVO A;  4I2Z A;  2A4Z A;  1YA0 A;  5T3R A;  2AXU A;  4EZL A;  3UQ3 A;  3TWQ A;  1O1R A;  5ENS D;  5AAR A;  1E90 A;  4U07 A;  4ILG A;  2P9K G;  3HVE B;  3J5Q B;  4LCT A;  4DJA A;  2J4B A;  4I2W A;  3RRN B;  4L1B A;  3BEE A;  3C98 A;  1V54 E;  1AWC B;  3DXM G;  4BEP A;  2EIK E;  4O6F A;  4WNE A;  5KBA A;  4XI9 A;  1U3C A;  5C1D A;  3T9K A;  4KVM A;  3SD5 A;  4Q96 A;  3Q78 A;  4EPZ A;  4GZC A;  3CHM A;  3E4B A;  4L7T A;  3ULQ A;  4F7A A;  3U64 A;  1ZBP A;  3MV2 B;  5A6C A;  3L22 A;  5ARF A;  2ZGG A;  3DRA A;  1NA3 A;  2XS8 A;  2WVI A;  1TNB A;  5FZR A;  3I5P A;  1ZU2 A;  2DWZ A;  1K8K G;  1ELR A;  2Q7F A;  3TWS A;  4C0E A;  3EU5 A;  4I6E A;  3OXL A;  1TN7 A;  2FO1 E;  4AIF A;  3SZ7 A;  4TUU A;  2F0Y A;  3PDN A;  2XRZ A;  5DBK A;  2QY7 A;  3UM0 A;  4DX5 D;  2YQ8 A;  3UPV A;  3PZD A;  3FUM A;  3CVL A;  2KCK A;  4U0S A;  2CFU A;  1O1T A;  3PEV B;  3ZEF A;  3C3Q A;  3B7S A;  4JHJ A;  4UQX A;  3FUH A;  3MA5 A;  5ITZ F;  2BTD A;  1FVF A;  2KXP C;  4OAU C;  1RZ4 A;  2WXF A;  5A7D B;  2RG8 A;  1BD8 A;  2FF4 A;  4JA9 A;  3AS4 A;  3E34 A;  1N54 A;  1MYO A;  2J9Q A;  2WXR A;  1KT0 A;  2LSV A;  5C2Y A;  4YDO A;  3EIQ C;  3APC A;  1QYM A;  4ANV A;  3AG2 E;  2WXQ A;  3K9I A;  4C48 B;  4G23 A;  4GML A;  4HS2 A;  3ZHE A;  2VTB B;  2OV8 A;  3ONL A;  5KJL A;  4YDW A;  3URZ A;  3SO8 A;  2DIW A;  4GYW A;  3S7F A;  3D9O A;  4WNF A;  3E33 A;  3ULE G;  2AXV A;  2X6H A;  5AJD A;  1DCQ A;  4LNU D;  3MZL B;  3QKY A;  2FUL A;  2EQX A;  2VSY A;  1OUV A;  3VTX A;  1NZN A;  4OVU A;  3UT8 A;  3AAA C;  1Y8M A;  2MOW A;  1LD8 A;  2DYS E;  4LNG A;  3CVV A;  3BG1 B;  1N0R A;  4Y6C A;  3ZYM A;  3R7R A;  4APO A;  4HRN A;  1NI1 A;  1DNP A;  1NL4 A;  3I4R B;  1PAQ A;  5JJT A;  3V2X A;  4A63 B;  1UW4 B;  2GW1 A;  3GYZ A;  4N3C A;  2XEV A;  5JJ7 A;  2F37 A;  1HX8 A;  2IFU A;  2EIN E;  2XCC A;  3Q5M A;  3FUE A;  2GRQ B;  4EBA G;  1UJJ A;  2XPI A;  2A5E A;  4HOU A;  2KAT A;  5ENN A;  2H6I A;  4L2Y A;  4OVV A;  4U7E B;  3CK9 A;  1OWO A;  1YYH A;  2HR2 A;  4KZC A;  3D9L A;  4N2Q A;  3EU9 A;  4I43 A;  2H6F A;  1TJC A;  4JW1 A;  4O60 A;  2BED A;  3CV0 A;  3FEY A;  3HXD A;  2GRR B;  1HU3 A;  3FY4 A;  1DCE A;  2VGE A;  4TXQ A;  1OCC E;  3B7R L;  4ACL A;  5CMW A;  2XEH A;  2Y1L E;  1MJ0 A;  3N71 A;  1PC2 A;  3HXF A;  2AVP A;  5KNG A;  3EHR A;  3UXG A;  3ESK A;  3LY7 A;  4BT9 A;  4HLL A;  2KCL A;  3T8K A;  4CT4 A;  3DSW A;  2J09 A;  2ZGD A;  2X6J A;  3AG1 E;  3CHS A;  4J0U A;  5FZS A;  4Q94 A;  3IHY A;  1EPU A;  4BTB A;  3FU3 A;  4KXK B;  2R17 C;  3O48 A;  5D0O D;  4A1S A;  3VLE A;  1YCS B;  1OY3 D;  3SNX A;  2R03 A;  3NZU A;  3QOU A;  4I9E A;  4CEM A;  3CHO A;  3PNL B;  3CHP A;  3RK6 A;  4GZ5 A;  4URK A;  3PUJ A;  2PL2 A;  3Q79 A;  2YIN A;  3CVU A;  3J5P A;  4CGW A;  1HFA A;  3UKU G;  3CVN A;  4DX6 D;  3FTV A;  3TAX A;  5JA4 D;  3LYA A;  1WDY A;  4U8H A;  1KPS B;  2ZIS A;  4GTS A;  3ZKJ A;  4PS7 A;  1O5M A;  2QC9 A;  3AG3 E;  4FLH A;  5ANL A;  3FH8 A;  4N2S A;  1WM5 A;  3JQ0 A;  2WXG A;  4RSY A;  2X3M A;  4EQF A;  1HO8 A;  2E0I A;  3D9N A;  3IEG A;  4CYM D;  3FEX A;  3R9M A;  3Q15 A;  2L0I A;  4KBQ A;  4MKT A;  1OCZ E;  2I2O A;  2YHE A;  3RSE G;  2XS1 A;  4FUL A;  1B89 A;  3CLJ A;  4WWP A;  3FH7 A;  5AQB A;  3U3W A;  3ENE A;  3TGO A;  5ENQ D;  4UWF A;  3WXX A;  4BX9 A;  1QZ2 A;  4GAA A;  4DLQ A;  5G04 J;  3W9F A;  2KBX A;  3CSF A;  4RQI A;  3MKR A;  3ASD A;  4RVB A;  4GTT A;  2LSU A;  1IQU A;  2FEZ A;  4RLY A;  2RFA A;  4UWH A;  4FJY A;  3FU0 A;  3L13 A;  3CVX A;  5LFA A;  2KC7 A;  1TEZ A;  2ILR A;  4JHR A;  2V8S E;  3UIO C;  1HG2 A;  5BNW A;  3U4T A;  1MQS A;  1KZP A;  3PH0 C;  1LD7 A;  3QAR A;  1JPL A;  4KMO A;  2R02 A;  4I17 A;  2CG2 A;  1N9A A;  2IO3 C;  5ENT D;  4LRZ A;  5B1A E;  3MGB A;  3NOC D;  3HXE A;  2QFC A;  4BET A;  4RG9 A;  4K5B A;  4B89 A;  2VSX E;  5D2M C;  3PVL A;  3ZXP A;  4DLO A;  2UWJ G;  2DZO A;  2J08 A;  1KLX A;  4IRU A;  3T5V A;  3NBN B;  2OVF A;  4U0Z A;  1RW2 A;  3DXK G;  1JUQ A;  3Q47 B;  4CT0 A;  4UQY A;  3R7Q A;  4IYP A;  1FCH A;  1FT2 A;  4K03 A;  3KS2 A;  1H2T C;  3G2T A;  3SFZ A;  4HB5 A;  4WWO A;  4GYY A;  5EDS A;  3QWV A;  2H6G A;  4AJW A;  4ABN A;  3CR3 A;  3CQG B;  5EIB E;  1Z5S C;  4ACK A;  4OYS A;  3V30 A;  3EHM A;  2Y69 E;  5ENP D;  2MHK A;  3ONK A;  4LEU A;  4XX5 A;  1FT1 A;  1TN8 A;  2PQN A;  4N39 A;  4XZ4 A;  2GRO B;  4EHM A;  3LPZ A;  1UN8 A;  2L6B A;  3E30 A;  3SFY A;  3HG0 D;  3ZYL A;  2P9I G;  3CVW A;  2AXZ A;  1E8Z A;  1YMP A;  3ZYQ A;  1JWF A;  3JQ1 A;  2EIJ E;  1Z3Y A;  2C0M A;  5FQ4 A;  3FTW A;  3UM2 A;  5LX8 A;  4GTR A;  3NB2 A;  5AQA A;  5H7P A;  3ASH A;  3Q9N C;  1JWG A;  4HQD A;  4CDN A;  4DX7 D;  2F8Y A;  3ZW3 A;  3PZ1 A;  3WG7 E;  1W3B A;  2H6H A;  4OAV B;  2GRL A;  2FI7 A;  4BER A;  4BX8 A;  1E96 B;  4ATZ D;  1PY1 A;  2PQR A;  4X8Q A;  2C2L A;  2ION A;  4YDE A;  2XPY A;  3ZXS A;  4ANW A;  4F1P A;  1N4R A;  4M7C A;  5JHA A;  2Y4U A;  4PS3 A;  2CHW A;  3JYS A;  1FPP A;  3AU5 A;  4LUN U;  4G25 A;  2QYJ A;  4ILH B;  4FU3 A;  3NAW A;  4KT6 B;  2I9C A;  1GW6 A;  1XNF A;  3V79 K;  3O4Z A;  3T5X A;  2HM8 A;  5LCW C;  4DK5 A;  4L23 A;  4UUC A;  1UN9 A;  3X2Q E;  2RFM A;  5CEC B;  3D9H A;  4F1S A;  3P2B A;  4H7X A;  4GA2 A;  3BG0 B;  4IN3 B;  1H2V C;  5LCW J;  4C0M A;  1ELK A;  3QK0 A;  3ABM E;  2Y3A A;  2WM9 A;  3LCA A;  4U8Y D;  1LTX A;  4O1P A;  2DCP A;  2OOE A;  2WMO A;  4O1O A;  5FJY A;  2E2E A;  1E7V A;  2XHE A;  3FUK A;  2R59 A;  3LVR E;  3B13 A;  3IHV A;  3FTY A;  1OT8 A;  1X81 A;  2XGO A;  4P29 A;  1D8E A;  2ETA A;  1N4S A;  2EIL E;  2VGX B;  4BY6 A;  3CK7 A;  3P1U A;  3DSU A;  5FQ8 A;  4XKC A;  3LJN A;  4AP2 A;  1BLX B;  2HE0 A;  4AOF A;  4JPS A;  5T4Y A;  5EX3 A;  3CKB A;  3FUD A;  2PM7 A;  2WB2 A;  4XI0 A;  2PNN A;  1IXV A;  4UWK A;  3FTZ A;  3Q7A A;  2V4H C;  3ZYK A;  3ZRH A;  2X6F A;  4I1M A;  4TRQ A;  4BES A;  4WAF A;  4DUI A;  4HNA D;  2L0T B;  4E85 A;  3LVQ E;  2IJG X;  5ENR D;  2KZT B;  2LXM A;  4JVS A;  4MLP A;  5HRY A;  2IO2 C;  2RKK A;  1E8Y A;  2J49 A;  5AYW D;  5EYL A;  5EX0 A;  3ASF A;  4MBG A;  2OEW A;  1N0Q A;  5EID A;  3SHF A;  3QB2 A;  2LAH A;  2VGY A;  3D9P A;  3B7B A;  4NAC A;  4I6J A;  5EN5 D;  4DRX E;  2I6H A;  2P9P G;  4FHK A;  4AEZ C;  4I9C A;  4UWG A;  1BI7 B;  2I1J A;  3S7B A;  5AN8 A;  3MKQ A;  1X5B A;  2C0L A;  3TG5 A;  4LER A;  3CK8 A;  3APF A;  3LY9 A;  4DI4 A;  3SY2 A;  4JEU A;  5HS0 A;  5D0Q D;  3UI2 A;  1TNU A;  3D3M A;  4CCA A;  3SBS A;  3HVE A;  1OWM A;  3D9I A;  3FH5 A;  4JA7 A;  1SVX A;  5HKP A;  2QYU A;  1QBQ A;  1G3N B;  4APF A;  2X38 A;  2CFZ A;  3LY8 A;  3CHQ A;  2OCC E;  2OND A;  2L6J A;  3V31 A;  1OCR E;  4ZHB A;  3JUI A;  1HE8 A;  3RIB A;  3C3O A;  3HYM B;  2B6C A;  4GU5 A;  1IYG A;  4I1A A;  3CGH A;  5BW8 C;  4L9P A;  1D9S A;  3OXF A;  4Z68 A;  5AQ9 A;  3MYV A;  2OEV A;  3ZGQ A;  3G2U A;  5B1B E;  5FIN A;  3ZVV A;  5FZQ A;  1N11 A;  5AEN A;  2IY0 C;  3KEA A;  3JCK C;  3AJI A;  1INZ A;  3EHQ A;  3RJV A;  1NFI E;  3Q49 B;  1JCS A;  3R9A B;  5M72 A;  1WAO 1;  4XE0 A;  1S0P A;  3RAU A;  1A5E A;  2BUG A;  4DX2 A;  4BTA A;  4E6H A;  4B93 B;  2WQ7 A;  1S63 A;  4A55 A;  2AWI A;  2HYZ A;  4JL0 A;  3Q73 A;  4F3V A;  2R2L A;  4AVX A;  4ME2 A;  4FP7 A;  4FC8 A;  4B0Z A;  1IKN D;  5BXO A;  3DSV A;  3SGH A;  3DPY A;  4A3T A;  3ML8 A;  3PZ4 A;  4D10 C;  4HRM B;  3HHM A;  3PE3 A;  4BSX A;  4YDY A;  3T8M A;  3TG4 A;  5JHB A;  1N4P A;  2IU1 A;  1TNO A;  4PUC A;  2KCV A;  1NP7 A;  1SA4 A;  1IHG A;  4JXT A;  1TN6 A;  5G04 C;  3MJW A;  2XGM A;  4YND A;  4N5C A;  5B3S E;  2ETC A;  2WMN A;  3MEK A;  4U63 A;  4GA0 A;  3KD7 A;  4JD2 G;  5BUZ A;  1UJK A;  3FUJ A;  4V3I A;  1OWP A;  3W9G A;  3ZN3 A;  1OXJ A;  1DC2 A;  2DZN A;  1BI8 B;  4U96 D;  4WWN A;  4F53 A;  2VYI A;  5AIJ A;  4TXP A;  2GRM A;  3JXJ A;  4WUY A;  3QWP A;  1N95 A;  4H7Y A;  5KJK A;  2XQ0 A;  4NUR A;  1AP7 A;  2WXK A;  2XGS A;  4TUM A;  1K3Z D;  5LP0 A;  4AY5 A;  5CCL A;  3EHN A;  3PZ3 A;  1TNY A;  4QQI A;  3Q9U C;  3E32 A;  1UG3 A;  2LUH A;  1EDU A;  3UM3 A;  4DI3 A;  1ZB1 A;  3EIJ A;  2UY1 A;  1D8D A;  2NSZ A;  3ZHE B;  5AAO A;  4U95 D;  4KZ0 A;  4G8K A;  3FP3 A;  3CEQ A;  3ZUV B;  4GMR A;  2XEE A;  3HRA A;  2WXN A;  1H0A A;  4GZD A;  1JCR A;  3S2A A;  4GA1 A;  5CMY A;  4B94 A;  2WQ6 A;  2V0P A;  2BF0 X;  3SF4 A;  2FBN A;  2J8S D;  2V5F A;  4ANU A;  3HXB A;  3ZNG A;  1Y6I A;  3B7T A;  1TNZ A;  3RKV A;  4XKB A;  4GB9 A;  4HI9 A;  4CZ2 D;  3C72 A;  4BT8 A;  3AS8 A;  2WXO A;  3PNT B;  3OXG A;  3LS8 A;  2LXL A;  1SZA A;  3LEW A;  2BKG A;  3FTX A;  2V5Q C;  4FAD A;  4JHK A;  5KJM A;  2F8X K;  4FLB A;  3BU8 A;  1SZ9 A;  1H6K A;  2V4L A;  3U66 A;  5JMN D;  4G1T A;  3KAE A;  3CQC B;  3ISM C;  3QC1 A;  3LJ3 A;  3UX4 A;  3CST A;  2XZD G;  3ZIM A;  1A17 A;  1U2V G;  3FU6 A;  3TWX A;  1K1A A;  3AU4 A;  4XIF A;  4M3O A;  2WQH A;  3CKC A;  5BT1 A;  3LDZ A;  5BV0 A;  3ZPJ A;  5CHE E;  4GCO A;  4GYO A;  4G26 A;  3IBE A;  3VLD A;  5CBN A;  2J4D A;  5J90 A;  1NA0 A;  2GGF A;  3PZ2 A;  2MRI A;  2OVB A;  2WXH A;  1JCQ A;  2P58 C;  1EYH A;  4GZ3 A;  3D9J A;  4K0R A;  1Z6T A;  2MYO A;  4U04 A;  3Q7F A;  1MX2 A;  2XRY A;  3FHE A;  4ATG A;  4NIK A;  2P9N G;  2VSO E;  3KEZ A;  2WPV A;  3UIN C;  1L5J A;  4RG6 A;  3QJZ A;  3UIP C;  4WND A;  3FUL A;  1MX6 A;  3TWU A;  3CHR A;  3DPD A;  5KNH D;  2IEJ A;  2B0O E;  4LG6 A;  3UTM A;  3VLF A;  5ANR A;  4Q69 A;  4AM9 A;  4UWL A;  3TWT A;  3APD A;  2RD0 A;  4GPK A;  1DVP A;  4R7L A;  5T8I A;  3ZFW A;  4JZY A;  5KWD A;  4HBD A;  3RU0 A;  3UM1 A;  5FT9 A;  1FVH A;  1TR4 A;  4PH4 B;  5ARG A;  4HOT A;  3G2V A;  3JXI A;  2NYJ A;  5FWQ A;  4CDM A;  3TJP A;  3ASO E;  1IQR A;  5DIZ A;  2LNI A;  1MZC A;  3L16 A;  4HRL A;  4B8C B;  2ZXW E;  5G55 A;  2VSN A;  3ASN E;  4AV7 A;  4U0U A;  5AJL A;  5CED B;  2P9L G;  1BPO A;  3FTS A;  4MRU A;  1TJF A;  4GTQ A;  2I1K A;  2DBA A;  3FUI A;  3TWW A;  1Z3X A;  4FHJ A; 
#chains in the Genus database with same CATH homology
 3J5Q B;  4DUI A;  4HNA D;  4HI8 A;  3IXE A;  4J7W A;  4DX1 A;  2F37 A;  2XZT G;  2J8S D;  5FIN A;  5ENR D;  1AWC B;  3NOG D;  5CBO A;  3ZNG A;  5CER B;  1BD8 A;  3DEO A;  4BEP A;  2L6B A;  4UUC A;  5HRY A;  2DVW A;  3J5P A;  1N11 A;  2RFM A;  3HG0 D;  5CEC B;  5KBA A;  3D9H A;  3ZU7 B;  4HI9 A;  4GPM A;  3KEA A;  4CZ2 D;  3AJI A;  3T9K A;  4QFV A;  2A5E A;  4DX6 D;  2XEN A;  3EHQ A;  1MYO A;  5EYL A;  5D66 A;  3JUE A;  1YMP A;  1MX6 A;  3TWU A;  2BKG A;  4JB8 P;  5JA4 D;  1NFI E;  1YYH A;  1N0Q A;  4BSZ B;  3W9G A;  5CEA A;  1WDY A;  1QYM A;  3B95 A;  2AJA A;  2V5Q C;  5EID A;  3EU9 A;  3ZKJ A;  5KNH D;  1DC2 A;  4U8Y D;  4C48 B;  1SW6 A;  2B0O E;  2DZN A;  4O1P A;  4O60 A;  2F8X K;  4LG6 A;  1BI8 B;  4K5C A;  4O1O A;  3B7B A;  2QC9 A;  4U96 D;  2ZGG A;  3TWR A;  3TWV A;  3UTM A;  4DX2 A;  1A5E A;  5EN5 D;  4DRX E;  4J8Y A;  5JMN D;  5AQA A;  4U8V D;  4B93 B;  4LSZ E;  1BI7 B;  5ENT D;  3Q9N C;  4YDW A;  5AN8 A;  2VGE A;  3NOC D;  4HQD A;  2ETB A;  3JXJ A;  3TWT A;  2DWZ A;  2XZD G;  3SO8 A;  4DX7 D;  2F8Y A;  4BET A;  5EIL A;  1OT8 A;  4G8L A;  1K1B A;  4K5B A;  4ZFH A;  4CYM D;  2XEH A;  1K1A A;  1IKN D;  2Y1L E;  3TWS A;  3TWX A;  5BXO A;  2Y0B G;  1AP7 A;  4TUM A;  1K3Z D;  4OAV B;  1MJ0 A;  5HS0 A;  5KWD A;  2FO1 E;  1DCQ A;  3UI2 A;  4HBD A;  4LNU D;  4BER A;  2DZO A;  5KNG A;  2BKK B;  4ATZ D;  3EHR A;  4QQI A;  3Q9U C;  5ENO D;  2ETA A;  3UXG A;  1TR4 A;  5AQB A;  3JXI A;  2NYJ A;  4HLL A;  4DX5 D;  3NBN B;  3T8K A;  4HRM B;  4F1P A;  1S70 B;  3DEP A;  2JAB A;  3C5R A;  5AQ7 A;  4F6R D;  2ZGD A;  3LJN A;  1BU9 A;  3AAA C;  5ENQ D;  1IHB A;  5AAO A;  1BLX B;  1SVX A;  4U95 D;  5FIO A;  2HE0 A;  4N5Q A;  5HKP A;  2P2C P;  1G3N B;  1UOH A;  4K5A B;  1N0R A;  4G8K A;  4YDY A;  3V79 K;  5BXU A;  5CBN A;  1WG0 A;  4HRL A;  3ZUV B;  4GMR A;  3W9F A;  4HB5 A;  2KBX A;  3F6Q A;  2XEE A;  3HRA A;  3V31 A;  5CED B;  4ZHB A;  5ITZ F;  2PNN A;  2QYJ A;  1IXV A;  5EIB E;  4HRN A;  3TWQ A;  5EYP F;  2V4H C;  5ENS D;  2KXP C;  5AAR A;  2MYO A;  1YCS B;  3V30 A;  4RLY A;  1MX2 A;  1OY3 D;  1MX4 A;  3TWW A;  3V2X A;  2RFA A;  2ETC A;  4A63 B;  5ENP D;  1D9S A;  4BES A;  3V2O A;  4Z68 A;  5AQ9 A;  4NIK A;  4OAU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...